Index of /pub/php/manual/es/


../
feeds/                                             24-May-2024 14:02                   -
images/                                            24-May-2024 14:02                   -
styles/                                            24-May-2024 14:02                   -
toc/                                               24-May-2024 14:02                   -
about.formats.php                                  24-May-2024 14:02                4462
about.generate.php                                 24-May-2024 14:02                2746
about.howtohelp.php                                24-May-2024 14:02                3544
about.more.php                                     24-May-2024 14:02                1956
about.notes.php                                    24-May-2024 14:02                2491
about.php                                          24-May-2024 14:02                1994
about.phpversions.php                              24-May-2024 14:02                3659
about.prototypes.php                               24-May-2024 14:02                7489
about.translations.php                             24-May-2024 14:02                3374
aliases.php                                        24-May-2024 14:02               32886
allowdynamicproperties.construct.php               24-May-2024 14:02                2263
apache.configuration.php                           24-May-2024 14:02                5578
apache.constants.php                               24-May-2024 14:02                1214
apache.installation.php                            24-May-2024 14:02                1332
apache.requirements.php                            24-May-2024 14:02                1282
apache.resources.php                               24-May-2024 14:02                1286
apache.setup.php                                   24-May-2024 14:02                1702
apcu.configuration.php                             24-May-2024 14:02               16028
apcu.constants.php                                 24-May-2024 14:02                7598
apcu.installation.php                              24-May-2024 14:02                2940
apcu.requirements.php                              24-May-2024 14:02                1268
apcu.resources.php                                 24-May-2024 14:02                1272
apcu.setup.php                                     24-May-2024 14:02                1663
apcuiterator.construct.php                         24-May-2024 14:02                7190
apcuiterator.current.php                           24-May-2024 14:02                3062
apcuiterator.gettotalcount.php                     24-May-2024 14:02                3297
apcuiterator.gettotalhits.php                      24-May-2024 14:02                3458
apcuiterator.gettotalsize.php                      24-May-2024 14:02                3166
apcuiterator.key.php                               24-May-2024 14:02                2852
apcuiterator.next.php                              24-May-2024 14:02                3105
apcuiterator.rewind.php                            24-May-2024 14:02                2746
apcuiterator.valid.php                             24-May-2024 14:02                3008
appendices.php                                     24-May-2024 14:02               12880
appenditerator.append.php                          24-May-2024 14:02                5452
appenditerator.construct.php                       24-May-2024 14:02               10158
appenditerator.current.php                         24-May-2024 14:02                3502
appenditerator.getarrayiterator.php                24-May-2024 14:02                3123
appenditerator.getiteratorindex.php                24-May-2024 14:02                6643
appenditerator.key.php                             24-May-2024 14:02                7919
appenditerator.next.php                            24-May-2024 14:02                3401
appenditerator.rewind.php                          24-May-2024 14:02                3388
appenditerator.valid.php                           24-May-2024 14:02                3393
array.configuration.php                            24-May-2024 14:02                1347
array.constants.php                                24-May-2024 14:02               12144
array.installation.php                             24-May-2024 14:02                1319
array.requirements.php                             24-May-2024 14:02                1275
array.resources.php                                24-May-2024 14:02                1279
array.setup.php                                    24-May-2024 14:02                1667
array.sorting.php                                  24-May-2024 14:02                6908
arrayaccess.offsetexists.php                       24-May-2024 14:02                9167
arrayaccess.offsetget.php                          24-May-2024 14:02                5005
arrayaccess.offsetset.php                          24-May-2024 14:02                5167
arrayaccess.offsetunset.php                        24-May-2024 14:02                2847
arrayiterator.append.php                           24-May-2024 14:02                3537
arrayiterator.asort.php                            24-May-2024 14:02                7078
arrayiterator.construct.php                        24-May-2024 14:02                3776
arrayiterator.count.php                            24-May-2024 14:02                2974
arrayiterator.current.php                          24-May-2024 14:02                5228
arrayiterator.getarraycopy.php                     24-May-2024 14:02                3115
arrayiterator.getflags.php                         24-May-2024 14:02                3103
arrayiterator.key.php                              24-May-2024 14:02                4041
arrayiterator.ksort.php                            24-May-2024 14:02                7032
arrayiterator.natcasesort.php                      24-May-2024 14:02                4719
arrayiterator.natsort.php                          24-May-2024 14:02                4492
arrayiterator.next.php                             24-May-2024 14:02                4661
arrayiterator.offsetexists.php                     24-May-2024 14:02                3403
arrayiterator.offsetget.php                        24-May-2024 14:02                3439
arrayiterator.offsetset.php                        24-May-2024 14:02                3728
arrayiterator.offsetunset.php                      24-May-2024 14:02                3831
arrayiterator.rewind.php                           24-May-2024 14:02                4621
arrayiterator.seek.php                             24-May-2024 14:02                2660
arrayiterator.serialize.php                        24-May-2024 14:02                2925
arrayiterator.setflags.php                         24-May-2024 14:02                4145
arrayiterator.uasort.php                           24-May-2024 14:02                6454
arrayiterator.uksort.php                           24-May-2024 14:02                6218
arrayiterator.unserialize.php                      24-May-2024 14:02                3172
arrayiterator.valid.php                            24-May-2024 14:02                4698
arrayobject.append.php                             24-May-2024 14:02                5545
arrayobject.asort.php                              24-May-2024 14:02                6335
arrayobject.construct.php                          24-May-2024 14:02                7053
arrayobject.count.php                              24-May-2024 14:02                5467
arrayobject.exchangearray.php                      24-May-2024 14:02                6263
arrayobject.getarraycopy.php                       24-May-2024 14:02                5328
arrayobject.getflags.php                           24-May-2024 14:02                6122
arrayobject.getiterator.php                        24-May-2024 14:02                5321
arrayobject.getiteratorclass.php                   24-May-2024 14:02                6649
arrayobject.ksort.php                              24-May-2024 14:02                6102
arrayobject.natcasesort.php                        24-May-2024 14:02                7104
arrayobject.natsort.php                            24-May-2024 14:02                6975
arrayobject.offsetexists.php                       24-May-2024 14:02                4994
arrayobject.offsetget.php                          24-May-2024 14:02                5197
arrayobject.offsetset.php                          24-May-2024 14:02                6822
arrayobject.offsetunset.php                        24-May-2024 14:02                4303
arrayobject.serialize.php                          24-May-2024 14:02                5175
arrayobject.setflags.php                           24-May-2024 14:02                6848
arrayobject.setiteratorclass.php                   24-May-2024 14:02                5896
arrayobject.uasort.php                             24-May-2024 14:02                8741
arrayobject.uksort.php                             24-May-2024 14:02                8273
arrayobject.unserialize.php                        24-May-2024 14:02                3740
attribute.construct.php                            24-May-2024 14:02                2358
backedenum.from.php                                24-May-2024 14:02                6145
backedenum.tryfrom.php                             24-May-2024 14:02                6554
bc.configuration.php                               24-May-2024 14:02                2649
bc.constants.php                                   24-May-2024 14:02                1188
bc.installation.php                                24-May-2024 14:02                1506
bc.requirements.php                                24-May-2024 14:02                1254
bc.resources.php                                   24-May-2024 14:02                1258
bc.setup.php                                       24-May-2024 14:02                1659
book.apache.php                                    24-May-2024 14:02                3520
book.apcu.php                                      24-May-2024 14:02                4635
book.array.php                                     24-May-2024 14:02               12995
book.bc.php                                        24-May-2024 14:02                3263
book.bson.php                                      24-May-2024 14:02               19899
book.bzip2.php                                     24-May-2024 14:02                3132
book.calendar.php                                  24-May-2024 14:02                4345
book.classobj.php                                  24-May-2024 14:02                4618
book.cmark.php                                     24-May-2024 14:02                8765
book.com.php                                       24-May-2024 14:02                8132
book.componere.php                                 24-May-2024 14:02                6458
book.ctype.php                                     24-May-2024 14:02                3399
book.cubrid.php                                    24-May-2024 14:02               15366
book.curl.php                                      24-May-2024 14:02                6950
book.datetime.php                                  24-May-2024 14:02               16892
book.dba.php                                       24-May-2024 14:02                3678
book.dbase.php                                     24-May-2024 14:02                3320
book.dio.php                                       24-May-2024 14:02                3250
book.dir.php                                       24-May-2024 14:02                3305
book.dom.php                                       24-May-2024 14:02               21806
book.ds.php                                        24-May-2024 14:02               25195
book.eio.php                                       24-May-2024 14:02                8986
book.enchant.php                                   24-May-2024 14:02                5542
book.errorfunc.php                                 24-May-2024 14:02                3720
book.ev.php                                        24-May-2024 14:02               13520
book.event.php                                     24-May-2024 14:02               23450
book.exec.php                                      24-May-2024 14:02                3484
book.exif.php                                      24-May-2024 14:02                2653
book.expect.php                                    24-May-2024 14:02                2583
book.fann.php                                      24-May-2024 14:02               25841
book.fdf.php                                       24-May-2024 14:02                5689
book.ffi.php                                       24-May-2024 14:02                5720
book.fileinfo.php                                  24-May-2024 14:02                3227
book.filesystem.php                                24-May-2024 14:02               10758
book.filter.php                                    24-May-2024 14:02                3592
book.fpm.php                                       24-May-2024 14:02                2067
book.ftp.php                                       24-May-2024 14:02                6203
book.funchand.php                                  24-May-2024 14:02                3933
book.gearman.php                                   24-May-2024 14:02               16837
book.gender.php                                    24-May-2024 14:02                2711
book.geoip.php                                     24-May-2024 14:02                4451
book.gettext.php                                   24-May-2024 14:02                3096
book.gmagick.php                                   24-May-2024 14:02               24663
book.gmp.php                                       24-May-2024 14:02                6847
book.gnupg.php                                     24-May-2024 14:02                5126
book.hash.php                                      24-May-2024 14:02                3989
book.hrtime.php                                    24-May-2024 14:02                3637
book.ibase.php                                     24-May-2024 14:02               12132
book.ibm-db2.php                                   24-May-2024 14:02                9180
book.iconv.php                                     24-May-2024 14:02                3495
book.igbinary.php                                  24-May-2024 14:02                2218
book.image.php                                     24-May-2024 14:02               16900
book.imagick.php                                   24-May-2024 14:02               68466
book.imap.php                                      24-May-2024 14:02               10319
book.info.php                                      24-May-2024 14:02                8808
book.inotify.php                                   24-May-2024 14:02                2689
book.intl.php                                      24-May-2024 14:02               49488
book.json.php                                      24-May-2024 14:02                2964
book.ldap.php                                      24-May-2024 14:02                9560
book.libxml.php                                    24-May-2024 14:02                3310
book.lua.php                                       24-May-2024 14:02                2789
book.luasandbox.php                                24-May-2024 14:02                5647
book.lzf.php                                       24-May-2024 14:02                2305
book.mail.php                                      24-May-2024 14:02                2172
book.mailparse.php                                 24-May-2024 14:02                4185
book.math.php                                      24-May-2024 14:02                5697
book.mbstring.php                                  24-May-2024 14:02               11356
book.mcrypt.php                                    24-May-2024 14:02                6474
book.memcache.php                                  24-May-2024 14:02                4529
book.memcached.php                                 24-May-2024 14:02                9227
book.mhash.php                                     24-May-2024 14:02                2556
book.misc.php                                      24-May-2024 14:02                5586
book.mongodb.php                                   24-May-2024 14:02               26874
book.mqseries.php                                  24-May-2024 14:02                3252
book.mysql-xdevapi.php                             24-May-2024 14:02               29084
book.mysql.php                                     24-May-2024 14:02                8506
book.mysqli.php                                    24-May-2024 14:02               19519
book.mysqlnd.php                                   24-May-2024 14:02                2702
book.network.php                                   24-May-2024 14:02                6307
book.oauth.php                                     24-May-2024 14:02                7660
book.oci8.php                                      24-May-2024 14:02               17896
book.opcache.php                                   24-May-2024 14:02                2770
book.openal.php                                    24-May-2024 14:02                4691
book.openssl.php                                   24-May-2024 14:02               11123
book.outcontrol.php                                24-May-2024 14:02                4450
book.parallel.php                                  24-May-2024 14:02                5752
book.parle.php                                     24-May-2024 14:02                8848
book.password.php                                  24-May-2024 14:02                2748
book.pcntl.php                                     24-May-2024 14:02                5135
book.pcre.php                                      24-May-2024 14:02                4194
book.pdo.php                                       24-May-2024 14:02                8601
book.pgsql.php                                     24-May-2024 14:02               12665
book.phar.php                                      24-May-2024 14:02               17377
book.phpdbg.php                                    24-May-2024 14:02                2996
book.posix.php                                     24-May-2024 14:02                7161
book.ps.php                                        24-May-2024 14:02               10432
book.pspell.php                                    24-May-2024 14:02                4654
book.pthreads.php                                  24-May-2024 14:02                5529
book.quickhash.php                                 24-May-2024 14:02                8981
book.radius.php                                    24-May-2024 14:02                5654
book.random.php                                    24-May-2024 14:02                9159
book.rar.php                                       24-May-2024 14:02                5704
book.readline.php                                  24-May-2024 14:02                3895
book.recode.php                                    24-May-2024 14:02                2377
book.reflection.php                                24-May-2024 14:02               34829
book.rnp.php                                       24-May-2024 14:02                6130
book.rpminfo.php                                   24-May-2024 14:02                2568
book.rrd.php                                       24-May-2024 14:02                5579
book.runkit7.php                                   24-May-2024 14:02                4507
book.scoutapm.php                                  24-May-2024 14:02                2264
book.seaslog.php                                   24-May-2024 14:02                5269
book.sem.php                                       24-May-2024 14:02                4147
book.session.php                                   24-May-2024 14:02                8386
book.shmop.php                                     24-May-2024 14:02                2926
book.simdjson.php                                  24-May-2024 14:02                2708
book.simplexml.php                                 24-May-2024 14:02                5654
book.snmp.php                                      24-May-2024 14:02                5938
book.soap.php                                      24-May-2024 14:02                6502
book.sockets.php                                   24-May-2024 14:02                7289
book.sodium.php                                    24-May-2024 14:02               17389
book.solr.php                                      24-May-2024 14:02               56351
book.spl.php                                       24-May-2024 14:02               10197
book.sqlite3.php                                   24-May-2024 14:02                7681
book.sqlsrv.php                                    24-May-2024 14:02                5646
book.ssdeep.php                                    24-May-2024 14:02                2403
book.ssh2.php                                      24-May-2024 14:02                5603
book.stats.php                                     24-May-2024 14:02               11888
book.stomp.php                                     24-May-2024 14:02                4443
book.stream.php                                    24-May-2024 14:02               12595
book.strings.php                                   24-May-2024 14:02               14458
book.svm.php                                       24-May-2024 14:02                3764
book.svn.php                                       24-May-2024 14:02                8821
book.swoole.php                                    24-May-2024 14:02               37392
book.sync.php                                      24-May-2024 14:02                4858
book.taint.php                                     24-May-2024 14:02                2645
book.tcpwrap.php                                   24-May-2024 14:02                2133
book.tidy.php                                      24-May-2024 14:02                6883
book.tokenizer.php                                 24-May-2024 14:02                3197
book.trader.php                                    24-May-2024 14:02               19053
book.ui.php                                        24-May-2024 14:02               28800
book.uodbc.php                                     24-May-2024 14:02                7695
book.uopz.php                                      24-May-2024 14:02                5166
book.url.php                                       24-May-2024 14:02                3129
book.v8js.php                                      24-May-2024 14:02                3212
book.var.php                                       24-May-2024 14:02                6021
book.var_representation.php                        24-May-2024 14:02                2187
book.varnish.php                                   24-May-2024 14:02                5950
book.wddx.php                                      24-May-2024 14:02                2875
book.win32service.php                              24-May-2024 14:02                4094
book.wincache.php                                  24-May-2024 14:02                5875
book.wkhtmltox.php                                 24-May-2024 14:02                3451
book.xattr.php                                     24-May-2024 14:02                2571
book.xdiff.php                                     24-May-2024 14:02                4390
book.xhprof.php                                    24-May-2024 14:02                2545
book.xlswriter.php                                 24-May-2024 14:02                4466
book.xml.php                                       24-May-2024 14:02                5991
book.xmldiff.php                                   24-May-2024 14:02                3241
book.xmlreader.php                                 24-May-2024 14:02                5105
book.xmlrpc.php                                    24-May-2024 14:02                4031
book.xmlwriter.php                                 24-May-2024 14:02                6998
book.xsl.php                                       24-May-2024 14:02                4005
book.yac.php                                       24-May-2024 14:02                2742
book.yaconf.php                                    24-May-2024 14:02                2231
book.yaf.php                                       24-May-2024 14:02               37473
book.yaml.php                                      24-May-2024 14:02                2964
book.yar.php                                       24-May-2024 14:02                3844
book.yaz.php                                       24-May-2024 14:02                4775
book.zip.php                                       24-May-2024 14:02               10992
book.zlib.php                                      24-May-2024 14:02                5468
book.zmq.php                                       24-May-2024 14:02                5957
book.zookeeper.php                                 24-May-2024 14:02                6727
bzip2.configuration.php                            24-May-2024 14:02                1347
bzip2.constants.php                                24-May-2024 14:02                1200
bzip2.examples.php                                 24-May-2024 14:02                4134
bzip2.installation.php                             24-May-2024 14:02                1449
bzip2.requirements.php                             24-May-2024 14:02                1426
bzip2.resources.php                                24-May-2024 14:02                1334
bzip2.setup.php                                    24-May-2024 14:02                1688
cachingiterator.construct.php                      24-May-2024 14:02                2886
cachingiterator.count.php                          24-May-2024 14:02                2559
cachingiterator.current.php                        24-May-2024 14:02                2849
cachingiterator.getcache.php                       24-May-2024 14:02                5918
cachingiterator.getflags.php                       24-May-2024 14:02                2562
cachingiterator.hasnext.php                        24-May-2024 14:02                2674
cachingiterator.key.php                            24-May-2024 14:02                2238
cachingiterator.next.php                           24-May-2024 14:02                2475
cachingiterator.offsetexists.php                   24-May-2024 14:02                3040
cachingiterator.offsetget.php                      24-May-2024 14:02                2758
cachingiterator.offsetset.php                      24-May-2024 14:02                3135
cachingiterator.offsetunset.php                    24-May-2024 14:02                2803
cachingiterator.rewind.php                         24-May-2024 14:02                2486
cachingiterator.setflags.php                       24-May-2024 14:02                2842
cachingiterator.tostring.php                       24-May-2024 14:02                2650
cachingiterator.valid.php                          24-May-2024 14:02                2713
calendar.configuration.php                         24-May-2024 14:02                1368
calendar.constants.php                             24-May-2024 14:02                8676
calendar.installation.php                          24-May-2024 14:02                1553
calendar.requirements.php                          24-May-2024 14:02                1296
calendar.resources.php                             24-May-2024 14:02                1300
calendar.setup.php                                 24-May-2024 14:02                1728
callbackfilteriterator.accept.php                  24-May-2024 14:02                3650
callbackfilteriterator.construct.php               24-May-2024 14:02                4049
cc.license.php                                     24-May-2024 14:02               20781
changelog.misc.php                                 24-May-2024 14:02                1349
changelog.mysql.php                                24-May-2024 14:02                2662
changelog.mysql_xdevapi.php                        24-May-2024 14:02                2372
changelog.mysqli.php                               24-May-2024 14:02                1391
changelog.strings.php                              24-May-2024 14:02                1415
class.allowdynamicproperties.php                   24-May-2024 14:02                5003
class.apcuiterator.php                             24-May-2024 14:02                7568
class.appenditerator.php                           24-May-2024 14:02                7953
class.argumentcounterror.php                       24-May-2024 14:02                8688
class.arithmeticerror.php                          24-May-2024 14:02                8857
class.arrayaccess.php                              24-May-2024 14:02               11737
class.arrayiterator.php                            24-May-2024 14:02               17040
class.arrayobject.php                              24-May-2024 14:02               16699
class.assertionerror.php                           24-May-2024 14:02                8502
class.attribute.php                                24-May-2024 14:02                8598
class.backedenum.php                               24-May-2024 14:02                4313
class.badfunctioncallexception.php                 24-May-2024 14:02                8632
class.badmethodcallexception.php                   24-May-2024 14:02                8651
class.cachingiterator.php                          24-May-2024 14:02               17478
class.callbackfilteriterator.php                   24-May-2024 14:02               11627
class.closedgeneratorexception.php                 24-May-2024 14:02                8751
class.closure.php                                  24-May-2024 14:02                7038
class.collator.php                                 24-May-2024 14:02               35111
class.collectable.php                              24-May-2024 14:02                2577
class.com-exception.php                            24-May-2024 14:02                8430
class.com-safearray-proxy.php                      24-May-2024 14:02                1934
class.com.php                                      24-May-2024 14:02               12530
class.commonmark-cql.php                           24-May-2024 14:02                7371
class.commonmark-interfaces-ivisitable.php         24-May-2024 14:02                3018
class.commonmark-interfaces-ivisitor.php           24-May-2024 14:02                4613
class.commonmark-node-blockquote.php               24-May-2024 14:02                8466
class.commonmark-node-bulletlist.php               24-May-2024 14:02               10644
class.commonmark-node-code.php                     24-May-2024 14:02                9460
class.commonmark-node-codeblock.php                24-May-2024 14:02               10848
class.commonmark-node-customblock.php              24-May-2024 14:02                9215
class.commonmark-node-custominline.php             24-May-2024 14:02                9195
class.commonmark-node-document.php                 24-May-2024 14:02                8424
class.commonmark-node-heading.php                  24-May-2024 14:02                9825
class.commonmark-node-htmlblock.php                24-May-2024 14:02                9518
class.commonmark-node-htmlinline.php               24-May-2024 14:02                9494
class.commonmark-node-image.php                    24-May-2024 14:02               10733
class.commonmark-node-item.php                     24-May-2024 14:02                8433
class.commonmark-node-linebreak.php                24-May-2024 14:02                8447
class.commonmark-node-link.php                     24-May-2024 14:02               10726
class.commonmark-node-orderedlist.php              24-May-2024 14:02               11611
class.commonmark-node-paragraph.php                24-May-2024 14:02                8472
class.commonmark-node-softbreak.php                24-May-2024 14:02                8465
class.commonmark-node-text-emphasis.php            24-May-2024 14:02                8494
class.commonmark-node-text-strong.php              24-May-2024 14:02                8483
class.commonmark-node-text.php                     24-May-2024 14:02                9863
class.commonmark-node-thematicbreak.php            24-May-2024 14:02                8494
class.commonmark-node.php                          24-May-2024 14:02                9391
class.commonmark-parser.php                        24-May-2024 14:02                3871
class.compersisthelper.php                         24-May-2024 14:02                7502
class.compileerror.php                             24-May-2024 14:02                8458
class.componere-abstract-definition.php            24-May-2024 14:02                4825
class.componere-definition.php                     24-May-2024 14:02               10356
class.componere-method.php                         24-May-2024 14:02                4419
class.componere-patch.php                          24-May-2024 14:02                8443
class.componere-value.php                          24-May-2024 14:02                5582
class.countable.php                                24-May-2024 14:02                2617
class.curlfile.php                                 24-May-2024 14:02                7286
class.dateinterval.php                             24-May-2024 14:02                9020
class.dateperiod.php                               24-May-2024 14:02               11951
class.datetime.php                                 24-May-2024 14:02               21312
class.datetimeimmutable.php                        24-May-2024 14:02               20534
class.datetimeinterface.php                        24-May-2024 14:02               15357
class.datetimezone.php                             24-May-2024 14:02               15794
class.deflatecontext.php                           24-May-2024 14:02                1867
class.directory.php                                24-May-2024 14:02                5738
class.directoryiterator.php                        24-May-2024 14:02               20210
class.divisionbyzeroerror.php                      24-May-2024 14:02                8487
class.domainexception.php                          24-May-2024 14:02                8546
class.domattr.php                                  24-May-2024 14:02               27355
class.domcdatasection.php                          24-May-2024 14:02               31212
class.domcharacterdata.php                         24-May-2024 14:02               32549
class.domchildnode.php                             24-May-2024 14:02                4253
class.domcomment.php                               24-May-2024 14:02               29879
class.domdocument.php                              24-May-2024 14:02               62139
class.domdocumentfragment.php                      24-May-2024 14:02               28260
class.domdocumenttype.php                          24-May-2024 14:02               26372
class.domelement.php                               24-May-2024 14:02               52397
class.domentity.php                                24-May-2024 14:02               27021
class.domentityreference.php                       24-May-2024 14:02               22482
class.domexception.php                             24-May-2024 14:02                9385
class.domimplementation.php                        24-May-2024 14:02                6134
class.domnamednodemap.php                          24-May-2024 14:02                7483
class.domnamespacenode.php                         24-May-2024 14:02                9441
class.domnode.php                                  24-May-2024 14:02               31923
class.domnodelist.php                              24-May-2024 14:02                6089
class.domnotation.php                              24-May-2024 14:02               22751
class.domparentnode.php                            24-May-2024 14:02                3923
class.domprocessinginstruction.php                 24-May-2024 14:02               24012
class.domtext.php                                  24-May-2024 14:02               32877
class.domxpath.php                                 24-May-2024 14:02                8786
class.dotnet.php                                   24-May-2024 14:02                6949
class.ds-collection.php                            24-May-2024 14:02                6081
class.ds-deque.php                                 24-May-2024 14:02               22192
class.ds-hashable.php                              24-May-2024 14:02                4212
class.ds-map.php                                   24-May-2024 14:02               23199
class.ds-pair.php                                  24-May-2024 14:02                4624
class.ds-priorityqueue.php                         24-May-2024 14:02                8389
class.ds-queue.php                                 24-May-2024 14:02                7905
class.ds-sequence.php                              24-May-2024 14:02               23690
class.ds-set.php                                   24-May-2024 14:02               18619
class.ds-stack.php                                 24-May-2024 14:02                7219
class.ds-vector.php                                24-May-2024 14:02               21736
class.emptyiterator.php                            24-May-2024 14:02                4119
class.error.php                                    24-May-2024 14:02               10874
class.errorexception.php                           24-May-2024 14:02               14572
class.ev.php                                       24-May-2024 14:02               43442
class.evcheck.php                                  24-May-2024 14:02               10868
class.evchild.php                                  24-May-2024 14:02               12541
class.evembed.php                                  24-May-2024 14:02               10053
class.event.php                                    24-May-2024 14:02               18459
class.eventbase.php                                24-May-2024 14:02               15140
class.eventbuffer.php                              24-May-2024 14:02               23496
class.eventbufferevent.php                         24-May-2024 14:02               37945
class.eventconfig.php                              24-May-2024 14:02                7865
class.eventdnsbase.php                             24-May-2024 14:02               14300
class.eventexception.php                           24-May-2024 14:02                8557
class.eventhttp.php                                24-May-2024 14:02                9729
class.eventhttpconnection.php                      24-May-2024 14:02               10545
class.eventhttprequest.php                         24-May-2024 14:02               22886
class.eventlistener.php                            24-May-2024 14:02               12819
class.eventsslcontext.php                          24-May-2024 14:02               19184
class.eventutil.php                                24-May-2024 14:02               25585
class.evfork.php                                   24-May-2024 14:02                9034
class.evidle.php                                   24-May-2024 14:02                9861
class.evio.php                                     24-May-2024 14:02               12648
class.evloop.php                                   24-May-2024 14:02               31551
class.evperiodic.php                               24-May-2024 14:02               14963
class.evprepare.php                                24-May-2024 14:02               11032
class.evsignal.php                                 24-May-2024 14:02               11960
class.evstat.php                                   24-May-2024 14:02               14428
class.evtimer.php                                  24-May-2024 14:02               14341
class.evwatcher.php                                24-May-2024 14:02               10012
class.exception.php                                24-May-2024 14:02               11247
class.fannconnection.php                           24-May-2024 14:02                6653
class.ffi-cdata.php                                24-May-2024 14:02                6189
class.ffi-ctype.php                                24-May-2024 14:02               31283
class.ffi-exception.php                            24-May-2024 14:02                8243
class.ffi-parserexception.php                      24-May-2024 14:02                8298
class.ffi.php                                      24-May-2024 14:02               18417
class.fiber.php                                    24-May-2024 14:02                7721
class.fibererror.php                               24-May-2024 14:02                8171
class.filesystemiterator.php                       24-May-2024 14:02               19785
class.filteriterator.php                           24-May-2024 14:02                7396
class.finfo.php                                    24-May-2024 14:02                5711
class.gearmanclient.php                            24-May-2024 14:02               35914
class.gearmanexception.php                         24-May-2024 14:02                7623
class.gearmanjob.php                               24-May-2024 14:02               12209
class.gearmantask.php                              24-May-2024 14:02                9541
class.gearmanworker.php                            24-May-2024 14:02               13874
class.gender.php                                   24-May-2024 14:02               42713
class.generator.php                                24-May-2024 14:02                6613
class.globiterator.php                             24-May-2024 14:02               11307
class.gmagick.php                                  24-May-2024 14:02               88547
class.gmagickdraw.php                              24-May-2024 14:02               24924
class.gmagickpixel.php                             24-May-2024 14:02                5806
class.gmp.php                                      24-May-2024 14:02                2426
class.hrtime-performancecounter.php                24-May-2024 14:02                3896
class.hrtime-stopwatch.php                         24-May-2024 14:02                7109
class.hrtime-unit.php                              24-May-2024 14:02                4572
class.imagick.php                                  24-May-2024 14:02              285903
class.imagickdraw.php                              24-May-2024 14:02               82584
class.imagickkernel.php                            24-May-2024 14:02                6392
class.imagickpixel.php                             24-May-2024 14:02               12765
class.imagickpixeliterator.php                     24-May-2024 14:02                9338
class.imap-connection.php                          24-May-2024 14:02                1818
class.infiniteiterator.php                         24-May-2024 14:02                5357
class.inflatecontext.php                           24-May-2024 14:02                1836
class.internaliterator.php                         24-May-2024 14:02                4781
class.intlbreakiterator.php                        24-May-2024 14:02               27722
class.intlcalendar.php                             24-May-2024 14:02               93472
class.intlchar.php                                 24-May-2024 14:02              428440
class.intlcodepointbreakiterator.php               24-May-2024 14:02               25442
class.intldateformatter.php                        24-May-2024 14:02               20870
class.intlexception.php                            24-May-2024 14:02                7833
class.intliterator.php                             24-May-2024 14:02                5128
class.intlpartsiterator.php                        24-May-2024 14:02                7283
class.intlrulebasedbreakiterator.php               24-May-2024 14:02               27857
class.intltimezone.php                             24-May-2024 14:02               24094
class.invalidargumentexception.php                 24-May-2024 14:02                8560
class.iterator.php                                 24-May-2024 14:02               11447
class.iteratoraggregate.php                        24-May-2024 14:02                6200
class.iteratoriterator.php                         24-May-2024 14:02                6424
class.jsonserializable.php                         24-May-2024 14:02                2968
class.lengthexception.php                          24-May-2024 14:02                8501
class.libxmlerror.php                              24-May-2024 14:02                5783
class.limititerator.php                            24-May-2024 14:02                9728
class.locale.php                                   24-May-2024 14:02               24164
class.logicexception.php                           24-May-2024 14:02                8574
class.lua.php                                      24-May-2024 14:02                7875
class.luaclosure.php                               24-May-2024 14:02                2721
class.luasandbox.php                               24-May-2024 14:02               14192
class.luasandboxerror.php                          24-May-2024 14:02               10122
class.luasandboxerrorerror.php                     24-May-2024 14:02                7656
class.luasandboxfatalerror.php                     24-May-2024 14:02                7778
class.luasandboxfunction.php                       24-May-2024 14:02                3974
class.luasandboxmemoryerror.php                    24-May-2024 14:02                7969
class.luasandboxruntimeerror.php                   24-May-2024 14:02                7798
class.luasandboxsyntaxerror.php                    24-May-2024 14:02                7660
class.luasandboxtimeouterror.php                   24-May-2024 14:02                7953
class.memcache.php                                 24-May-2024 14:02               18918
class.memcached.php                                24-May-2024 14:02               44623
class.memcachedexception.php                       24-May-2024 14:02                7618
class.messageformatter.php                         24-May-2024 14:02               12082
class.mongodb-bson-binary.php                      24-May-2024 14:02               10875
class.mongodb-bson-binaryinterface.php             24-May-2024 14:02                4772
class.mongodb-bson-dbpointer.php                   24-May-2024 14:02                6093
class.mongodb-bson-decimal128.php                  24-May-2024 14:02                7851
class.mongodb-bson-decimal128interface.php         24-May-2024 14:02                3899
class.mongodb-bson-int64.php                       24-May-2024 14:02                7473
class.mongodb-bson-javascript.php                  24-May-2024 14:02                6569
class.mongodb-bson-javascriptinterface.php         24-May-2024 14:02                5002
class.mongodb-bson-maxkey.php                      24-May-2024 14:02                4304
class.mongodb-bson-maxkeyinterface.php             24-May-2024 14:02                2250
class.mongodb-bson-minkey.php                      24-May-2024 14:02                4296
class.mongodb-bson-minkeyinterface.php             24-May-2024 14:02                2231
class.mongodb-bson-objectid.php                    24-May-2024 14:02                5853
class.mongodb-bson-objectidinterface.php           24-May-2024 14:02                4389
class.mongodb-bson-persistable.php                 24-May-2024 14:02                5013
class.mongodb-bson-regex.php                       24-May-2024 14:02                6023
class.mongodb-bson-regexinterface.php              24-May-2024 14:02                4791
class.mongodb-bson-serializable.php                24-May-2024 14:02                3392
class.mongodb-bson-symbol.php                      24-May-2024 14:02                5981
class.mongodb-bson-timestamp.php                   24-May-2024 14:02                8498
class.mongodb-bson-timestampinterface.php          24-May-2024 14:02                4949
class.mongodb-bson-type.php                        24-May-2024 14:02                1866
class.mongodb-bson-undefined.php                   24-May-2024 14:02                6069
class.mongodb-bson-unserializable.php              24-May-2024 14:02                3308
class.mongodb-bson-utcdatetime.php                 24-May-2024 14:02                6266
class.mongodb-bson-utcdatetimeinterface.php        24-May-2024 14:02                4462
class.mongodb-driver-bulkwrite.php                 24-May-2024 14:02               24175
class.mongodb-driver-clientencryption.php          24-May-2024 14:02               23524
class.mongodb-driver-command.php                   24-May-2024 14:02               14285
class.mongodb-driver-cursor.php                    24-May-2024 14:02               25883
class.mongodb-driver-cursorid.php                  24-May-2024 14:02                5617
class.mongodb-driver-cursorinterface.php           24-May-2024 14:02                6255
class.mongodb-driver-exception-authenticationex..> 24-May-2024 14:02                9224
class.mongodb-driver-exception-bulkwriteexcepti..> 24-May-2024 14:02               10071
class.mongodb-driver-exception-commandexception..> 24-May-2024 14:02               10977
class.mongodb-driver-exception-connectionexcept..> 24-May-2024 14:02                9286
class.mongodb-driver-exception-connectiontimeou..> 24-May-2024 14:02                9674
class.mongodb-driver-exception-encryptionexcept..> 24-May-2024 14:02                9220
class.mongodb-driver-exception-exception.php       24-May-2024 14:02                2252
class.mongodb-driver-exception-executiontimeout..> 24-May-2024 14:02               10337
class.mongodb-driver-exception-invalidargumente..> 24-May-2024 14:02                8246
class.mongodb-driver-exception-logicexception.php  24-May-2024 14:02                8130
class.mongodb-driver-exception-runtimeexception..> 24-May-2024 14:02               11738
class.mongodb-driver-exception-serverexception.php 24-May-2024 14:02                9297
class.mongodb-driver-exception-sslconnectionexc..> 24-May-2024 14:02                9568
class.mongodb-driver-exception-unexpectedvaluee..> 24-May-2024 14:02                8263
class.mongodb-driver-exception-writeexception.php  24-May-2024 14:02               12256
class.mongodb-driver-manager.php                   24-May-2024 14:02               21872
class.mongodb-driver-monitoring-commandfailedev..> 24-May-2024 14:02                8693
class.mongodb-driver-monitoring-commandstartede..> 24-May-2024 14:02                7616
class.mongodb-driver-monitoring-commandsubscrib..> 24-May-2024 14:02                6338
class.mongodb-driver-monitoring-commandsucceede..> 24-May-2024 14:02                8284
class.mongodb-driver-monitoring-sdamsubscriber.php 24-May-2024 14:02               11722
class.mongodb-driver-monitoring-serverchangedev..> 24-May-2024 14:02                5806
class.mongodb-driver-monitoring-serverclosedeve..> 24-May-2024 14:02                4453
class.mongodb-driver-monitoring-serverheartbeat..> 24-May-2024 14:02                5804
class.mongodb-driver-monitoring-serverheartbeat..> 24-May-2024 14:02                4631
class.mongodb-driver-monitoring-serverheartbeat..> 24-May-2024 14:02                5876
class.mongodb-driver-monitoring-serveropeningev..> 24-May-2024 14:02                4473
class.mongodb-driver-monitoring-subscriber.php     24-May-2024 14:02                2701
class.mongodb-driver-monitoring-topologychanged..> 24-May-2024 14:02                4801
class.mongodb-driver-monitoring-topologyclosede..> 24-May-2024 14:02                3412
class.mongodb-driver-monitoring-topologyopening..> 24-May-2024 14:02                3426
class.mongodb-driver-query.php                     24-May-2024 14:02                3490
class.mongodb-driver-readconcern.php               24-May-2024 14:02               17781
class.mongodb-driver-readpreference.php            24-May-2024 14:02               21984
class.mongodb-driver-server.php                    24-May-2024 14:02               27254
class.mongodb-driver-serverapi.php                 24-May-2024 14:02               14149
class.mongodb-driver-serverdescription.php         24-May-2024 14:02               16946
class.mongodb-driver-session.php                   24-May-2024 14:02               15605
class.mongodb-driver-topologydescription.php       24-May-2024 14:02               11710
class.mongodb-driver-writeconcern.php              24-May-2024 14:02               10369
class.mongodb-driver-writeconcernerror.php         24-May-2024 14:02                4449
class.mongodb-driver-writeerror.php                24-May-2024 14:02                4773
class.mongodb-driver-writeresult.php               24-May-2024 14:02                8751
class.multipleiterator.php                         24-May-2024 14:02               11741
class.mysql-xdevapi-baseresult.php                 24-May-2024 14:02                3109
class.mysql-xdevapi-client.php                     24-May-2024 14:02                3191
class.mysql-xdevapi-collection.php                 24-May-2024 14:02               10869
class.mysql-xdevapi-collectionadd.php              24-May-2024 14:02                3010
class.mysql-xdevapi-collectionfind.php             24-May-2024 14:02                8890
class.mysql-xdevapi-collectionmodify.php           24-May-2024 14:02               10347
class.mysql-xdevapi-collectionremove.php           24-May-2024 14:02                5284
class.mysql-xdevapi-columnresult.php               24-May-2024 14:02                6834
class.mysql-xdevapi-crudoperationbindable.php      24-May-2024 14:02                3046
class.mysql-xdevapi-crudoperationlimitable.php     24-May-2024 14:02                3052
class.mysql-xdevapi-crudoperationskippable.php     24-May-2024 14:02                3063
class.mysql-xdevapi-crudoperationsortable.php      24-May-2024 14:02                3039
class.mysql-xdevapi-databaseobject.php             24-May-2024 14:02                3610
class.mysql-xdevapi-docresult.php                  24-May-2024 14:02                4112
class.mysql-xdevapi-exception.php                  24-May-2024 14:02                2261
class.mysql-xdevapi-executable.php                 24-May-2024 14:02                2688
class.mysql-xdevapi-executionstatus.php            24-May-2024 14:02                4928
class.mysql-xdevapi-expression.php                 24-May-2024 14:02                3321
class.mysql-xdevapi-result.php                     24-May-2024 14:02                4496
class.mysql-xdevapi-rowresult.php                  24-May-2024 14:02                5209
class.mysql-xdevapi-schema.php                     24-May-2024 14:02                7923
class.mysql-xdevapi-schemaobject.php               24-May-2024 14:02                2873
class.mysql-xdevapi-session.php                    24-May-2024 14:02                9773
class.mysql-xdevapi-sqlstatement.php               24-May-2024 14:02                6735
class.mysql-xdevapi-sqlstatementresult.php         24-May-2024 14:02                7391
class.mysql-xdevapi-statement.php                  24-May-2024 14:02                5095
class.mysql-xdevapi-table.php                      24-May-2024 14:02                7492
class.mysql-xdevapi-tabledelete.php                24-May-2024 14:02                5249
class.mysql-xdevapi-tableinsert.php                24-May-2024 14:02                3570
class.mysql-xdevapi-tableselect.php                24-May-2024 14:02                8394
class.mysql-xdevapi-tableupdate.php                24-May-2024 14:02                6184
class.mysql-xdevapi-warning.php                    24-May-2024 14:02                3818
class.mysqli-driver.php                            24-May-2024 14:02                7919
class.mysqli-result.php                            24-May-2024 14:02               10896
class.mysqli-sql-exception.php                     24-May-2024 14:02                5234
class.mysqli-stmt.php                              24-May-2024 14:02               15185
class.mysqli-warning.php                           24-May-2024 14:02                4024
class.mysqli.php                                   24-May-2024 14:02               31675
class.norewinditerator.php                         24-May-2024 14:02                6468
class.normalizer.php                               24-May-2024 14:02                9843
class.numberformatter.php                          24-May-2024 14:02               52624
class.oauth.php                                    24-May-2024 14:02               20096
class.oauthexception.php                           24-May-2024 14:02                8651
class.oauthprovider.php                            24-May-2024 14:02               12991
class.ocicollection.php                            24-May-2024 14:02                7413
class.ocilob.php                                   24-May-2024 14:02               15747
class.outeriterator.php                            24-May-2024 14:02                4508
class.outofboundsexception.php                     24-May-2024 14:02                8618
class.outofrangeexception.php                      24-May-2024 14:02                8612
class.overflowexception.php                        24-May-2024 14:02                8528
class.override.php                                 24-May-2024 14:02                4054
class.parallel-channel.php                         24-May-2024 14:02                8263
class.parallel-events-event-type.php               24-May-2024 14:02                3420
class.parallel-events-event.php                    24-May-2024 14:02                3573
class.parallel-events-input.php                    24-May-2024 14:02                4809
class.parallel-events.php                          24-May-2024 14:02                7183
class.parallel-future.php                          24-May-2024 14:02                7842
class.parallel-runtime.php                         24-May-2024 14:02                6463
class.parallel-sync.php                            24-May-2024 14:02                5284
class.parentiterator.php                           24-May-2024 14:02                8893
class.parle-errorinfo.php                          24-May-2024 14:02                3909
class.parle-lexer.php                              24-May-2024 14:02               13248
class.parle-lexerexception.php                     24-May-2024 14:02                7793
class.parle-parser.php                             24-May-2024 14:02               18176
class.parle-parserexception.php                    24-May-2024 14:02                7775
class.parle-rlexer.php                             24-May-2024 14:02               15483
class.parle-rparser.php                            24-May-2024 14:02               18349
class.parle-stack.php                              24-May-2024 14:02                4879
class.parle-token.php                              24-May-2024 14:02                4976
class.parseerror.php                               24-May-2024 14:02                8975
class.pdo.php                                      24-May-2024 14:02               10916
class.pdoexception.php                             24-May-2024 14:02                9397
class.pdostatement.php                             24-May-2024 14:02               17382
class.phar.php                                     24-May-2024 14:02               38373
class.phardata.php                                 24-May-2024 14:02               47755
class.pharexception.php                            24-May-2024 14:02                8090
class.pharfileinfo.php                             24-May-2024 14:02                9475
class.php-user-filter.php                          24-May-2024 14:02                5447
class.phptoken.php                                 24-May-2024 14:02                8800
class.pool.php                                     24-May-2024 14:02                7765
class.quickhashinthash.php                         24-May-2024 14:02               15157
class.quickhashintset.php                          24-May-2024 14:02               12935
class.quickhashintstringhash.php                   24-May-2024 14:02               16053
class.quickhashstringinthash.php                   24-May-2024 14:02               13722
class.random-brokenrandomengineerror.php           24-May-2024 14:02                8581
class.random-cryptosafeengine.php                  24-May-2024 14:02                2521
class.random-engine-mt19937.php                    24-May-2024 14:02                5420
class.random-engine-pcgoneseq128xslrr64.php        24-May-2024 14:02                6234
class.random-engine-secure.php                     24-May-2024 14:02                3461
class.random-engine-xoshiro256starstar.php         24-May-2024 14:02                6419
class.random-engine.php                            24-May-2024 14:02                3817
class.random-randomerror.php                       24-May-2024 14:02                8505
class.random-randomexception.php                   24-May-2024 14:02                8619
class.random-randomizer.php                        24-May-2024 14:02               10624
class.rangeexception.php                           24-May-2024 14:02                8778
class.rararchive.php                               24-May-2024 14:02                7938
class.rarentry.php                                 24-May-2024 14:02               51669
class.rarexception.php                             24-May-2024 14:02                8478
class.recursivearrayiterator.php                   24-May-2024 14:02               15986
class.recursivecachingiterator.php                 24-May-2024 14:02               12647
class.recursivecallbackfilteriterator.php          24-May-2024 14:02               10119
class.recursivedirectoryiterator.php               24-May-2024 14:02               15765
class.recursivefilteriterator.php                  24-May-2024 14:02                6616
class.recursiveiterator.php                        24-May-2024 14:02                4953
class.recursiveiteratoriterator.php                24-May-2024 14:02               15066
class.recursiveregexiterator.php                   24-May-2024 14:02               14831
class.recursivetreeiterator.php                    24-May-2024 14:02               19396
class.reflection.php                               24-May-2024 14:02                3506
class.reflectionclass.php                          24-May-2024 14:02               35754
class.reflectionclassconstant.php                  24-May-2024 14:02               16306
class.reflectionexception.php                      24-May-2024 14:02                7538
class.reflectionextension.php                      24-May-2024 14:02               10199
class.reflectionfunction.php                       24-May-2024 14:02               20535
class.reflectionfunctionabstract.php               24-May-2024 14:02               19525
class.reflectiongenerator.php                      24-May-2024 14:02                6398
class.reflectionmethod.php                         24-May-2024 14:02               29983
class.reflectionnamedtype.php                      24-May-2024 14:02                3804
class.reflectionobject.php                         24-May-2024 14:02               28959
class.reflectionparameter.php                      24-May-2024 14:02               15782
class.reflectionproperty.php                       24-May-2024 14:02               20184
class.reflectionreference.php                      24-May-2024 14:02                4045
class.reflectiontype.php                           24-May-2024 14:02                4505
class.reflectionuniontype.php                      24-May-2024 14:02                3376
class.reflectionzendextension.php                  24-May-2024 14:02                7512
class.reflector.php                                24-May-2024 14:02                2659
class.regexiterator.php                            24-May-2024 14:02               17856
class.resourcebundle.php                           24-May-2024 14:02                8471
class.returntypewillchange.php                     24-May-2024 14:02                3189
class.rnpffi.php                                   24-May-2024 14:02                1694
class.rrdcreator.php                               24-May-2024 14:02                4618
class.rrdgraph.php                                 24-May-2024 14:02                4059
class.rrdupdater.php                               24-May-2024 14:02                3377
class.runtimeexception.php                         24-May-2024 14:02                8521
class.seaslog.php                                  24-May-2024 14:02               22000
class.seekableiterator.php                         24-May-2024 14:02               11369
class.sensitiveparameter.php                       24-May-2024 14:02                6349
class.sensitiveparametervalue.php                  24-May-2024 14:02                4985
class.serializable.php                             24-May-2024 14:02                8189
class.sessionhandler.php                           24-May-2024 14:02               26291
class.sessionhandlerinterface.php                  24-May-2024 14:02               15968
class.sessionidinterface.php                       24-May-2024 14:02                3210
class.sessionupdatetimestamphandlerinterface.php   24-May-2024 14:02                4455
class.simdjsonexception.php                        24-May-2024 14:02                5069
class.simdjsonvalueerror.php                       24-May-2024 14:02                8384
class.simplexmlelement.php                         24-May-2024 14:02               15908
class.simplexmliterator.php                        24-May-2024 14:02                7685
class.snmp.php                                     24-May-2024 14:02               28368
class.snmpexception.php                            24-May-2024 14:02                9087
class.soapclient.php                               24-May-2024 14:02               11828
class.soapfault.php                                24-May-2024 14:02                9865
class.soapheader.php                               24-May-2024 14:02                3455
class.soapparam.php                                24-May-2024 14:02                2711
class.soapserver.php                               24-May-2024 14:02                8643
class.soapvar.php                                  24-May-2024 14:02                3716
class.sodiumexception.php                          24-May-2024 14:02                8438
class.solrclient.php                               24-May-2024 14:02               25237
class.solrclientexception.php                      24-May-2024 14:02                9810
class.solrcollapsefunction.php                     24-May-2024 14:02               11832
class.solrdismaxquery.php                          24-May-2024 14:02              112022
class.solrdocument.php                             24-May-2024 14:02               23716
class.solrdocumentfield.php                        24-May-2024 14:02                4694
class.solrexception.php                            24-May-2024 14:02               10190
class.solrgenericresponse.php                      24-May-2024 14:02               12748
class.solrillegalargumentexception.php             24-May-2024 14:02                9890
class.solrillegaloperationexception.php            24-May-2024 14:02                9973
class.solrinputdocument.php                        24-May-2024 14:02               19650
class.solrmissingmandatoryparameterexception.php   24-May-2024 14:02                9090
class.solrmodifiableparams.php                     24-May-2024 14:02                9007
class.solrobject.php                               24-May-2024 14:02                5926
class.solrparams.php                               24-May-2024 14:02                9300
class.solrpingresponse.php                         24-May-2024 14:02               11249
class.solrquery.php                                24-May-2024 14:02              121386
class.solrqueryresponse.php                        24-May-2024 14:02               12678
class.solrresponse.php                             24-May-2024 14:02               14585
class.solrserverexception.php                      24-May-2024 14:02                9775
class.solrupdateresponse.php                       24-May-2024 14:02               12731
class.solrutils.php                                24-May-2024 14:02                5046
class.spldoublylinkedlist.php                      24-May-2024 14:02               17782
class.splfileinfo.php                              24-May-2024 14:02               18436
class.splfileobject.php                            24-May-2024 14:02               36028
class.splfixedarray.php                            24-May-2024 14:02               20130
class.splheap.php                                  24-May-2024 14:02                7962
class.splmaxheap.php                               24-May-2024 14:02                7282
class.splminheap.php                               24-May-2024 14:02                7293
class.splobjectstorage.php                         24-May-2024 14:02               21406
class.splobserver.php                              24-May-2024 14:02                2890
class.splpriorityqueue.php                         24-May-2024 14:02               12005
class.splqueue.php                                 24-May-2024 14:02               17245
class.splstack.php                                 24-May-2024 14:02               14458
class.splsubject.php                               24-May-2024 14:02                3767
class.spltempfileobject.php                        24-May-2024 14:02               30002
class.spoofchecker.php                             24-May-2024 14:02               10717
class.sqlite3.php                                  24-May-2024 14:02               18330
class.sqlite3result.php                            24-May-2024 14:02                5412
class.sqlite3stmt.php                              24-May-2024 14:02                7458
class.stdclass.php                                 24-May-2024 14:02                6635
class.stomp.php                                    24-May-2024 14:02               21914
class.stompexception.php                           24-May-2024 14:02                5945
class.stompframe.php                               24-May-2024 14:02                4421
class.streamwrapper.php                            24-May-2024 14:02               20271
class.stringable.php                               24-May-2024 14:02                8189
class.svm.php                                      24-May-2024 14:02               18742
class.svmmodel.php                                 24-May-2024 14:02                6999
class.swoole-async.php                             24-May-2024 14:02                8054
class.swoole-atomic.php                            24-May-2024 14:02                5083
class.swoole-buffer.php                            24-May-2024 14:02                7538
class.swoole-channel.php                           24-May-2024 14:02                3981
class.swoole-client.php                            24-May-2024 14:02               16551
class.swoole-connection-iterator.php               24-May-2024 14:02                7534
class.swoole-coroutine.php                         24-May-2024 14:02               18670
class.swoole-event.php                             24-May-2024 14:02                7477
class.swoole-exception.php                         24-May-2024 14:02                4584
class.swoole-http-client.php                       24-May-2024 14:02               14798
class.swoole-http-request.php                      24-May-2024 14:02                3046
class.swoole-http-response.php                     24-May-2024 14:02               10922
class.swoole-http-server.php                       24-May-2024 14:02               26450
class.swoole-lock.php                              24-May-2024 14:02                4691
class.swoole-mmap.php                              24-May-2024 14:02                3092
class.swoole-mysql-exception.php                   24-May-2024 14:02                4625
class.swoole-mysql.php                             24-May-2024 14:02                5430
class.swoole-process.php                           24-May-2024 14:02               13683
class.swoole-redis-server.php                      24-May-2024 14:02               32086
class.swoole-serialize.php                         24-May-2024 14:02                3624
class.swoole-server.php                            24-May-2024 14:02               29589
class.swoole-table.php                             24-May-2024 14:02               12733
class.swoole-timer.php                             24-May-2024 14:02                5012
class.swoole-websocket-frame.php                   24-May-2024 14:02                1959
class.swoole-websocket-server.php                  24-May-2024 14:02                7843
class.syncevent.php                                24-May-2024 14:02                4910
class.syncmutex.php                                24-May-2024 14:02                4234
class.syncreaderwriter.php                         24-May-2024 14:02                5219
class.syncsemaphore.php                            24-May-2024 14:02                4667
class.syncsharedmemory.php                         24-May-2024 14:02                5517
class.thread.php                                   24-May-2024 14:02               11439
class.threaded.php                                 24-May-2024 14:02                8856
class.throwable.php                                24-May-2024 14:02                7328
class.tidy.php                                     24-May-2024 14:02               19089
class.tidynode.php                                 24-May-2024 14:02               11713
class.transliterator.php                           24-May-2024 14:02                9018
class.traversable.php                              24-May-2024 14:02                4376
class.typeerror.php                                24-May-2024 14:02                9540
class.uconverter.php                               24-May-2024 14:02               39070
class.ui-area.php                                  24-May-2024 14:02               12267
class.ui-control.php                               24-May-2024 14:02                5489
class.ui-controls-box.php                          24-May-2024 14:02               10134
class.ui-controls-button.php                       24-May-2024 14:02                6691
class.ui-controls-check.php                        24-May-2024 14:02                7535
class.ui-controls-colorbutton.php                  24-May-2024 14:02                6570
class.ui-controls-combo.php                        24-May-2024 14:02                6659
class.ui-controls-editablecombo.php                24-May-2024 14:02                6771
class.ui-controls-entry.php                        24-May-2024 14:02                9657
class.ui-controls-form.php                         24-May-2024 14:02                8059
class.ui-controls-grid.php                         24-May-2024 14:02               13165
class.ui-controls-group.php                        24-May-2024 14:02                8367
class.ui-controls-label.php                        24-May-2024 14:02                6442
class.ui-controls-multilineentry.php               24-May-2024 14:02                9900
class.ui-controls-picker.php                       24-May-2024 14:02                7587
class.ui-controls-progress.php                     24-May-2024 14:02                5943
class.ui-controls-radio.php                        24-May-2024 14:02                6638
class.ui-controls-separator.php                    24-May-2024 14:02                7091
class.ui-controls-slider.php                       24-May-2024 14:02                7026
class.ui-controls-spin.php                         24-May-2024 14:02                6896
class.ui-controls-tab.php                          24-May-2024 14:02                9165
class.ui-draw-brush-gradient.php                   24-May-2024 14:02                7351
class.ui-draw-brush-lineargradient.php             24-May-2024 14:02                6603
class.ui-draw-brush-radialgradient.php             24-May-2024 14:02                6789
class.ui-draw-brush.php                            24-May-2024 14:02                4449
class.ui-draw-color.php                            24-May-2024 14:02                8632
class.ui-draw-line-cap.php                         24-May-2024 14:02                3753
class.ui-draw-line-join.php                        24-May-2024 14:02                3737
class.ui-draw-matrix.php                           24-May-2024 14:02                5681
class.ui-draw-path.php                             24-May-2024 14:02               10831
class.ui-draw-pen.php                              24-May-2024 14:02                8192
class.ui-draw-stroke.php                           24-May-2024 14:02                7020
class.ui-draw-text-font-descriptor.php             24-May-2024 14:02                6059
class.ui-draw-text-font-italic.php                 24-May-2024 14:02                4112
class.ui-draw-text-font-stretch.php                24-May-2024 14:02                8308
class.ui-draw-text-font-weight.php                 24-May-2024 14:02                8910
class.ui-draw-text-font.php                        24-May-2024 14:02                4986
class.ui-draw-text-layout.php                      24-May-2024 14:02                5336
class.ui-exception-invalidargumentexception.php    24-May-2024 14:02                7809
class.ui-exception-runtimeexception.php            24-May-2024 14:02                7732
class.ui-executor.php                              24-May-2024 14:02                5449
class.ui-key.php                                   24-May-2024 14:02               21352
class.ui-menu.php                                  24-May-2024 14:02                6470
class.ui-menuitem.php                              24-May-2024 14:02                3835
class.ui-point.php                                 24-May-2024 14:02                6372
class.ui-size.php                                  24-May-2024 14:02                6475
class.ui-window.php                                24-May-2024 14:02               13343
class.underflowexception.php                       24-May-2024 14:02                8605
class.unexpectedvalueexception.php                 24-May-2024 14:02                8772
class.unhandledmatcherror.php                      24-May-2024 14:02                8610
class.unitenum.php                                 24-May-2024 14:02                2797
class.v8js.php                                     24-May-2024 14:02                9126
class.v8jsexception.php                            24-May-2024 14:02               11410
class.valueerror.php                               24-May-2024 14:02                8547
class.variant.php                                  24-May-2024 14:02                5671
class.varnishadmin.php                             24-May-2024 14:02               11999
class.varnishlog.php                               24-May-2024 14:02               34864
class.varnishstat.php                              24-May-2024 14:02                3061
class.volatile.php                                 24-May-2024 14:02               11740
class.vtiful-kernel-excel.php                      24-May-2024 14:02               12096
class.vtiful-kernel-format.php                     24-May-2024 14:02               16112
class.weakmap.php                                  24-May-2024 14:02                9358
class.weakreference.php                            24-May-2024 14:02                5685
class.win32serviceexception.php                    24-May-2024 14:02                7841
class.wkhtmltox-image-converter.php                24-May-2024 14:02                4214
class.wkhtmltox-pdf-converter.php                  24-May-2024 14:02                4593
class.wkhtmltox-pdf-object.php                     24-May-2024 14:02                3020
class.worker.php                                   24-May-2024 14:02                8565
class.xmldiff-base.php                             24-May-2024 14:02                4175
class.xmldiff-dom.php                              24-May-2024 14:02                5089
class.xmldiff-file.php                             24-May-2024 14:02                5072
class.xmldiff-memory.php                           24-May-2024 14:02                5103
class.xmlparser.php                                24-May-2024 14:02                1820
class.xmlreader.php                                24-May-2024 14:02               39465
class.xmlwriter.php                                24-May-2024 14:02               32792
class.xsltprocessor.php                            24-May-2024 14:02               11730
class.yac.php                                      24-May-2024 14:02                9675
class.yaconf.php                                   24-May-2024 14:02                3541
class.yaf-action-abstract.php                      24-May-2024 14:02               13285
class.yaf-application.php                          24-May-2024 14:02               13185
class.yaf-bootstrap-abstract.php                   24-May-2024 14:02                5696
class.yaf-config-abstract.php                      24-May-2024 14:02                5350
class.yaf-config-ini.php                           24-May-2024 14:02               18276
class.yaf-config-simple.php                        24-May-2024 14:02               13456
class.yaf-controller-abstract.php                  24-May-2024 14:02               19399
class.yaf-dispatcher.php                           24-May-2024 14:02               20764
class.yaf-exception-dispatchfailed.php             24-May-2024 14:02                2722
class.yaf-exception-loadfailed-action.php          24-May-2024 14:02                2797
class.yaf-exception-loadfailed-controller.php      24-May-2024 14:02                2813
class.yaf-exception-loadfailed-module.php          24-May-2024 14:02                2784
class.yaf-exception-loadfailed-view.php            24-May-2024 14:02                2726
class.yaf-exception-loadfailed.php                 24-May-2024 14:02                2700
class.yaf-exception-routerfailed.php               24-May-2024 14:02                2711
class.yaf-exception-startuperror.php               24-May-2024 14:02                2709
class.yaf-exception-typeerror.php                  24-May-2024 14:02                2680
class.yaf-exception.php                            24-May-2024 14:02                8542
class.yaf-loader.php                               24-May-2024 14:02               19234
class.yaf-plugin-abstract.php                      24-May-2024 14:02               16369
class.yaf-registry.php                             24-May-2024 14:02                6193
class.yaf-request-abstract.php                     24-May-2024 14:02               23823
class.yaf-request-http.php                         24-May-2024 14:02               23035
class.yaf-request-simple.php                       24-May-2024 14:02               22447
class.yaf-response-abstract.php                    24-May-2024 14:02               12067
class.yaf-route-interface.php                      24-May-2024 14:02                3854
class.yaf-route-map.php                            24-May-2024 14:02                6600
class.yaf-route-regex.php                          24-May-2024 14:02                8338
class.yaf-route-rewrite.php                        24-May-2024 14:02                7552
class.yaf-route-simple.php                         24-May-2024 14:02                6720
class.yaf-route-static.php                         24-May-2024 14:02                5214
class.yaf-route-supervar.php                       24-May-2024 14:02                4786
class.yaf-router.php                               24-May-2024 14:02               12616
class.yaf-session.php                              24-May-2024 14:02               12916
class.yaf-view-interface.php                       24-May-2024 14:02                6211
class.yaf-view-simple.php                          24-May-2024 14:02               11451
class.yar-client-exception.php                     24-May-2024 14:02                6667
class.yar-client.php                               24-May-2024 14:02                5888
class.yar-concurrent-client.php                    24-May-2024 14:02                6696
class.yar-server-exception.php                     24-May-2024 14:02                7137
class.yar-server.php                               24-May-2024 14:02                3520
class.ziparchive.php                               24-May-2024 14:02               87183
class.zmq.php                                      24-May-2024 14:02               41962
class.zmqcontext.php                               24-May-2024 14:02                5700
class.zmqdevice.php                                24-May-2024 14:02                7330
class.zmqpoll.php                                  24-May-2024 14:02                5374
class.zmqsocket.php                                24-May-2024 14:02               11666
class.zookeeper.php                                24-May-2024 14:02               56644
class.zookeeperauthenticationexception.php         24-May-2024 14:02                7749
class.zookeeperconfig.php                          24-May-2024 14:02                6482
class.zookeeperconnectionexception.php             24-May-2024 14:02                7746
class.zookeeperexception.php                       24-May-2024 14:02                7607
class.zookeepermarshallingexception.php            24-May-2024 14:02                7762
class.zookeepernonodeexception.php                 24-May-2024 14:02                7726
class.zookeeperoperationtimeoutexception.php       24-May-2024 14:02                7771
class.zookeepersessionexception.php                24-May-2024 14:02                7714
classobj.configuration.php                         24-May-2024 14:02                1368
classobj.constants.php                             24-May-2024 14:02                1230
classobj.examples.php                              24-May-2024 14:02               13459
classobj.installation.php                          24-May-2024 14:02                1340
classobj.requirements.php                          24-May-2024 14:02                1296
classobj.resources.php                             24-May-2024 14:02                1300
classobj.setup.php                                 24-May-2024 14:02                1711
closure.bind.php                                   24-May-2024 14:02                7987
closure.bindto.php                                 24-May-2024 14:02                9512
closure.call.php                                   24-May-2024 14:02                6346
closure.construct.php                              24-May-2024 14:02                2461
closure.fromcallable.php                           24-May-2024 14:02                3861
cmark.installation.php                             24-May-2024 14:02                2026
cmark.requirements.php                             24-May-2024 14:02                1367
cmark.setup.php                                    24-May-2024 14:02                1508
collator.asort.php                                 24-May-2024 14:02                9396
collator.compare.php                               24-May-2024 14:02                8590
collator.construct.php                             24-May-2024 14:02                5835
collator.create.php                                24-May-2024 14:02                5398
collator.getattribute.php                          24-May-2024 14:02                6023
collator.geterrorcode.php                          24-May-2024 14:02                5386
collator.geterrormessage.php                       24-May-2024 14:02                5451
collator.getlocale.php                             24-May-2024 14:02                6914
collator.getsortkey.php                            24-May-2024 14:02                6562
collator.getstrength.php                           24-May-2024 14:02                5072
collator.setattribute.php                          24-May-2024 14:02                6994
collator.setstrength.php                           24-May-2024 14:02               13730
collator.sort.php                                  24-May-2024 14:02                8257
collator.sortwithsortkeys.php                      24-May-2024 14:02                6701
collectable.isgarbage.php                          24-May-2024 14:02                3462
com.configuration.php                              24-May-2024 14:02                8058
com.constants.php                                  24-May-2024 14:02               26301
com.construct.php                                  24-May-2024 14:02                9512
com.error-handling.php                             24-May-2024 14:02                1629
com.examples.arrays.php                            24-May-2024 14:02                2113
com.examples.foreach.php                           24-May-2024 14:02                2896
com.examples.php                                   24-May-2024 14:02                1476
com.installation.php                               24-May-2024 14:02                1583
com.requirements.php                               24-May-2024 14:02                1327
com.resources.php                                  24-May-2024 14:02                1265
com.setup.php                                      24-May-2024 14:02                1662
commonmark-cql.construct.php                       24-May-2024 14:02                2238
commonmark-cql.invoke.php                          24-May-2024 14:02                3917
commonmark-interfaces-ivisitable.accept.php        24-May-2024 14:02                3156
commonmark-interfaces-ivisitor.enter.php           24-May-2024 14:02                4189
commonmark-interfaces-ivisitor.leave.php           24-May-2024 14:02                4191
commonmark-node-bulletlist.construct.php           24-May-2024 14:02                3241
commonmark-node-codeblock.construct.php            24-May-2024 14:02                2893
commonmark-node-heading.construct.php              24-May-2024 14:02                2682
commonmark-node-image.construct.php                24-May-2024 14:02                3336
commonmark-node-link.construct.php                 24-May-2024 14:02                3333
commonmark-node-orderedlist.construct.php          24-May-2024 14:02                4220
commonmark-node-text.construct.php                 24-May-2024 14:02                2721
commonmark-node.accept.php                         24-May-2024 14:02                2897
commonmark-node.appendchild.php                    24-May-2024 14:02                2765
commonmark-node.insertafter.php                    24-May-2024 14:02                2790
commonmark-node.insertbefore.php                   24-May-2024 14:02                2788
commonmark-node.prependchild.php                   24-May-2024 14:02                2792
commonmark-node.replace.php                        24-May-2024 14:02                2736
commonmark-node.unlink.php                         24-May-2024 14:02                2436
commonmark-parser.construct.php                    24-May-2024 14:02                3586
commonmark-parser.finish.php                       24-May-2024 14:02                2466
commonmark-parser.parse.php                        24-May-2024 14:02                2695
compersisthelper.construct.php                     24-May-2024 14:02                3645
compersisthelper.getcurfilename.php                24-May-2024 14:02                3168
compersisthelper.getmaxstreamsize.php              24-May-2024 14:02                3174
compersisthelper.initnew.php                       24-May-2024 14:02                3123
compersisthelper.loadfromfile.php                  24-May-2024 14:02                4337
compersisthelper.loadfromstream.php                24-May-2024 14:02                3553
compersisthelper.savetofile.php                    24-May-2024 14:02                6339
compersisthelper.savetostream.php                  24-May-2024 14:02                3580
componere-abstract-definition.addinterface.php     24-May-2024 14:02                3316
componere-abstract-definition.addmethod.php        24-May-2024 14:02                4058
componere-abstract-definition.addtrait.php         24-May-2024 14:02                3266
componere-abstract-definition.getreflector.php     24-May-2024 14:02                2430
componere-definition.addconstant.php               24-May-2024 14:02                4397
componere-definition.addproperty.php               24-May-2024 14:02                3786
componere-definition.construct.php                 24-May-2024 14:02                6068
componere-definition.getclosure.php                24-May-2024 14:02                3497
componere-definition.getclosures.php               24-May-2024 14:02                2718
componere-definition.isregistered.php              24-May-2024 14:02                2305
componere-definition.register.php                  24-May-2024 14:02                2444
componere-method.construct.php                     24-May-2024 14:02                2227
componere-method.getreflector.php                  24-May-2024 14:02                2239
componere-method.setprivate.php                    24-May-2024 14:02                2477
componere-method.setprotected.php                  24-May-2024 14:02                2492
componere-method.setstatic.php                     24-May-2024 14:02                2057
componere-patch.apply.php                          24-May-2024 14:02                1905
componere-patch.construct.php                      24-May-2024 14:02                3692
componere-patch.derive.php                         24-May-2024 14:02                3199
componere-patch.getclosure.php                     24-May-2024 14:02                3124
componere-patch.getclosures.php                    24-May-2024 14:02                2234
componere-patch.isapplied.php                      24-May-2024 14:02                1868
componere-patch.revert.php                         24-May-2024 14:02                1904
componere-value.construct.php                      24-May-2024 14:02                2664
componere-value.hasdefault.php                     24-May-2024 14:02                1913
componere-value.isprivate.php                      24-May-2024 14:02                1931
componere-value.isprotected.php                    24-May-2024 14:02                1941
componere-value.isstatic.php                       24-May-2024 14:02                1925
componere-value.setprivate.php                     24-May-2024 14:02                2499
componere-value.setprotected.php                   24-May-2024 14:02                2513
componere-value.setstatic.php                      24-May-2024 14:02                2073
componere.cast.php                                 24-May-2024 14:02                4949
componere.cast_by_ref.php                          24-May-2024 14:02                5133
componere.installation.php                         24-May-2024 14:02                1410
componere.requirements.php                         24-May-2024 14:02                1257
componere.setup.php                                24-May-2024 14:02                1547
configuration.changes.modes.php                    24-May-2024 14:02                3916
configuration.changes.php                          24-May-2024 14:02                8973
configuration.file.per-user.php                    24-May-2024 14:02                3234
configuration.file.php                             24-May-2024 14:02               11039
configuration.php                                  24-May-2024 14:02                1849
configure.about.php                                24-May-2024 14:02               12810
configure.php                                      24-May-2024 14:02                1545
context.ftp.php                                    24-May-2024 14:02                4934
context.http.php                                   24-May-2024 14:02               17937
context.params.php                                 24-May-2024 14:02                2566
context.phar.php                                   24-May-2024 14:02                2849
context.php                                        24-May-2024 14:02                3042
context.socket.php                                 24-May-2024 14:02                7416
context.ssl.php                                    24-May-2024 14:02               14286
context.zip.php                                    24-May-2024 14:02                4099
context.zlib.php                                   24-May-2024 14:02                2482
control-structures.alternative-syntax.php          24-May-2024 14:02                6879
control-structures.break.php                       24-May-2024 14:02                5521
control-structures.continue.php                    24-May-2024 14:02                8052
control-structures.declare.php                     24-May-2024 14:02               12477
control-structures.do.while.php                    24-May-2024 14:02                5406
control-structures.else.php                        24-May-2024 14:02                3258
control-structures.elseif.php                      24-May-2024 14:02                7749
control-structures.for.php                         24-May-2024 14:02               11805
control-structures.foreach.php                     24-May-2024 14:02               22544
control-structures.goto.php                        24-May-2024 14:02                7253
control-structures.if.php                          24-May-2024 14:02                4892
control-structures.intro.php                       24-May-2024 14:02                1786
control-structures.match.php                       24-May-2024 14:02               20656
control-structures.switch.php                      24-May-2024 14:02               14548
control-structures.while.php                       24-May-2024 14:02                4681
copyright.php                                      24-May-2024 14:02                2078
countable.count.php                                24-May-2024 14:02                5508
ctype.configuration.php                            24-May-2024 14:02                1347
ctype.constants.php                                24-May-2024 14:02                1205
ctype.installation.php                             24-May-2024 14:02                1595
ctype.requirements.php                             24-May-2024 14:02                1297
ctype.resources.php                                24-May-2024 14:02                1279
ctype.setup.php                                    24-May-2024 14:02                1672
cubrid.configuration.php                           24-May-2024 14:02                1307
cubrid.constants.php                               24-May-2024 14:02               14365
cubrid.examples.php                                24-May-2024 14:02               14201
cubrid.installation.php                            24-May-2024 14:02                2215
cubrid.requirements.php                            24-May-2024 14:02                1350
cubrid.resources.php                               24-May-2024 14:02                3244
cubrid.setup.php                                   24-May-2024 14:02                1691
cubridmysql.cubrid.php                             24-May-2024 14:02                5324
curl.configuration.php                             24-May-2024 14:02                2689
curl.constants.php                                 24-May-2024 14:02              195557
curl.examples-basic.php                            24-May-2024 14:02                4095
curl.examples.php                                  24-May-2024 14:02                1430
curl.installation.php                              24-May-2024 14:02                2582
curl.requirements.php                              24-May-2024 14:02                1415
curl.resources.php                                 24-May-2024 14:02                1307
curl.setup.php                                     24-May-2024 14:02                1689
curlfile.construct.php                             24-May-2024 14:02               10536
curlfile.getfilename.php                           24-May-2024 14:02                2197
curlfile.getmimetype.php                           24-May-2024 14:02                2185
curlfile.getpostfilename.php                       24-May-2024 14:02                2252
curlfile.setmimetype.php                           24-May-2024 14:02                2462
curlfile.setpostfilename.php                       24-May-2024 14:02                2502
dateinterval.construct.php                         24-May-2024 14:02               10122
dateinterval.createfromdatestring.php              24-May-2024 14:02                8244
dateinterval.format.php                            24-May-2024 14:02               13408
dateperiod.construct.php                           24-May-2024 14:02               13898
dateperiod.createfromiso8601string.php             24-May-2024 14:02                7767
dateperiod.getdateinterval.php                     24-May-2024 14:02                4647
dateperiod.getenddate.php                          24-May-2024 14:02                7389
dateperiod.getrecurrences.php                      24-May-2024 14:02                8880
dateperiod.getstartdate.php                        24-May-2024 14:02                5047
datetime.add.php                                   24-May-2024 14:02               12605
datetime.configuration.php                         24-May-2024 14:02                6049
datetime.constants.php                             24-May-2024 14:02                3022
datetime.construct.php                             24-May-2024 14:02               16027
datetime.createfromformat.php                      24-May-2024 14:02               27973
datetime.createfromimmutable.php                   24-May-2024 14:02                4876
datetime.createfrominterface.php                   24-May-2024 14:02                4853
datetime.diff.php                                  24-May-2024 14:02               12354
datetime.examples-arithmetic.php                   24-May-2024 14:02               14792
datetime.examples.php                              24-May-2024 14:02                1484
datetime.format.php                                24-May-2024 14:02                7511
datetime.formats.compound.php                      24-May-2024 14:02                9546
datetime.formats.date.php                          24-May-2024 14:02               13824
datetime.formats.php                               24-May-2024 14:02                2823
datetime.formats.relative.php                      24-May-2024 14:02               14957
datetime.formats.time.php                          24-May-2024 14:02                7336
datetime.getlasterrors.php                         24-May-2024 14:02                6175
datetime.getoffset.php                             24-May-2024 14:02                8044
datetime.gettimestamp.php                          24-May-2024 14:02                6398
datetime.gettimezone.php                           24-May-2024 14:02                7387
datetime.installation.php                          24-May-2024 14:02                2322
datetime.modify.php                                24-May-2024 14:02               10897
datetime.requirements.php                          24-May-2024 14:02                1296
datetime.resources.php                             24-May-2024 14:02                1300
datetime.set-state.php                             24-May-2024 14:02                2614
datetime.setdate.php                               24-May-2024 14:02               11515
datetime.setisodate.php                            24-May-2024 14:02               14479
datetime.settime.php                               24-May-2024 14:02               14231
datetime.settimestamp.php                          24-May-2024 14:02                9515
datetime.settimezone.php                           24-May-2024 14:02                9408
datetime.setup.php                                 24-May-2024 14:02                1745
datetime.sub.php                                   24-May-2024 14:02               12550
datetime.wakeup.php                                24-May-2024 14:02                2773
datetimeimmutable.add.php                          24-May-2024 14:02                2401
datetimeimmutable.construct.php                    24-May-2024 14:02                3693
datetimeimmutable.createfromformat.php             24-May-2024 14:02                4075
datetimeimmutable.createfrominterface.php          24-May-2024 14:02                5117
datetimeimmutable.createfrommutable.php            24-May-2024 14:02                4452
datetimeimmutable.getlasterrors.php                24-May-2024 14:02                2318
datetimeimmutable.modify.php                       24-May-2024 14:02                3459
datetimeimmutable.set-state.php                    24-May-2024 14:02                2437
datetimeimmutable.setdate.php                      24-May-2024 14:02                2698
datetimeimmutable.setisodate.php                   24-May-2024 14:02                2758
datetimeimmutable.settime.php                      24-May-2024 14:02                3059
datetimeimmutable.settimestamp.php                 24-May-2024 14:02                2478
datetimeimmutable.settimezone.php                  24-May-2024 14:02                2438
datetimeimmutable.sub.php                          24-May-2024 14:02                2404
datetimezone.construct.php                         24-May-2024 14:02                6689
datetimezone.getlocation.php                       24-May-2024 14:02                5330
datetimezone.getname.php                           24-May-2024 14:02                3246
datetimezone.getoffset.php                         24-May-2024 14:02                7216
datetimezone.gettransitions.php                    24-May-2024 14:02                8024
datetimezone.listabbreviations.php                 24-May-2024 14:02                5212
datetimezone.listidentifiers.php                   24-May-2024 14:02                7647
dba.configuration.php                              24-May-2024 14:02                2409
dba.constants.php                                  24-May-2024 14:02                1184
dba.example.php                                    24-May-2024 14:02                6370
dba.examples.php                                   24-May-2024 14:02                1380
dba.installation.php                               24-May-2024 14:02                9155
dba.requirements.php                               24-May-2024 14:02                7502
dba.resources.php                                  24-May-2024 14:02                1565
dba.setup.php                                      24-May-2024 14:02                1662
dbase.configuration.php                            24-May-2024 14:02                1347
dbase.constants.php                                24-May-2024 14:02                3690
dbase.installation.php                             24-May-2024 14:02                1695
dbase.requirements.php                             24-May-2024 14:02                1275
dbase.resources.php                                24-May-2024 14:02                1543
dbase.setup.php                                    24-May-2024 14:02                1687
debugger-about.php                                 24-May-2024 14:02                1925
debugger.php                                       24-May-2024 14:02                1455
dio.configuration.php                              24-May-2024 14:02                1333
dio.constants.php                                  24-May-2024 14:02               11342
dio.installation.php                               24-May-2024 14:02                2127
dio.requirements.php                               24-May-2024 14:02                1261
dio.resources.php                                  24-May-2024 14:02                1392
dio.setup.php                                      24-May-2024 14:02                1668
dir.configuration.php                              24-May-2024 14:02                1333
dir.constants.php                                  24-May-2024 14:02                2946
dir.installation.php                               24-May-2024 14:02                1305
dir.requirements.php                               24-May-2024 14:02                1261
dir.resources.php                                  24-May-2024 14:02                1265
dir.setup.php                                      24-May-2024 14:02                1660
directory.close.php                                24-May-2024 14:02                2226
directory.read.php                                 24-May-2024 14:02                2218
directory.rewind.php                               24-May-2024 14:02                2213
directoryiterator.construct.php                    24-May-2024 14:02                5821
directoryiterator.current.php                      24-May-2024 14:02                6152
directoryiterator.getbasename.php                  24-May-2024 14:02                6480
directoryiterator.getextension.php                 24-May-2024 14:02                6206
directoryiterator.getfilename.php                  24-May-2024 14:02                5178
directoryiterator.isdot.php                        24-May-2024 14:02                5333
directoryiterator.key.php                          24-May-2024 14:02                6747
directoryiterator.next.php                         24-May-2024 14:02                5481
directoryiterator.rewind.php                       24-May-2024 14:02                5404
directoryiterator.seek.php                         24-May-2024 14:02                5464
directoryiterator.tostring.php                     24-May-2024 14:02                4713
directoryiterator.valid.php                        24-May-2024 14:02                5839
doc.changelog.php                                  24-May-2024 14:02                1355
dom.configuration.php                              24-May-2024 14:02                1333
dom.constants.php                                  24-May-2024 14:02               19413
dom.examples.php                                   24-May-2024 14:02                2995
dom.installation.php                               24-May-2024 14:02                1405
dom.requirements.php                               24-May-2024 14:02                1500
dom.resources.php                                  24-May-2024 14:02                1265
dom.setup.php                                      24-May-2024 14:02                1656
domattr.construct.php                              24-May-2024 14:02                5597
domattr.isid.php                                   24-May-2024 14:02                5037
domcdatasection.construct.php                      24-May-2024 14:02                5178
domcharacterdata.after.php                         24-May-2024 14:02                7756
domcharacterdata.appenddata.php                    24-May-2024 14:02                3899
domcharacterdata.before.php                        24-May-2024 14:02                7384
domcharacterdata.deletedata.php                    24-May-2024 14:02                5139
domcharacterdata.insertdata.php                    24-May-2024 14:02                4844
domcharacterdata.remove.php                        24-May-2024 14:02                5402
domcharacterdata.replacedata.php                   24-May-2024 14:02                5550
domcharacterdata.replacewith.php                   24-May-2024 14:02                7840
domcharacterdata.substringdata.php                 24-May-2024 14:02                4990
domchildnode.after.php                             24-May-2024 14:02                5689
domchildnode.before.php                            24-May-2024 14:02                5108
domchildnode.remove.php                            24-May-2024 14:02                3117
domchildnode.replacewith.php                       24-May-2024 14:02                5301
domcomment.construct.php                           24-May-2024 14:02                5032
domdocument.adoptnode.php                          24-May-2024 14:02                6720
domdocument.append.php                             24-May-2024 14:02                6807
domdocument.construct.php                          24-May-2024 14:02                4396
domdocument.createattribute.php                    24-May-2024 14:02                5932
domdocument.createattributens.php                  24-May-2024 14:02                6982
domdocument.createcdatasection.php                 24-May-2024 14:02                5540
domdocument.createcomment.php                      24-May-2024 14:02                5369
domdocument.createdocumentfragment.php             24-May-2024 14:02                4973
domdocument.createelement.php                      24-May-2024 14:02               11484
domdocument.createelementns.php                    24-May-2024 14:02               14135
domdocument.createentityreference.php              24-May-2024 14:02                6243
domdocument.createprocessinginstruction.php        24-May-2024 14:02                6587
domdocument.createtextnode.php                     24-May-2024 14:02                5360
domdocument.getelementbyid.php                     24-May-2024 14:02                7670
domdocument.getelementsbytagname.php               24-May-2024 14:02                6201
domdocument.getelementsbytagnamens.php             24-May-2024 14:02                7081
domdocument.importnode.php                         24-May-2024 14:02                8976
domdocument.load.php                               24-May-2024 14:02                6284
domdocument.loadhtml.php                           24-May-2024 14:02                7530
domdocument.loadhtmlfile.php                       24-May-2024 14:02                7166
domdocument.loadxml.php                            24-May-2024 14:02                6619
domdocument.normalizedocument.php                  24-May-2024 14:02                2987
domdocument.prepend.php                            24-May-2024 14:02                6899
domdocument.registernodeclass.php                  24-May-2024 14:02               15869
domdocument.relaxngvalidate.php                    24-May-2024 14:02                4059
domdocument.relaxngvalidatesource.php              24-May-2024 14:02                4116
domdocument.replacechildren.php                    24-May-2024 14:02                7196
domdocument.save.php                               24-May-2024 14:02                7650
domdocument.savehtml.php                           24-May-2024 14:02                7559
domdocument.savehtmlfile.php                       24-May-2024 14:02                8016
domdocument.savexml.php                            24-May-2024 14:02                9106
domdocument.schemavalidate.php                     24-May-2024 14:02                4467
domdocument.schemavalidatesource.php               24-May-2024 14:02                4547
domdocument.validate.php                           24-May-2024 14:02                6110
domdocument.xinclude.php                           24-May-2024 14:02                7178
domdocumentfragment.append.php                     24-May-2024 14:02                7497
domdocumentfragment.appendxml.php                  24-May-2024 14:02                5607
domdocumentfragment.construct.php                  24-May-2024 14:02                2152
domdocumentfragment.prepend.php                    24-May-2024 14:02                7555
domdocumentfragment.replacechildren.php            24-May-2024 14:02                7940
domelement.after.php                               24-May-2024 14:02                7434
domelement.append.php                              24-May-2024 14:02                7119
domelement.before.php                              24-May-2024 14:02                7019
domelement.construct.php                           24-May-2024 14:02                6759
domelement.getattribute.php                        24-May-2024 14:02                3576
domelement.getattributenames.php                   24-May-2024 14:02                3971
domelement.getattributenode.php                    24-May-2024 14:02                4168
domelement.getattributenodens.php                  24-May-2024 14:02                4682
domelement.getattributens.php                      24-May-2024 14:02                4132
domelement.getelementsbytagname.php                24-May-2024 14:02                3784
domelement.getelementsbytagnamens.php              24-May-2024 14:02                4827
domelement.hasattribute.php                        24-May-2024 14:02                3859
domelement.hasattributens.php                      24-May-2024 14:02                4348
domelement.insertadjacentelement.php               24-May-2024 14:02                6651
domelement.insertadjacenttext.php                  24-May-2024 14:02                6466
domelement.prepend.php                             24-May-2024 14:02                7169
domelement.remove.php                              24-May-2024 14:02                5045
domelement.removeattribute.php                     24-May-2024 14:02                4086
domelement.removeattributenode.php                 24-May-2024 14:02                4439
domelement.removeattributens.php                   24-May-2024 14:02                4394
domelement.replacechildren.php                     24-May-2024 14:02                7760
domelement.replacewith.php                         24-May-2024 14:02                7824
domelement.setattribute.php                        24-May-2024 14:02                6214
domelement.setattributenode.php                    24-May-2024 14:02                4223
domelement.setattributenodens.php                  24-May-2024 14:02                4153
domelement.setattributens.php                      24-May-2024 14:02                5315
domelement.setidattribute.php                      24-May-2024 14:02                4816
domelement.setidattributenode.php                  24-May-2024 14:02                4815
domelement.setidattributens.php                    24-May-2024 14:02                5294
domelement.toggleattribute.php                     24-May-2024 14:02                6429
domentityreference.construct.php                   24-May-2024 14:02                4840
domimplementation.construct.php                    24-May-2024 14:02                2161
domimplementation.createdocument.php               24-May-2024 14:02                7385
domimplementation.createdocumenttype.php           24-May-2024 14:02                9958
domimplementation.hasfeature.php                   24-May-2024 14:02                9259
domnamednodemap.count.php                          24-May-2024 14:02                2440
domnamednodemap.getiterator.php                    24-May-2024 14:02                3216
domnamednodemap.getnameditem.php                   24-May-2024 14:02                3528
domnamednodemap.getnameditemns.php                 24-May-2024 14:02                4006
domnamednodemap.item.php                           24-May-2024 14:02                3100
domnode.appendchild.php                            24-May-2024 14:02                8750
domnode.c14n.php                                   24-May-2024 14:02                5004
domnode.c14nfile.php                               24-May-2024 14:02                5349
domnode.clonenode.php                              24-May-2024 14:02                2861
domnode.contains.php                               24-May-2024 14:02                5364
domnode.getlineno.php                              24-May-2024 14:02                4951
domnode.getnodepath.php                            24-May-2024 14:02                5279
domnode.getrootnode.php                            24-May-2024 14:02                4407
domnode.hasattributes.php                          24-May-2024 14:02                2995
domnode.haschildnodes.php                          24-May-2024 14:02                2849
domnode.insertbefore.php                           24-May-2024 14:02                4978
domnode.isdefaultnamespace.php                     24-May-2024 14:02                3000
domnode.isequalnode.php                            24-May-2024 14:02                4703
domnode.issamenode.php                             24-May-2024 14:02                2801
domnode.issupported.php                            24-May-2024 14:02                3973
domnode.lookupnamespaceuri.php                     24-May-2024 14:02                3689
domnode.lookupprefix.php                           24-May-2024 14:02                3227
domnode.normalize.php                              24-May-2024 14:02                2825
domnode.removechild.php                            24-May-2024 14:02                6899
domnode.replacechild.php                           24-May-2024 14:02                5710
domnodelist.count.php                              24-May-2024 14:02                2377
domnodelist.getiterator.php                        24-May-2024 14:02                3119
domnodelist.item.php                               24-May-2024 14:02                7014
domparentnode.append.php                           24-May-2024 14:02                4784
domparentnode.prepend.php                          24-May-2024 14:02                4824
domparentnode.replacechildren.php                  24-May-2024 14:02                6628
domprocessinginstruction.construct.php             24-May-2024 14:02                6709
domtext.construct.php                              24-May-2024 14:02                4813
domtext.iselementcontentwhitespace.php             24-May-2024 14:02                2670
domtext.iswhitespaceinelementcontent.php           24-May-2024 14:02                2908
domtext.splittext.php                              24-May-2024 14:02                3298
domxpath.construct.php                             24-May-2024 14:02                2906
domxpath.evaluate.php                              24-May-2024 14:02                7723
domxpath.query.php                                 24-May-2024 14:02               12249
domxpath.registernamespace.php                     24-May-2024 14:02                3316
domxpath.registerphpfunctions.php                  24-May-2024 14:02               13935
dotnet.construct.php                               24-May-2024 14:02                3129
ds-collection.clear.php                            24-May-2024 14:02                3921
ds-collection.copy.php                             24-May-2024 14:02                4326
ds-collection.isempty.php                          24-May-2024 14:02                4254
ds-collection.toarray.php                          24-May-2024 14:02                4243
ds-deque.allocate.php                              24-May-2024 14:02                4673
ds-deque.apply.php                                 24-May-2024 14:02                4973
ds-deque.capacity.php                              24-May-2024 14:02                3953
ds-deque.clear.php                                 24-May-2024 14:02                3838
ds-deque.construct.php                             24-May-2024 14:02                4320
ds-deque.contains.php                              24-May-2024 14:02                7091
ds-deque.copy.php                                  24-May-2024 14:02                4192
ds-deque.count.php                                 24-May-2024 14:02                1626
ds-deque.filter.php                                24-May-2024 14:02                7613
ds-deque.find.php                                  24-May-2024 14:02                5428
ds-deque.first.php                                 24-May-2024 14:02                3764
ds-deque.get.php                                   24-May-2024 14:02                6590
ds-deque.insert.php                                24-May-2024 14:02                6672
ds-deque.isempty.php                               24-May-2024 14:02                4140
ds-deque.join.php                                  24-May-2024 14:02                5738
ds-deque.jsonserialize.php                         24-May-2024 14:02                1880
ds-deque.last.php                                  24-May-2024 14:02                3752
ds-deque.map.php                                   24-May-2024 14:02                5324
ds-deque.merge.php                                 24-May-2024 14:02                4874
ds-deque.pop.php                                   24-May-2024 14:02                4249
ds-deque.push.php                                  24-May-2024 14:02                4677
ds-deque.reduce.php                                24-May-2024 14:02                7984
ds-deque.remove.php                                24-May-2024 14:02                4874
ds-deque.reverse.php                               24-May-2024 14:02                3674
ds-deque.reversed.php                              24-May-2024 14:02                4017
ds-deque.rotate.php                                24-May-2024 14:02                5063
ds-deque.set.php                                   24-May-2024 14:02                6065
ds-deque.shift.php                                 24-May-2024 14:02                4350
ds-deque.slice.php                                 24-May-2024 14:02                7152
ds-deque.sort.php                                  24-May-2024 14:02                7491
ds-deque.sorted.php                                24-May-2024 14:02                7510
ds-deque.sum.php                                   24-May-2024 14:02                5259
ds-deque.toarray.php                               24-May-2024 14:02                4129
ds-deque.unshift.php                               24-May-2024 14:02                4756
ds-hashable.equals.php                             24-May-2024 14:02                3711
ds-hashable.hash.php                               24-May-2024 14:02                7480
ds-map.allocate.php                                24-May-2024 14:02                4539
ds-map.apply.php                                   24-May-2024 14:02                5669
ds-map.capacity.php                                24-May-2024 14:02                3243
ds-map.clear.php                                   24-May-2024 14:02                4314
ds-map.construct.php                               24-May-2024 14:02                4822
ds-map.copy.php                                    24-May-2024 14:02                4052
ds-map.count.php                                   24-May-2024 14:02                1587
ds-map.diff.php                                    24-May-2024 14:02                5454
ds-map.filter.php                                  24-May-2024 14:02                8397
ds-map.first.php                                   24-May-2024 14:02                4063
ds-map.get.php                                     24-May-2024 14:02                8415
ds-map.haskey.php                                  24-May-2024 14:02                4687
ds-map.hasvalue.php                                24-May-2024 14:02                4731
ds-map.intersect.php                               24-May-2024 14:02                5975
ds-map.isempty.php                                 24-May-2024 14:02                4362
ds-map.jsonserialize.php                           24-May-2024 14:02                1858
ds-map.keys.php                                    24-May-2024 14:02                3953
ds-map.ksort.php                                   24-May-2024 14:02                8178
ds-map.ksorted.php                                 24-May-2024 14:02                8259
ds-map.last.php                                    24-May-2024 14:02                4048
ds-map.map.php                                     24-May-2024 14:02                6305
ds-map.merge.php                                   24-May-2024 14:02                5854
ds-map.pairs.php                                   24-May-2024 14:02                4368
ds-map.put.php                                     24-May-2024 14:02               13941
ds-map.putall.php                                  24-May-2024 14:02                5542
ds-map.reduce.php                                  24-May-2024 14:02                8919
ds-map.remove.php                                  24-May-2024 14:02                6974
ds-map.reverse.php                                 24-May-2024 14:02                4126
ds-map.reversed.php                                24-May-2024 14:02                4227
ds-map.skip.php                                    24-May-2024 14:02                4624
ds-map.slice.php                                   24-May-2024 14:02                8004
ds-map.sort.php                                    24-May-2024 14:02                8101
ds-map.sorted.php                                  24-May-2024 14:02                8238
ds-map.sum.php                                     24-May-2024 14:02                5726
ds-map.toarray.php                                 24-May-2024 14:02                5134
ds-map.union.php                                   24-May-2024 14:02                5959
ds-map.values.php                                  24-May-2024 14:02                3952
ds-map.xor.php                                     24-May-2024 14:02                5520
ds-pair.clear.php                                  24-May-2024 14:02                3743
ds-pair.construct.php                              24-May-2024 14:02                2605
ds-pair.copy.php                                   24-May-2024 14:02                4106
ds-pair.isempty.php                                24-May-2024 14:02                4090
ds-pair.jsonserialize.php                          24-May-2024 14:02                1878
ds-pair.toarray.php                                24-May-2024 14:02                4063
ds-priorityqueue.allocate.php                      24-May-2024 14:02                4839
ds-priorityqueue.capacity.php                      24-May-2024 14:02                3452
ds-priorityqueue.clear.php                         24-May-2024 14:02                4495
ds-priorityqueue.construct.php                     24-May-2024 14:02                2927
ds-priorityqueue.copy.php                          24-May-2024 14:02                4495
ds-priorityqueue.count.php                         24-May-2024 14:02                1735
ds-priorityqueue.isempty.php                       24-May-2024 14:02                5050
ds-priorityqueue.jsonserialize.php                 24-May-2024 14:02                1998
ds-priorityqueue.peek.php                          24-May-2024 14:02                4742
ds-priorityqueue.pop.php                           24-May-2024 14:02                5512
ds-priorityqueue.push.php                          24-May-2024 14:02                5603
ds-priorityqueue.toarray.php                       24-May-2024 14:02                5228
ds-queue.allocate.php                              24-May-2024 14:02                4866
ds-queue.capacity.php                              24-May-2024 14:02                3959
ds-queue.clear.php                                 24-May-2024 14:02                3823
ds-queue.construct.php                             24-May-2024 14:02                4318
ds-queue.copy.php                                  24-May-2024 14:02                4294
ds-queue.count.php                                 24-May-2024 14:02                1623
ds-queue.isempty.php                               24-May-2024 14:02                4156
ds-queue.jsonserialize.php                         24-May-2024 14:02                1901
ds-queue.peek.php                                  24-May-2024 14:02                4346
ds-queue.pop.php                                   24-May-2024 14:02                4880
ds-queue.push.php                                  24-May-2024 14:02                4710
ds-queue.toarray.php                               24-May-2024 14:02                4300
ds-sequence.allocate.php                           24-May-2024 14:02                4577
ds-sequence.apply.php                              24-May-2024 14:02                5088
ds-sequence.capacity.php                           24-May-2024 14:02                4508
ds-sequence.contains.php                           24-May-2024 14:02                7218
ds-sequence.filter.php                             24-May-2024 14:02                7752
ds-sequence.find.php                               24-May-2024 14:02                5540
ds-sequence.first.php                              24-May-2024 14:02                3879
ds-sequence.get.php                                24-May-2024 14:02                6718
ds-sequence.insert.php                             24-May-2024 14:02                6791
ds-sequence.join.php                               24-May-2024 14:02                5834
ds-sequence.last.php                               24-May-2024 14:02                3846
ds-sequence.map.php                                24-May-2024 14:02                5453
ds-sequence.merge.php                              24-May-2024 14:02                5000
ds-sequence.pop.php                                24-May-2024 14:02                4361
ds-sequence.push.php                               24-May-2024 14:02                4799
ds-sequence.reduce.php                             24-May-2024 14:02                8103
ds-sequence.remove.php                             24-May-2024 14:02                4986
ds-sequence.reverse.php                            24-May-2024 14:02                3787
ds-sequence.reversed.php                           24-May-2024 14:02                4140
ds-sequence.rotate.php                             24-May-2024 14:02                5200
ds-sequence.set.php                                24-May-2024 14:02                6189
ds-sequence.shift.php                              24-May-2024 14:02                4462
ds-sequence.slice.php                              24-May-2024 14:02                7317
ds-sequence.sort.php                               24-May-2024 14:02                7618
ds-sequence.sorted.php                             24-May-2024 14:02                7637
ds-sequence.sum.php                                24-May-2024 14:02                5384
ds-sequence.unshift.php                            24-May-2024 14:02                4867
ds-set.add.php                                     24-May-2024 14:02               12174
ds-set.allocate.php                                24-May-2024 14:02                4548
ds-set.capacity.php                                24-May-2024 14:02                3911
ds-set.clear.php                                   24-May-2024 14:02                3769
ds-set.construct.php                               24-May-2024 14:02                4272
ds-set.contains.php                                24-May-2024 14:02                7288
ds-set.copy.php                                    24-May-2024 14:02                4233
ds-set.count.php                                   24-May-2024 14:02                1587
ds-set.diff.php                                    24-May-2024 14:02                4744
ds-set.filter.php                                  24-May-2024 14:02                7561
ds-set.first.php                                   24-May-2024 14:02                3717
ds-set.get.php                                     24-May-2024 14:02                6534
ds-set.intersect.php                               24-May-2024 14:02                4975
ds-set.isempty.php                                 24-May-2024 14:02                4098
ds-set.join.php                                    24-May-2024 14:02                5684
ds-set.jsonserialize.php                           24-May-2024 14:02                1852
ds-set.last.php                                    24-May-2024 14:02                3718
ds-set.merge.php                                   24-May-2024 14:02                4800
ds-set.reduce.php                                  24-May-2024 14:02                7930
ds-set.remove.php                                  24-May-2024 14:02                4983
ds-set.reverse.php                                 24-May-2024 14:02                3622
ds-set.reversed.php                                24-May-2024 14:02                3955
ds-set.slice.php                                   24-May-2024 14:02                7066
ds-set.sort.php                                    24-May-2024 14:02                7427
ds-set.sorted.php                                  24-May-2024 14:02                7446
ds-set.sum.php                                     24-May-2024 14:02                5199
ds-set.toarray.php                                 24-May-2024 14:02                4075
ds-set.union.php                                   24-May-2024 14:02                4938
ds-set.xor.php                                     24-May-2024 14:02                4914
ds-stack.allocate.php                              24-May-2024 14:02                2865
ds-stack.capacity.php                              24-May-2024 14:02                2198
ds-stack.clear.php                                 24-May-2024 14:02                3819
ds-stack.construct.php                             24-May-2024 14:02                4284
ds-stack.copy.php                                  24-May-2024 14:02                4294
ds-stack.count.php                                 24-May-2024 14:02                1623
ds-stack.isempty.php                               24-May-2024 14:02                4156
ds-stack.jsonserialize.php                         24-May-2024 14:02                1886
ds-stack.peek.php                                  24-May-2024 14:02                4340
ds-stack.pop.php                                   24-May-2024 14:02                4874
ds-stack.push.php                                  24-May-2024 14:02                4712
ds-stack.toarray.php                               24-May-2024 14:02                4120
ds-vector.allocate.php                             24-May-2024 14:02                4494
ds-vector.apply.php                                24-May-2024 14:02                4999
ds-vector.capacity.php                             24-May-2024 14:02                4413
ds-vector.clear.php                                24-May-2024 14:02                3850
ds-vector.construct.php                            24-May-2024 14:02                4352
ds-vector.contains.php                             24-May-2024 14:02                7121
ds-vector.copy.php                                 24-May-2024 14:02                4318
ds-vector.count.php                                24-May-2024 14:02                1640
ds-vector.filter.php                               24-May-2024 14:02                7647
ds-vector.find.php                                 24-May-2024 14:02                5453
ds-vector.first.php                                24-May-2024 14:02                3790
ds-vector.get.php                                  24-May-2024 14:02                6621
ds-vector.insert.php                               24-May-2024 14:02                6702
ds-vector.isempty.php                              24-May-2024 14:02                4164
ds-vector.join.php                                 24-May-2024 14:02                5765
ds-vector.jsonserialize.php                        24-May-2024 14:02                1894
ds-vector.last.php                                 24-May-2024 14:02                3777
ds-vector.map.php                                  24-May-2024 14:02                5356
ds-vector.merge.php                                24-May-2024 14:02                4905
ds-vector.pop.php                                  24-May-2024 14:02                4274
ds-vector.push.php                                 24-May-2024 14:02                4706
ds-vector.reduce.php                               24-May-2024 14:02                8012
ds-vector.remove.php                               24-May-2024 14:02                4899
ds-vector.reverse.php                              24-May-2024 14:02                3700
ds-vector.reversed.php                             24-May-2024 14:02                4047
ds-vector.rotate.php                               24-May-2024 14:02                5097
ds-vector.set.php                                  24-May-2024 14:02                6096
ds-vector.shift.php                                24-May-2024 14:02                4375
ds-vector.slice.php                                24-May-2024 14:02                7198
ds-vector.sort.php                                 24-May-2024 14:02                7523
ds-vector.sorted.php                               24-May-2024 14:02                7542
ds-vector.sum.php                                  24-May-2024 14:02                5289
ds-vector.toarray.php                              24-May-2024 14:02                4154
ds-vector.unshift.php                              24-May-2024 14:02                4786
ds.constants.php                                   24-May-2024 14:02                1193
ds.examples.php                                    24-May-2024 14:02                4721
ds.installation.php                                24-May-2024 14:02                2549
ds.requirements.php                                24-May-2024 14:02                1258
ds.setup.php                                       24-May-2024 14:02                1484
eio.configuration.php                              24-May-2024 14:02                1331
eio.constants.php                                  24-May-2024 14:02               22361
eio.examples.php                                   24-May-2024 14:02               27858
eio.installation.php                               24-May-2024 14:02                1828
eio.requirements.php                               24-May-2024 14:02                1396
eio.resources.php                                  24-May-2024 14:02                1296
eio.setup.php                                      24-May-2024 14:02                1665
emptyiterator.current.php                          24-May-2024 14:02                2783
emptyiterator.key.php                              24-May-2024 14:02                2748
emptyiterator.next.php                             24-May-2024 14:02                2434
emptyiterator.rewind.php                           24-May-2024 14:02                2456
emptyiterator.valid.php                            24-May-2024 14:02                2529
enchant.configuration.php                          24-May-2024 14:02                1361
enchant.constants.php                              24-May-2024 14:02                2515
enchant.examples.php                               24-May-2024 14:02                5517
enchant.installation.php                           24-May-2024 14:02                1817
enchant.requirements.php                           24-May-2024 14:02                1880
enchant.resources.php                              24-May-2024 14:02                1389
enchant.setup.php                                  24-May-2024 14:02                1719
error.clone.php                                    24-May-2024 14:02                2848
error.construct.php                                24-May-2024 14:02                3472
error.getcode.php                                  24-May-2024 14:02                4106
error.getfile.php                                  24-May-2024 14:02                3811
error.getline.php                                  24-May-2024 14:02                4033
error.getmessage.php                               24-May-2024 14:02                3871
error.getprevious.php                              24-May-2024 14:02                6677
error.gettrace.php                                 24-May-2024 14:02                4357
error.gettraceasstring.php                         24-May-2024 14:02                4147
error.tostring.php                                 24-May-2024 14:02                4033
errorexception.construct.php                       24-May-2024 14:02                6292
errorexception.getseverity.php                     24-May-2024 14:02                4418
errorfunc.configuration.php                        24-May-2024 14:02               28132
errorfunc.constants.php                            24-May-2024 14:02               11876
errorfunc.examples.php                             24-May-2024 14:02               19364
errorfunc.installation.php                         24-May-2024 14:02                1347
errorfunc.requirements.php                         24-May-2024 14:02                1303
errorfunc.resources.php                            24-May-2024 14:02                1307
errorfunc.setup.php                                24-May-2024 14:02                1733
ev.backend.php                                     24-May-2024 14:02                3443
ev.configuration.php                               24-May-2024 14:02                1326
ev.depth.php                                       24-May-2024 14:02                3359
ev.embeddablebackends.php                          24-May-2024 14:02                6476
ev.examples.php                                    24-May-2024 14:02               41806
ev.feedsignal.php                                  24-May-2024 14:02                3402
ev.feedsignalevent.php                             24-May-2024 14:02                3189
ev.global.constants.php                            24-May-2024 14:02                1364
ev.installation.php                                24-May-2024 14:02                1821
ev.iteration.php                                   24-May-2024 14:02                2672
ev.now.php                                         24-May-2024 14:02                3124
ev.nowupdate.php                                   24-May-2024 14:02                3206
ev.periodic-modes.php                              24-May-2024 14:02                7686
ev.recommendedbackends.php                         24-May-2024 14:02                7168
ev.requirements.php                                24-May-2024 14:02                1316
ev.resources.php                                   24-May-2024 14:02                1265
ev.resume.php                                      24-May-2024 14:02                3728
ev.run.php                                         24-May-2024 14:02                5100
ev.setup.php                                       24-May-2024 14:02                1623
ev.sleep.php                                       24-May-2024 14:02                2461
ev.stop.php                                        24-May-2024 14:02                2901
ev.supportedbackends.php                           24-May-2024 14:02                6458
ev.suspend.php                                     24-May-2024 14:02                3495
ev.time.php                                        24-May-2024 14:02                2698
ev.verify.php                                      24-May-2024 14:02                2286
ev.watcher-callbacks.php                           24-May-2024 14:02                4559
ev.watchers.php                                    24-May-2024 14:02                3479
evcheck.construct.php                              24-May-2024 14:02                3674
evcheck.createstopped.php                          24-May-2024 14:02                3784
evchild.construct.php                              24-May-2024 14:02                6751
evchild.createstopped.php                          24-May-2024 14:02                5155
evchild.set.php                                    24-May-2024 14:02                3238
evembed.construct.php                              24-May-2024 14:02                7967
evembed.createstopped.php                          24-May-2024 14:02                4797
evembed.set.php                                    24-May-2024 14:02                2585
evembed.sweep.php                                  24-May-2024 14:02                3119
event.add.php                                      24-May-2024 14:02               10304
event.addsignal.php                                24-May-2024 14:02                1692
event.addtimer.php                                 24-May-2024 14:02                1701
event.callbacks.php                                24-May-2024 14:02                5714
event.configuration.php                            24-May-2024 14:02                1347
event.construct.php                                24-May-2024 14:02                4602
event.constructing.signal.events.php               24-May-2024 14:02                6075
event.del.php                                      24-May-2024 14:02                2658
event.delsignal.php                                24-May-2024 14:02                1692
event.deltimer.php                                 24-May-2024 14:02                1689
event.examples.php                                 24-May-2024 14:02              165057
event.flags.php                                    24-May-2024 14:02                2640
event.free.php                                     24-May-2024 14:02                3054
event.getsupportedmethods.php                      24-May-2024 14:02                2695
event.installation.php                             24-May-2024 14:02                1848
event.pending.php                                  24-May-2024 14:02                3146
event.persistence.php                              24-May-2024 14:02                2968
event.requirements.php                             24-May-2024 14:02                1531
event.resources.php                                24-May-2024 14:02                1263
event.set.php                                      24-May-2024 14:02                4722
event.setpriority.php                              24-May-2024 14:02                2638
event.settimer.php                                 24-May-2024 14:02                4151
event.setup.php                                    24-May-2024 14:02                1662
event.signal.php                                   24-May-2024 14:02                4337
event.timer.php                                    24-May-2024 14:02                3627
eventbase.construct.php                            24-May-2024 14:02                3078
eventbase.dispatch.php                             24-May-2024 14:02                3426
eventbase.exit.php                                 24-May-2024 14:02                3231
eventbase.free.php                                 24-May-2024 14:02                3433
eventbase.getfeatures.php                          24-May-2024 14:02                5907
eventbase.getmethod.php                            24-May-2024 14:02                4662
eventbase.gettimeofdaycached.php                   24-May-2024 14:02                2809
eventbase.gotexit.php                              24-May-2024 14:02                3503
eventbase.gotstop.php                              24-May-2024 14:02                3461
eventbase.loop.php                                 24-May-2024 14:02                3730
eventbase.priorityinit.php                         24-May-2024 14:02                3132
eventbase.reinit.php                               24-May-2024 14:02                2487
eventbase.stop.php                                 24-May-2024 14:02                2968
eventbuffer.add.php                                24-May-2024 14:02                3116
eventbuffer.addbuffer.php                          24-May-2024 14:02                3481
eventbuffer.appendfrom.php                         24-May-2024 14:02                4999
eventbuffer.construct.php                          24-May-2024 14:02                2005
eventbuffer.copyout.php                            24-May-2024 14:02                4021
eventbuffer.drain.php                              24-May-2024 14:02                3607
eventbuffer.enablelocking.php                      24-May-2024 14:02                3018
eventbuffer.expand.php                             24-May-2024 14:02                2939
eventbuffer.freeze.php                             24-May-2024 14:02                3170
eventbuffer.lock.php                               24-May-2024 14:02                3088
eventbuffer.prepend.php                            24-May-2024 14:02                3596
eventbuffer.prependbuffer.php                      24-May-2024 14:02                3758
eventbuffer.pullup.php                             24-May-2024 14:02                4760
eventbuffer.read.php                               24-May-2024 14:02                5035
eventbuffer.readfrom.php                           24-May-2024 14:02                4461
eventbuffer.readline.php                           24-May-2024 14:02                4382
eventbuffer.search.php                             24-May-2024 14:02                8445
eventbuffer.searcheol.php                          24-May-2024 14:02                4991
eventbuffer.substr.php                             24-May-2024 14:02                3631
eventbuffer.unfreeze.php                           24-May-2024 14:02                3180
eventbuffer.unlock.php                             24-May-2024 14:02                2878
eventbuffer.write.php                              24-May-2024 14:02                3537
eventbufferevent.about.callbacks.php               24-May-2024 14:02                6179
eventbufferevent.close.php                         24-May-2024 14:02                2621
eventbufferevent.connect.php                       24-May-2024 14:02               23952
eventbufferevent.connecthost.php                   24-May-2024 14:02               17848
eventbufferevent.construct.php                     24-May-2024 14:02                6951
eventbufferevent.createpair.php                    24-May-2024 14:02                4389
eventbufferevent.disable.php                       24-May-2024 14:02                3618
eventbufferevent.enable.php                        24-May-2024 14:02                4088
eventbufferevent.free.php                          24-May-2024 14:02                2842
eventbufferevent.getdnserrorstring.php             24-May-2024 14:02                3165
eventbufferevent.getenabled.php                    24-May-2024 14:02                3114
eventbufferevent.getinput.php                      24-May-2024 14:02                5056
eventbufferevent.getoutput.php                     24-May-2024 14:02                7937
eventbufferevent.read.php                          24-May-2024 14:02                3133
eventbufferevent.readbuffer.php                    24-May-2024 14:02                3304
eventbufferevent.setcallbacks.php                  24-May-2024 14:02                4625
eventbufferevent.setpriority.php                   24-May-2024 14:02                3025
eventbufferevent.settimeouts.php                   24-May-2024 14:02                3245
eventbufferevent.setwatermark.php                  24-May-2024 14:02                4157
eventbufferevent.sslerror.php                      24-May-2024 14:02                5938
eventbufferevent.sslfilter.php                     24-May-2024 14:02               34587
eventbufferevent.sslgetcipherinfo.php              24-May-2024 14:02                2976
eventbufferevent.sslgetciphername.php              24-May-2024 14:02                2879
eventbufferevent.sslgetcipherversion.php           24-May-2024 14:02                2908
eventbufferevent.sslgetprotocol.php                24-May-2024 14:02                2785
eventbufferevent.sslrenegotiate.php                24-May-2024 14:02                2882
eventbufferevent.sslsocket.php                     24-May-2024 14:02                5983
eventbufferevent.write.php                         24-May-2024 14:02                3300
eventbufferevent.writebuffer.php                   24-May-2024 14:02                3422
eventconfig.avoidmethod.php                        24-May-2024 14:02                4462
eventconfig.construct.php                          24-May-2024 14:02                4095
eventconfig.requirefeatures.php                    24-May-2024 14:02                6084
eventconfig.setflags.php                           24-May-2024 14:02                3445
eventconfig.setmaxdispatchinterval.php             24-May-2024 14:02                4613
eventdnsbase.addnameserverip.php                   24-May-2024 14:02                3047
eventdnsbase.addsearch.php                         24-May-2024 14:02                2615
eventdnsbase.clearsearch.php                       24-May-2024 14:02                2863
eventdnsbase.construct.php                         24-May-2024 14:02                7586
eventdnsbase.countnameservers.php                  24-May-2024 14:02                2592
eventdnsbase.loadhosts.php                         24-May-2024 14:02                2920
eventdnsbase.parseresolvconf.php                   24-May-2024 14:02                4296
eventdnsbase.setoption.php                         24-May-2024 14:02                3494
eventdnsbase.setsearchndots.php                    24-May-2024 14:02                2983
eventhttp.accept.php                               24-May-2024 14:02               12456
eventhttp.addserveralias.php                       24-May-2024 14:02                6504
eventhttp.bind.php                                 24-May-2024 14:02                7919
eventhttp.construct.php                            24-May-2024 14:02               17446
eventhttp.removeserveralias.php                    24-May-2024 14:02                3310
eventhttp.setallowedmethods.php                    24-May-2024 14:02                3454
eventhttp.setcallback.php                          24-May-2024 14:02               18118
eventhttp.setdefaultcallback.php                   24-May-2024 14:02                7922
eventhttp.setmaxbodysize.php                       24-May-2024 14:02                2969
eventhttp.setmaxheaderssize.php                    24-May-2024 14:02                2881
eventhttp.settimeout.php                           24-May-2024 14:02                2568
eventhttpconnection.construct.php                  24-May-2024 14:02                5173
eventhttpconnection.getbase.php                    24-May-2024 14:02                2667
eventhttpconnection.getpeer.php                    24-May-2024 14:02                3084
eventhttpconnection.makerequest.php                24-May-2024 14:02               11726
eventhttpconnection.setclosecallback.php           24-May-2024 14:02                9489
eventhttpconnection.setlocaladdress.php            24-May-2024 14:02                3268
eventhttpconnection.setlocalport.php               24-May-2024 14:02                3154
eventhttpconnection.setmaxbodysize.php             24-May-2024 14:02                3193
eventhttpconnection.setmaxheaderssize.php          24-May-2024 14:02                3214
eventhttpconnection.setretries.php                 24-May-2024 14:02                2798
eventhttpconnection.settimeout.php                 24-May-2024 14:02                2695
eventhttprequest.addheader.php                     24-May-2024 14:02                4032
eventhttprequest.cancel.php                        24-May-2024 14:02                2896
eventhttprequest.clearheaders.php                  24-May-2024 14:02                2848
eventhttprequest.closeconnection.php               24-May-2024 14:02                2451
eventhttprequest.construct.php                     24-May-2024 14:02               11458
eventhttprequest.findheader.php                    24-May-2024 14:02                3596
eventhttprequest.free.php                          24-May-2024 14:02                2359
eventhttprequest.getbufferevent.php                24-May-2024 14:02                3731
eventhttprequest.getcommand.php                    24-May-2024 14:02                2731
eventhttprequest.getconnection.php                 24-May-2024 14:02                4485
eventhttprequest.gethost.php                       24-May-2024 14:02                2908
eventhttprequest.getinputbuffer.php                24-May-2024 14:02                2810
eventhttprequest.getinputheaders.php               24-May-2024 14:02                2901
eventhttprequest.getoutputbuffer.php               24-May-2024 14:02                2869
eventhttprequest.getoutputheaders.php              24-May-2024 14:02                2852
eventhttprequest.getresponsecode.php               24-May-2024 14:02                3188
eventhttprequest.geturi.php                        24-May-2024 14:02                3101
eventhttprequest.removeheader.php                  24-May-2024 14:02                3556
eventhttprequest.senderror.php                     24-May-2024 14:02                5896
eventhttprequest.sendreply.php                     24-May-2024 14:02                4104
eventhttprequest.sendreplychunk.php                24-May-2024 14:02                3476
eventhttprequest.sendreplyend.php                  24-May-2024 14:02                3081
eventhttprequest.sendreplystart.php                24-May-2024 14:02                4363
eventlistener.construct.php                        24-May-2024 14:02               22465
eventlistener.disable.php                          24-May-2024 14:02                2862
eventlistener.enable.php                           24-May-2024 14:02                2848
eventlistener.getbase.php                          24-May-2024 14:02                2370
eventlistener.getsocketname.php                    24-May-2024 14:02                3415
eventlistener.setcallback.php                      24-May-2024 14:02                6076
eventlistener.seterrorcallback.php                 24-May-2024 14:02                4445
eventsslcontext.construct.php                      24-May-2024 14:02                5335
eventutil.construct.php                            24-May-2024 14:02                2195
eventutil.getlastsocketerrno.php                   24-May-2024 14:02                3345
eventutil.getlastsocketerror.php                   24-May-2024 14:02                3161
eventutil.getsocketfd.php                          24-May-2024 14:02                3263
eventutil.getsocketname.php                        24-May-2024 14:02                3818
eventutil.setsocketoption.php                      24-May-2024 14:02                5772
eventutil.sslrandpoll.php                          24-May-2024 14:02                2424
evfork.construct.php                               24-May-2024 14:02                3700
evfork.createstopped.php                           24-May-2024 14:02                3986
evidle.construct.php                               24-May-2024 14:02                3704
evidle.createstopped.php                           24-May-2024 14:02                4184
evio.construct.php                                 24-May-2024 14:02                4852
evio.createstopped.php                             24-May-2024 14:02                5190
evio.set.php                                       24-May-2024 14:02                2880
evloop.backend.php                                 24-May-2024 14:02                2762
evloop.check.php                                   24-May-2024 14:02                3341
evloop.child.php                                   24-May-2024 14:02                3823
evloop.construct.php                               24-May-2024 14:02                4071
evloop.defaultloop.php                             24-May-2024 14:02                4670
evloop.embed.php                                   24-May-2024 14:02                3866
evloop.fork.php                                    24-May-2024 14:02                3423
evloop.idle.php                                    24-May-2024 14:02                3443
evloop.invokepending.php                           24-May-2024 14:02                2266
evloop.io.php                                      24-May-2024 14:02                3879
evloop.loopfork.php                                24-May-2024 14:02                2604
evloop.now.php                                     24-May-2024 14:02                2868
evloop.nowupdate.php                               24-May-2024 14:02                3185
evloop.periodic.php                                24-May-2024 14:02                4017
evloop.prepare.php                                 24-May-2024 14:02                3449
evloop.resume.php                                  24-May-2024 14:02                2845
evloop.run.php                                     24-May-2024 14:02                5083
evloop.signal.php                                  24-May-2024 14:02                3751
evloop.stat.php                                    24-May-2024 14:02                3932
evloop.stop.php                                    24-May-2024 14:02                3013
evloop.suspend.php                                 24-May-2024 14:02                2837
evloop.timer.php                                   24-May-2024 14:02                3944
evloop.verify.php                                  24-May-2024 14:02                2610
evperiodic.again.php                               24-May-2024 14:02                2600
evperiodic.at.php                                  24-May-2024 14:02                2671
evperiodic.construct.php                           24-May-2024 14:02               10057
evperiodic.createstopped.php                       24-May-2024 14:02                5892
evperiodic.set.php                                 24-May-2024 14:02                3237
evprepare.construct.php                            24-May-2024 14:02                3678
evprepare.createstopped.php                        24-May-2024 14:02                4404
evsignal.construct.php                             24-May-2024 14:02                5628
evsignal.createstopped.php                         24-May-2024 14:02                4877
evsignal.set.php                                   24-May-2024 14:02                2538
evstat.attr.php                                    24-May-2024 14:02                8254
evstat.construct.php                               24-May-2024 14:02                7248
evstat.createstopped.php                           24-May-2024 14:02                5248
evstat.prev.php                                    24-May-2024 14:02                2966
evstat.set.php                                     24-May-2024 14:02                2896
evstat.stat.php                                    24-May-2024 14:02                3023
evtimer.again.php                                  24-May-2024 14:02                3095
evtimer.construct.php                              24-May-2024 14:02               12688
evtimer.createstopped.php                          24-May-2024 14:02                8388
evtimer.set.php                                    24-May-2024 14:02                3053
evwatcher.clear.php                                24-May-2024 14:02                2858
evwatcher.construct.php                            24-May-2024 14:02                2136
evwatcher.feed.php                                 24-May-2024 14:02                2650
evwatcher.getloop.php                              24-May-2024 14:02                2344
evwatcher.invoke.php                               24-May-2024 14:02                2657
evwatcher.keepalive.php                            24-May-2024 14:02                5369
evwatcher.setcallback.php                          24-May-2024 14:02                2612
evwatcher.start.php                                24-May-2024 14:02                2542
evwatcher.stop.php                                 24-May-2024 14:02                2511
example.xml-external-entity.php                    24-May-2024 14:02               21475
example.xml-map-tags.php                           24-May-2024 14:02                8239
example.xml-structure.php                          24-May-2024 14:02                6277
example.xmlwriter-namespace.php                    24-May-2024 14:02                5440
example.xmlwriter-oop.php                          24-May-2024 14:02                3427
example.xmlwriter-simple.php                       24-May-2024 14:02                8671
exception.clone.php                                24-May-2024 14:02                3118
exception.construct.php                            24-May-2024 14:02                3846
exception.getcode.php                              24-May-2024 14:02                4708
exception.getfile.php                              24-May-2024 14:02                3932
exception.getline.php                              24-May-2024 14:02                4152
exception.getmessage.php                           24-May-2024 14:02                3991
exception.getprevious.php                          24-May-2024 14:02                6863
exception.gettrace.php                             24-May-2024 14:02                4483
exception.gettraceasstring.php                     24-May-2024 14:02                4286
exception.tostring.php                             24-May-2024 14:02                4221
exec.configuration.php                             24-May-2024 14:02                1340
exec.constants.php                                 24-May-2024 14:02                1246
exec.installation.php                              24-May-2024 14:02                1312
exec.requirements.php                              24-May-2024 14:02                1268
exec.resources.php                                 24-May-2024 14:02                1407
exec.setup.php                                     24-May-2024 14:02                1694
exif.configuration.php                             24-May-2024 14:02                8028
exif.constants.php                                 24-May-2024 14:02                1907
exif.installation.php                              24-May-2024 14:02                1744
exif.requirements.php                              24-May-2024 14:02                1474
exif.resources.php                                 24-May-2024 14:02                1272
exif.setup.php                                     24-May-2024 14:02                1684
expect.configuration.php                           24-May-2024 14:02                5581
expect.constants.php                               24-May-2024 14:02                3961
expect.examples-usage.php                          24-May-2024 14:02               12260
expect.examples.php                                24-May-2024 14:02                1440
expect.installation.php                            24-May-2024 14:02                2524
expect.requirements.php                            24-May-2024 14:02                1400
expect.resources.php                               24-May-2024 14:02                1482
expect.setup.php                                   24-May-2024 14:02                1711
extensions.alphabetical.php                        24-May-2024 14:02               20937
extensions.membership.php                          24-May-2024 14:02               20625
extensions.php                                     24-May-2024 14:02                1736
extensions.state.php                               24-May-2024 14:02                2821
fann.configuration.php                             24-May-2024 14:02                1340
fann.constants.php                                 24-May-2024 14:02               24688
fann.examples-1.php                                24-May-2024 14:02                8636
fann.examples.php                                  24-May-2024 14:02                1396
fann.installation.php                              24-May-2024 14:02                5035
fann.requirements.php                              24-May-2024 14:02                1237
fann.resources.php                                 24-May-2024 14:02                1221
fann.setup.php                                     24-May-2024 14:02                1658
fannconnection.construct.php                       24-May-2024 14:02                3070
fannconnection.getfromneuron.php                   24-May-2024 14:02                2414
fannconnection.gettoneuron.php                     24-May-2024 14:02                2395
fannconnection.getweight.php                       24-May-2024 14:02                2333
fannconnection.setweight.php                       24-May-2024 14:02                2990
faq.build.php                                      24-May-2024 14:02               23940
faq.com.php                                        24-May-2024 14:02               11959
faq.databases.php                                  24-May-2024 14:02                7852
faq.general.php                                    24-May-2024 14:02                4978
faq.html.php                                       24-May-2024 14:02               20174
faq.installation.php                               24-May-2024 14:02               26622
faq.mailinglist.php                                24-May-2024 14:02               11473
faq.misc.php                                       24-May-2024 14:02                4852
faq.obtaining.php                                  24-May-2024 14:02               10737
faq.passwords.php                                  24-May-2024 14:02               10119
faq.php                                            24-May-2024 14:02                2092
faq.using.php                                      24-May-2024 14:02               21852
fdf.configuration.php                              24-May-2024 14:02                1333
fdf.constants.php                                  24-May-2024 14:02                9258
fdf.examples.php                                   24-May-2024 14:02                6033
fdf.installation.php                               24-May-2024 14:02                3543
fdf.requirements.php                               24-May-2024 14:02                1576
fdf.resources.php                                  24-May-2024 14:02                1778
fdf.setup.php                                      24-May-2024 14:02                1661
features.commandline.differences.php               24-May-2024 14:02               12031
features.commandline.ini.php                       24-May-2024 14:02                2384
features.commandline.interactive.php               24-May-2024 14:02                7970
features.commandline.introduction.php              24-May-2024 14:02                6322
features.commandline.io-streams.php                24-May-2024 14:02                5864
features.commandline.options.php                   24-May-2024 14:02               27573
features.commandline.php                           24-May-2024 14:02                2123
features.commandline.usage.php                     24-May-2024 14:02               14454
features.commandline.webserver.php                 24-May-2024 14:02               11710
features.connection-handling.php                   24-May-2024 14:02                5713
features.cookies.php                               24-May-2024 14:02                3121
features.dtrace.dtrace.php                         24-May-2024 14:02               14699
features.dtrace.introduction.php                   24-May-2024 14:02                3741
features.dtrace.php                                24-May-2024 14:02                1745
features.dtrace.systemtap.php                      24-May-2024 14:02                8247
features.file-upload.common-pitfalls.php           24-May-2024 14:02                5643
features.file-upload.errors.php                    24-May-2024 14:02                3722
features.file-upload.errors.seealso.php            24-May-2024 14:02                1392
features.file-upload.multiple.php                  24-May-2024 14:02                4769
features.file-upload.php                           24-May-2024 14:02                1962
features.file-upload.post-method.php               24-May-2024 14:02               15995
features.file-upload.put-method.php                24-May-2024 14:02                5929
features.gc.collecting-cycles.php                  24-May-2024 14:02                8338
features.gc.performance-considerations.php         24-May-2024 14:02               14017
features.gc.php                                    24-May-2024 14:02                1937
features.gc.refcounting-basics.php                 24-May-2024 14:02               21720
features.http-auth.php                             24-May-2024 14:02               23982
features.persistent-connections.php                24-May-2024 14:02                8658
features.php                                       24-May-2024 14:02                4315
features.remote-files.php                          24-May-2024 14:02                8153
features.sessions.php                              24-May-2024 14:02                1458
features.xforms.php                                24-May-2024 14:02                5464
ffi-ctype.getalignment.php                         24-May-2024 14:02                2399
ffi-ctype.getarrayelementtype.php                  24-May-2024 14:02                2485
ffi-ctype.getarraylength.php                       24-May-2024 14:02                2442
ffi-ctype.getattributes.php                        24-May-2024 14:02                2418
ffi-ctype.getenumkind.php                          24-May-2024 14:02                2394
ffi-ctype.getfuncabi.php                           24-May-2024 14:02                2402
ffi-ctype.getfuncparametercount.php                24-May-2024 14:02                2508
ffi-ctype.getfuncparametertype.php                 24-May-2024 14:02                2750
ffi-ctype.getfuncreturntype.php                    24-May-2024 14:02                2467
ffi-ctype.getkind.php                              24-May-2024 14:02                2356
ffi-ctype.getname.php                              24-May-2024 14:02                2362
ffi-ctype.getpointertype.php                       24-May-2024 14:02                2411
ffi-ctype.getsize.php                              24-May-2024 14:02                2374
ffi-ctype.getstructfieldnames.php                  24-May-2024 14:02                2484
ffi-ctype.getstructfieldoffset.php                 24-May-2024 14:02                2746
ffi-ctype.getstructfieldtype.php                   24-May-2024 14:02                2708
ffi.addr.php                                       24-May-2024 14:02                2809
ffi.alignof.php                                    24-May-2024 14:02                2939
ffi.arraytype.php                                  24-May-2024 14:02                4639
ffi.cast.php                                       24-May-2024 14:02                4859
ffi.cdef.php                                       24-May-2024 14:02                4477
ffi.configuration.php                              24-May-2024 14:02                4452
ffi.constants.php                                  24-May-2024 14:02                1184
ffi.examples-basic.php                             24-May-2024 14:02               15799
ffi.examples-callback.php                          24-May-2024 14:02                4951
ffi.examples-complete.php                          24-May-2024 14:02                5353
ffi.examples.php                                   24-May-2024 14:02                1543
ffi.free.php                                       24-May-2024 14:02                2451
ffi.installation.php                               24-May-2024 14:02                1494
ffi.isnull.php                                     24-May-2024 14:02                2552
ffi.load.php                                       24-May-2024 14:02                4322
ffi.memcmp.php                                     24-May-2024 14:02                4117
ffi.memcpy.php                                     24-May-2024 14:02                3303
ffi.memset.php                                     24-May-2024 14:02                3143
ffi.new.php                                        24-May-2024 14:02                5191
ffi.requirements.php                               24-May-2024 14:02                1335
ffi.resources.php                                  24-May-2024 14:02                1265
ffi.scope.php                                      24-May-2024 14:02                3161
ffi.setup.php                                      24-May-2024 14:02                1651
ffi.sizeof.php                                     24-May-2024 14:02                2780
ffi.string.php                                     24-May-2024 14:02                4228
ffi.type.php                                       24-May-2024 14:02                3605
ffi.typeof.php                                     24-May-2024 14:02                2873
fiber.construct.php                                24-May-2024 14:02                2375
fiber.getcurrent.php                               24-May-2024 14:02                2532
fiber.getreturn.php                                24-May-2024 14:02                2605
fiber.isrunning.php                                24-May-2024 14:02                2753
fiber.isstarted.php                                24-May-2024 14:02                2367
fiber.issuspended.php                              24-May-2024 14:02                2382
fiber.isterminated.php                             24-May-2024 14:02                2439
fiber.resume.php                                   24-May-2024 14:02                3359
fiber.start.php                                    24-May-2024 14:02                3036
fiber.suspend.php                                  24-May-2024 14:02                4075
fiber.throw.php                                    24-May-2024 14:02                3219
fibererror.construct.php                           24-May-2024 14:02                2198
fileinfo.configuration.php                         24-May-2024 14:02                1368
fileinfo.constants.php                             24-May-2024 14:02                5204
fileinfo.installation.php                          24-May-2024 14:02                2690
fileinfo.requirements.php                          24-May-2024 14:02                1352
fileinfo.resources.php                             24-May-2024 14:02                1438
fileinfo.setup.php                                 24-May-2024 14:02                1727
filesystem.configuration.php                       24-May-2024 14:02                7690
filesystem.constants.php                           24-May-2024 14:02               13075
filesystem.installation.php                        24-May-2024 14:02                1354
filesystem.requirements.php                        24-May-2024 14:02                1310
filesystem.resources.php                           24-May-2024 14:02                1474
filesystem.setup.php                               24-May-2024 14:02                1768
filesystemiterator.construct.php                   24-May-2024 14:02                6052
filesystemiterator.current.php                     24-May-2024 14:02                5209
filesystemiterator.getflags.php                    24-May-2024 14:02                3267
filesystemiterator.key.php                         24-May-2024 14:02                5174
filesystemiterator.next.php                        24-May-2024 14:02                4554
filesystemiterator.rewind.php                      24-May-2024 14:02                5174
filesystemiterator.setflags.php                    24-May-2024 14:02                6755
filter.configuration.php                           24-May-2024 14:02                5388
filter.constants.php                               24-May-2024 14:02               21466
filter.examples.php                                24-May-2024 14:02                1509
filter.examples.sanitization.php                   24-May-2024 14:02                5590
filter.examples.validation.php                     24-May-2024 14:02                9493
filter.filters.flags.php                           24-May-2024 14:02               15644
filter.filters.misc.php                            24-May-2024 14:02                1959
filter.filters.php                                 24-May-2024 14:02                1683
filter.filters.sanitize.php                        24-May-2024 14:02               11024
filter.filters.validate.php                        24-May-2024 14:02               13274
filter.installation.php                            24-May-2024 14:02                1429
filter.requirements.php                            24-May-2024 14:02                1282
filter.resources.php                               24-May-2024 14:02                1277
filter.setup.php                                   24-May-2024 14:02                1694
filteriterator.accept.php                          24-May-2024 14:02                5310
filteriterator.construct.php                       24-May-2024 14:02                3127
filteriterator.current.php                         24-May-2024 14:02                3058
filteriterator.key.php                             24-May-2024 14:02                2992
filteriterator.next.php                            24-May-2024 14:02                3017
filteriterator.rewind.php                          24-May-2024 14:02                3187
filteriterator.valid.php                           24-May-2024 14:02                2689
filters.compression.php                            24-May-2024 14:02               15807
filters.convert.php                                24-May-2024 14:02               11680
filters.encryption.php                             24-May-2024 14:02               41098
filters.php                                        24-May-2024 14:02                3464
filters.string.php                                 24-May-2024 14:02               10240
finfo.buffer.php                                   24-May-2024 14:02                2715
finfo.construct.php                                24-May-2024 14:02                2422
finfo.file.php                                     24-May-2024 14:02                2707
finfo.set-flags.php                                24-May-2024 14:02                2122
fpm.observability.php                              24-May-2024 14:02                1470
fpm.setup.php                                      24-May-2024 14:02                1373
fpm.status.php                                     24-May-2024 14:02               10551
ftp.configuration.php                              24-May-2024 14:02                1333
ftp.constants.php                                  24-May-2024 14:02                4972
ftp.examples-basic.php                             24-May-2024 14:02                4923
ftp.examples.php                                   24-May-2024 14:02                1394
ftp.installation.php                               24-May-2024 14:02                1545
ftp.requirements.php                               24-May-2024 14:02                1261
ftp.resources.php                                  24-May-2024 14:02                1535
ftp.setup.php                                      24-May-2024 14:02                1662
funchand.configuration.php                         24-May-2024 14:02                1368
funchand.constants.php                             24-May-2024 14:02                1254
funchand.installation.php                          24-May-2024 14:02                1340
funchand.requirements.php                          24-May-2024 14:02                1296
funchand.resources.php                             24-May-2024 14:02                1300
funchand.setup.php                                 24-May-2024 14:02                1716
funcref.php                                        24-May-2024 14:02               14884
function.abs.php                                   24-May-2024 14:02                4800
function.acos.php                                  24-May-2024 14:02                3488
function.acosh.php                                 24-May-2024 14:02                3308
function.addcslashes.php                           24-May-2024 14:02                7968
function.addslashes.php                            24-May-2024 14:02                6242
function.apache-child-terminate.php                24-May-2024 14:02                4424
function.apache-get-modules.php                    24-May-2024 14:02                3309
function.apache-get-version.php                    24-May-2024 14:02                3686
function.apache-getenv.php                         24-May-2024 14:02                5331
function.apache-lookup-uri.php                     24-May-2024 14:02                5707
function.apache-note.php                           24-May-2024 14:02                6867
function.apache-request-headers.php                24-May-2024 14:02                5626
function.apache-response-headers.php               24-May-2024 14:02                4238
function.apache-setenv.php                         24-May-2024 14:02                5848
function.apcu-add.php                              24-May-2024 14:02                8518
function.apcu-cache-info.php                       24-May-2024 14:02                6904
function.apcu-cas.php                              24-May-2024 14:02                8853
function.apcu-clear-cache.php                      24-May-2024 14:02                2646
function.apcu-dec.php                              24-May-2024 14:02                8324
function.apcu-delete.php                           24-May-2024 14:02                6201
function.apcu-enabled.php                          24-May-2024 14:02                2424
function.apcu-entry.php                            24-May-2024 14:02                8495
function.apcu-exists.php                           24-May-2024 14:02                6989
function.apcu-fetch.php                            24-May-2024 14:02                5829
function.apcu-inc.php                              24-May-2024 14:02                8266
function.apcu-key-info.php                         24-May-2024 14:02                5012
function.apcu-sma-info.php                         24-May-2024 14:02                4649
function.apcu-store.php                            24-May-2024 14:02                7391
function.array-change-key-case.php                 24-May-2024 14:02                5863
function.array-chunk.php                           24-May-2024 14:02                7086
function.array-column.php                          24-May-2024 14:02               17167
function.array-combine.php                         24-May-2024 14:02                7343
function.array-count-values.php                    24-May-2024 14:02                5798
function.array-diff-assoc.php                      24-May-2024 14:02               11218
function.array-diff-key.php                        24-May-2024 14:02               13191
function.array-diff-uassoc.php                     24-May-2024 14:02               12690
function.array-diff-ukey.php                       24-May-2024 14:02               12773
function.array-diff.php                            24-May-2024 14:02                7365
function.array-fill-keys.php                       24-May-2024 14:02                5393
function.array-fill.php                            24-May-2024 14:02                7649
function.array-filter.php                          24-May-2024 14:02               16280
function.array-flip.php                            24-May-2024 14:02                7546
function.array-intersect-assoc.php                 24-May-2024 14:02                9000
function.array-intersect-key.php                   24-May-2024 14:02               10523
function.array-intersect-uassoc.php                24-May-2024 14:02                9362
function.array-intersect-ukey.php                  24-May-2024 14:02               12480
function.array-intersect.php                       24-May-2024 14:02                6902
function.array-is-list.php                         24-May-2024 14:02                7147
function.array-key-exists.php                      24-May-2024 14:02                8915
function.array-key-first.php                       24-May-2024 14:02                7001
function.array-key-last.php                        24-May-2024 14:02                3237
function.array-keys.php                            24-May-2024 14:02                8578
function.array-map.php                             24-May-2024 14:02               20437
function.array-merge-recursive.php                 24-May-2024 14:02                6642
function.array-merge.php                           24-May-2024 14:02               12345
function.array-multisort.php                       24-May-2024 14:02               25129
function.array-pad.php                             24-May-2024 14:02                7010
function.array-pop.php                             24-May-2024 14:02                6137
function.array-product.php                         24-May-2024 14:02                4828
function.array-push.php                            24-May-2024 14:02                6795
function.array-rand.php                            24-May-2024 14:02                6798
function.array-reduce.php                          24-May-2024 14:02               10269
function.array-replace-recursive.php               24-May-2024 14:02               11391
function.array-replace.php                         24-May-2024 14:02                7095
function.array-reverse.php                         24-May-2024 14:02                6264
function.array-search.php                          24-May-2024 14:02                9198
function.array-shift.php                           24-May-2024 14:02                5891
function.array-slice.php                           24-May-2024 14:02               10587
function.array-splice.php                          24-May-2024 14:02               16332
function.array-sum.php                             24-May-2024 14:02                4946
function.array-udiff-assoc.php                     24-May-2024 14:02               15093
function.array-udiff-uassoc.php                    24-May-2024 14:02               16389
function.array-udiff.php                           24-May-2024 14:02               27299
function.array-uintersect-assoc.php                24-May-2024 14:02                8719
function.array-uintersect-uassoc.php               24-May-2024 14:02                8993
function.array-uintersect.php                      24-May-2024 14:02                8252
function.array-unique.php                          24-May-2024 14:02               10612
function.array-unshift.php                         24-May-2024 14:02                6151
function.array-values.php                          24-May-2024 14:02                4643
function.array-walk-recursive.php                  24-May-2024 14:02                7725
function.array-walk.php                            24-May-2024 14:02               11605
function.array.php                                 24-May-2024 14:02               11648
function.arsort.php                                24-May-2024 14:02                6450
function.asin.php                                  24-May-2024 14:02                3478
function.asinh.php                                 24-May-2024 14:02                3300
function.asort.php                                 24-May-2024 14:02                6434
function.assert-options.php                        24-May-2024 14:02                8478
function.assert.php                                24-May-2024 14:02               25567
function.atan.php                                  24-May-2024 14:02                3495
function.atan2.php                                 24-May-2024 14:02                3480
function.atanh.php                                 24-May-2024 14:02                3333
function.autoload.php                              24-May-2024 14:02                3185
function.base-convert.php                          24-May-2024 14:02                6110
function.base64-decode.php                         24-May-2024 14:02                5269
function.base64-encode.php                         24-May-2024 14:02                4774
function.basename.php                              24-May-2024 14:02                7479
function.bcadd.php                                 24-May-2024 14:02                5328
function.bccomp.php                                24-May-2024 14:02                5223
function.bcdiv.php                                 24-May-2024 14:02                4915
function.bcmod.php                                 24-May-2024 14:02                4446
function.bcmul.php                                 24-May-2024 14:02                5066
function.bcpow.php                                 24-May-2024 14:02                6384
function.bcpowmod.php                              24-May-2024 14:02                6870
function.bcscale.php                               24-May-2024 14:02                4250
function.bcsqrt.php                                24-May-2024 14:02                4455
function.bcsub.php                                 24-May-2024 14:02                5328
function.bin2hex.php                               24-May-2024 14:02                3158
function.bind-textdomain-codeset.php               24-May-2024 14:02                3347
function.bindec.php                                24-May-2024 14:02               14195
function.bindtextdomain.php                        24-May-2024 14:02                5606
function.boolval.php                               24-May-2024 14:02               10283
function.bzclose.php                               24-May-2024 14:02                3130
function.bzcompress.php                            24-May-2024 14:02                5171
function.bzdecompress.php                          24-May-2024 14:02                5598
function.bzerrno.php                               24-May-2024 14:02                3220
function.bzerror.php                               24-May-2024 14:02                4455
function.bzerrstr.php                              24-May-2024 14:02                3229
function.bzflush.php                               24-May-2024 14:02                3397
function.bzopen.php                                24-May-2024 14:02                5090
function.bzread.php                                24-May-2024 14:02                6548
function.bzwrite.php                               24-May-2024 14:02                5694
function.cal-days-in-month.php                     24-May-2024 14:02                4733
function.cal-from-jd.php                           24-May-2024 14:02                6980
function.cal-info.php                              24-May-2024 14:02                6206
function.cal-to-jd.php                             24-May-2024 14:02                6163
function.call-user-func-array.php                  24-May-2024 14:02               14003
function.call-user-func.php                        24-May-2024 14:02               15284
function.ceil.php                                  24-May-2024 14:02                4658
function.chdir.php                                 24-May-2024 14:02                4876
function.checkdate.php                             24-May-2024 14:02                5622
function.checkdnsrr.php                            24-May-2024 14:02                5883
function.chgrp.php                                 24-May-2024 14:02                6538
function.chmod.php                                 24-May-2024 14:02                8837
function.chop.php                                  24-May-2024 14:02                2103
function.chown.php                                 24-May-2024 14:02                6629
function.chr.php                                   24-May-2024 14:02                4744
function.chroot.php                                24-May-2024 14:02                4187
function.chunk-split.php                           24-May-2024 14:02                5497
function.class-alias.php                           24-May-2024 14:02                7579
function.class-exists.php                          24-May-2024 14:02                7831
function.class-implements.php                      24-May-2024 14:02                7263
function.class-parents.php                         24-May-2024 14:02                6961
function.class-uses.php                            24-May-2024 14:02                6490
function.clearstatcache.php                        24-May-2024 14:02               11695
function.cli-get-process-title.php                 24-May-2024 14:02                4537
function.cli-set-process-title.php                 24-May-2024 14:02                5595
function.closedir.php                              24-May-2024 14:02                4571
function.closelog.php                              24-May-2024 14:02                2851
function.com-create-guid.php                       24-May-2024 14:02                2891
function.com-event-sink.php                        24-May-2024 14:02               10457
function.com-get-active-object.php                 24-May-2024 14:02                5734
function.com-load-typelib.php                      24-May-2024 14:02                5250
function.com-message-pump.php                      24-May-2024 14:02                4102
function.com-print-typeinfo.php                    24-May-2024 14:02                5185
function.commonmark-parse.php                      24-May-2024 14:02                3933
function.commonmark-render-html.php                24-May-2024 14:02                4404
function.commonmark-render-latex.php               24-May-2024 14:02                4734
function.commonmark-render-man.php                 24-May-2024 14:02                4716
function.commonmark-render-xml.php                 24-May-2024 14:02                4361
function.commonmark-render.php                     24-May-2024 14:02                4662
function.compact.php                               24-May-2024 14:02                6890
function.connection-aborted.php                    24-May-2024 14:02                2912
function.connection-status.php                     24-May-2024 14:02                3043
function.constant.php                              24-May-2024 14:02                6591
function.convert-cyr-string.php                    24-May-2024 14:02                4895
function.convert-uudecode.php                      24-May-2024 14:02                4017
function.convert-uuencode.php                      24-May-2024 14:02                4433
function.copy.php                                  24-May-2024 14:02                6709
function.cos.php                                   24-May-2024 14:02                4010
function.cosh.php                                  24-May-2024 14:02                3171
function.count-chars.php                           24-May-2024 14:02                6827
function.count.php                                 24-May-2024 14:02               11925
function.crc32.php                                 24-May-2024 14:02                7314
function.create-function.php                       24-May-2024 14:02               17399
function.crypt.php                                 24-May-2024 14:02               21771
function.ctype-alnum.php                           24-May-2024 14:02                7052
function.ctype-alpha.php                           24-May-2024 14:02                7408
function.ctype-cntrl.php                           24-May-2024 14:02                7046
function.ctype-digit.php                           24-May-2024 14:02                9166
function.ctype-graph.php                           24-May-2024 14:02                7775
function.ctype-lower.php                           24-May-2024 14:02                7100
function.ctype-print.php                           24-May-2024 14:02                7839
function.ctype-punct.php                           24-May-2024 14:02                7151
function.ctype-space.php                           24-May-2024 14:02                7898
function.ctype-upper.php                           24-May-2024 14:02                7188
function.ctype-xdigit.php                          24-May-2024 14:02                6974
function.cubrid-affected-rows.php                  24-May-2024 14:02                9541
function.cubrid-bind.php                           24-May-2024 14:02               20838
function.cubrid-client-encoding.php                24-May-2024 14:02                5443
function.cubrid-close-prepare.php                  24-May-2024 14:02                6346
function.cubrid-close-request.php                  24-May-2024 14:02                6347
function.cubrid-close.php                          24-May-2024 14:02                6542
function.cubrid-col-get.php                        24-May-2024 14:02                8713
function.cubrid-col-size.php                       24-May-2024 14:02                8879
function.cubrid-column-names.php                   24-May-2024 14:02                8710
function.cubrid-column-types.php                   24-May-2024 14:02                8691
function.cubrid-commit.php                         24-May-2024 14:02               15569
function.cubrid-connect-with-url.php               24-May-2024 14:02               15709
function.cubrid-connect.php                        24-May-2024 14:02               12657
function.cubrid-current-oid.php                    24-May-2024 14:02                6118
function.cubrid-data-seek.php                      24-May-2024 14:02                7550
function.cubrid-db-name.php                        24-May-2024 14:02                6709
function.cubrid-disconnect.php                     24-May-2024 14:02                7301
function.cubrid-drop.php                           24-May-2024 14:02               11561
function.cubrid-errno.php                          24-May-2024 14:02                7011
function.cubrid-error-code-facility.php            24-May-2024 14:02                5941
function.cubrid-error-code.php                     24-May-2024 14:02                5931
function.cubrid-error-msg.php                      24-May-2024 14:02                5386
function.cubrid-error.php                          24-May-2024 14:02                6576
function.cubrid-execute.php                        24-May-2024 14:02               14361
function.cubrid-fetch-array.php                    24-May-2024 14:02               10019
function.cubrid-fetch-assoc.php                    24-May-2024 14:02                9245
function.cubrid-fetch-field.php                    24-May-2024 14:02               14297
function.cubrid-fetch-lengths.php                  24-May-2024 14:02                4672
function.cubrid-fetch-object.php                   24-May-2024 14:02               12195
function.cubrid-fetch-row.php                      24-May-2024 14:02                9155
function.cubrid-fetch.php                          24-May-2024 14:02               10240
function.cubrid-field-flags.php                    24-May-2024 14:02                7902
function.cubrid-field-len.php                      24-May-2024 14:02                8387
function.cubrid-field-name.php                     24-May-2024 14:02                7314
function.cubrid-field-seek.php                     24-May-2024 14:02               11067
function.cubrid-field-table.php                    24-May-2024 14:02                7384
function.cubrid-field-type.php                     24-May-2024 14:02                7456
function.cubrid-free-result.php                    24-May-2024 14:02                5905
function.cubrid-get-autocommit.php                 24-May-2024 14:02                4040
function.cubrid-get-charset.php                    24-May-2024 14:02                5205
function.cubrid-get-class-name.php                 24-May-2024 14:02                6474
function.cubrid-get-client-info.php                24-May-2024 14:02                8249
function.cubrid-get-db-parameter.php               24-May-2024 14:02               14844
function.cubrid-get-query-timeout.php              24-May-2024 14:02                6797
function.cubrid-get-server-info.php                24-May-2024 14:02                8532
function.cubrid-get.php                            24-May-2024 14:02               10009
function.cubrid-insert-id.php                      24-May-2024 14:02                7227
function.cubrid-is-instance.php                    24-May-2024 14:02                7251
function.cubrid-list-dbs.php                       24-May-2024 14:02                4657
function.cubrid-load-from-glo.php                  24-May-2024 14:02                7080
function.cubrid-lob-close.php                      24-May-2024 14:02                7360
function.cubrid-lob-export.php                     24-May-2024 14:02                8084
function.cubrid-lob-get.php                        24-May-2024 14:02                7860
function.cubrid-lob-send.php                       24-May-2024 14:02                7225
function.cubrid-lob-size.php                       24-May-2024 14:02                6056
function.cubrid-lob2-bind.php                      24-May-2024 14:02               10035
function.cubrid-lob2-close.php                     24-May-2024 14:02                3530
function.cubrid-lob2-export.php                    24-May-2024 14:02                8939
function.cubrid-lob2-import.php                    24-May-2024 14:02                8850
function.cubrid-lob2-new.php                       24-May-2024 14:02                4051
function.cubrid-lob2-read.php                      24-May-2024 14:02               13920
function.cubrid-lob2-seek.php                      24-May-2024 14:02               11466
function.cubrid-lob2-seek64.php                    24-May-2024 14:02               12955
function.cubrid-lob2-size.php                      24-May-2024 14:02                4475
function.cubrid-lob2-size64.php                    24-May-2024 14:02                4672
function.cubrid-lob2-tell.php                      24-May-2024 14:02                4499
function.cubrid-lob2-tell64.php                    24-May-2024 14:02                4721
function.cubrid-lob2-write.php                     24-May-2024 14:02               14321
function.cubrid-lock-read.php                      24-May-2024 14:02                9329
function.cubrid-lock-write.php                     24-May-2024 14:02                9714
function.cubrid-move-cursor.php                    24-May-2024 14:02                9456
function.cubrid-new-glo.php                        24-May-2024 14:02                7094
function.cubrid-next-result.php                    24-May-2024 14:02               16450
function.cubrid-num-cols.php                       24-May-2024 14:02                6069
function.cubrid-num-fields.php                     24-May-2024 14:02                5786
function.cubrid-num-rows.php                       24-May-2024 14:02                7278
function.cubrid-pconnect-with-url.php              24-May-2024 14:02               14985
function.cubrid-pconnect.php                       24-May-2024 14:02               12421
function.cubrid-ping.php                           24-May-2024 14:02                6182
function.cubrid-prepare.php                        24-May-2024 14:02               10421
function.cubrid-put.php                            24-May-2024 14:02               11571
function.cubrid-query.php                          24-May-2024 14:02               14718
function.cubrid-real-escape-string.php             24-May-2024 14:02                8353
function.cubrid-result.php                         24-May-2024 14:02                7629
function.cubrid-rollback.php                       24-May-2024 14:02               14782
function.cubrid-save-to-glo.php                    24-May-2024 14:02                6984
function.cubrid-schema.php                         24-May-2024 14:02               20773
function.cubrid-send-glo.php                       24-May-2024 14:02                6430
function.cubrid-seq-drop.php                       24-May-2024 14:02                9965
function.cubrid-seq-insert.php                     24-May-2024 14:02               10488
function.cubrid-seq-put.php                        24-May-2024 14:02               10438
function.cubrid-set-add.php                        24-May-2024 14:02                9774
function.cubrid-set-autocommit.php                 24-May-2024 14:02                4446
function.cubrid-set-db-parameter.php               24-May-2024 14:02                8433
function.cubrid-set-drop.php                       24-May-2024 14:02                9752
function.cubrid-set-query-timeout.php              24-May-2024 14:02                3761
function.cubrid-unbuffered-query.php               24-May-2024 14:02                7157
function.cubrid-version.php                        24-May-2024 14:02                8815
function.curl-close.php                            24-May-2024 14:02                5201
function.curl-copy-handle.php                      24-May-2024 14:02                5145
function.curl-errno.php                            24-May-2024 14:02                5398
function.curl-error.php                            24-May-2024 14:02                5336
function.curl-escape.php                           24-May-2024 14:02                6781
function.curl-exec.php                             24-May-2024 14:02                6720
function.curl-getinfo.php                          24-May-2024 14:02               38727
function.curl-init.php                             24-May-2024 14:02                7240
function.curl-multi-add-handle.php                 24-May-2024 14:02                9156
function.curl-multi-close.php                      24-May-2024 14:02                8685
function.curl-multi-errno.php                      24-May-2024 14:02                3155
function.curl-multi-exec.php                       24-May-2024 14:02               10391
function.curl-multi-getcontent.php                 24-May-2024 14:02                3554
function.curl-multi-info-read.php                  24-May-2024 14:02               11981
function.curl-multi-init.php                       24-May-2024 14:02                8991
function.curl-multi-remove-handle.php              24-May-2024 14:02                4291
function.curl-multi-select.php                     24-May-2024 14:02                3712
function.curl-multi-setopt.php                     24-May-2024 14:02                5652
function.curl-multi-strerror.php                   24-May-2024 14:02                6779
function.curl-pause.php                            24-May-2024 14:02                3119
function.curl-reset.php                            24-May-2024 14:02                5791
function.curl-setopt-array.php                     24-May-2024 14:02                8899
function.curl-setopt.php                           24-May-2024 14:02              120372
function.curl-share-close.php                      24-May-2024 14:02                7110
function.curl-share-errno.php                      24-May-2024 14:02                3202
function.curl-share-init.php                       24-May-2024 14:02                6915
function.curl-share-setopt.php                     24-May-2024 14:02                9622
function.curl-share-strerror.php                   24-May-2024 14:02                3428
function.curl-strerror.php                         24-May-2024 14:02                6223
function.curl-unescape.php                         24-May-2024 14:02                7249
function.curl-version.php                          24-May-2024 14:02                6472
function.curl_upkeep.php                           24-May-2024 14:02                6835
function.current.php                               24-May-2024 14:02               10649
function.date-add.php                              24-May-2024 14:02                1752
function.date-create-from-format.php               24-May-2024 14:02                1927
function.date-create-immutable-from-format.php     24-May-2024 14:02                2039
function.date-create-immutable.php                 24-May-2024 14:02                1931
function.date-create.php                           24-May-2024 14:02                1807
function.date-date-set.php                         24-May-2024 14:02                1811
function.date-default-timezone-get.php             24-May-2024 14:02                8458
function.date-default-timezone-set.php             24-May-2024 14:02                7287
function.date-diff.php                             24-May-2024 14:02                1771
function.date-format.php                           24-May-2024 14:02                1779
function.date-get-last-errors.php                  24-May-2024 14:02                1908
function.date-interval-create-from-date-string.php 24-May-2024 14:02                2055
function.date-interval-format.php                  24-May-2024 14:02                1906
function.date-isodate-set.php                      24-May-2024 14:02                1834
function.date-modify.php                           24-May-2024 14:02                1783
function.date-offset-get.php                       24-May-2024 14:02                1827
function.date-parse-from-format.php                24-May-2024 14:02                6069
function.date-parse.php                            24-May-2024 14:02                6441
function.date-sub.php                              24-May-2024 14:02                1734
function.date-sun-info.php                         24-May-2024 14:02                6038
function.date-sunrise.php                          24-May-2024 14:02               10182
function.date-sunset.php                           24-May-2024 14:02               10175
function.date-time-set.php                         24-May-2024 14:02                1797
function.date-timestamp-get.php                    24-May-2024 14:02                1856
function.date-timestamp-set.php                    24-May-2024 14:02                1864
function.date-timezone-get.php                     24-May-2024 14:02                1853
function.date-timezone-set.php                     24-May-2024 14:02                1825
function.date.php                                  24-May-2024 14:02               35526
function.db2-autocommit.php                        24-May-2024 14:02               10755
function.db2-bind-param.php                        24-May-2024 14:02               22730
function.db2-client-info.php                       24-May-2024 14:02               11724
function.db2-close.php                             24-May-2024 14:02                5748
function.db2-column-privileges.php                 24-May-2024 14:02                8507
function.db2-columns.php                           24-May-2024 14:02               10477
function.db2-commit.php                            24-May-2024 14:02                3886
function.db2-conn-error.php                        24-May-2024 14:02                6927
function.db2-conn-errormsg.php                     24-May-2024 14:02                6728
function.db2-connect.php                           24-May-2024 14:02               39525
function.db2-cursor-type.php                       24-May-2024 14:02                3352
function.db2-escape-string.php                     24-May-2024 14:02                7707
function.db2-exec.php                              24-May-2024 14:02               26397
function.db2-execute.php                           24-May-2024 14:02               25881
function.db2-fetch-array.php                       24-May-2024 14:02               11527
function.db2-fetch-assoc.php                       24-May-2024 14:02               11605
function.db2-fetch-both.php                        24-May-2024 14:02               12218
function.db2-fetch-object.php                      24-May-2024 14:02                9291
function.db2-fetch-row.php                         24-May-2024 14:02               16633
function.db2-field-display-size.php                24-May-2024 14:02                4974
function.db2-field-name.php                        24-May-2024 14:02                4857
function.db2-field-num.php                         24-May-2024 14:02                4878
function.db2-field-precision.php                   24-May-2024 14:02                4896
function.db2-field-scale.php                       24-May-2024 14:02                4863
function.db2-field-type.php                        24-May-2024 14:02                4867
function.db2-field-width.php                       24-May-2024 14:02                5106
function.db2-foreign-keys.php                      24-May-2024 14:02                9028
function.db2-free-result.php                       24-May-2024 14:02                3390
function.db2-free-stmt.php                         24-May-2024 14:02                3416
function.db2-get-option.php                        24-May-2024 14:02               24475
function.db2-last-insert-id.php                    24-May-2024 14:02                8041
function.db2-lob-read.php                          24-May-2024 14:02               16455
function.db2-next-result.php                       24-May-2024 14:02                8819
function.db2-num-fields.php                        24-May-2024 14:02                7143
function.db2-num-rows.php                          24-May-2024 14:02                4588
function.db2-pclose.php                            24-May-2024 14:02                5883
function.db2-pconnect.php                          24-May-2024 14:02               32533
function.db2-prepare.php                           24-May-2024 14:02               10596
function.db2-primary-keys.php                      24-May-2024 14:02                7580
function.db2-procedure-columns.php                 24-May-2024 14:02               12095
function.db2-procedures.php                        24-May-2024 14:02                8109
function.db2-result.php                            24-May-2024 14:02                7838
function.db2-rollback.php                          24-May-2024 14:02                9405
function.db2-server-info.php                       24-May-2024 14:02               22516
function.db2-set-option.php                        24-May-2024 14:02               67388
function.db2-special-columns.php                   24-May-2024 14:02               10319
function.db2-statistics.php                        24-May-2024 14:02               12590
function.db2-stmt-error.php                        24-May-2024 14:02                4700
function.db2-stmt-errormsg.php                     24-May-2024 14:02                4331
function.db2-table-privileges.php                  24-May-2024 14:02                8628
function.db2-tables.php                            24-May-2024 14:02                8958
function.dba-close.php                             24-May-2024 14:02                3285
function.dba-delete.php                            24-May-2024 14:02                4113
function.dba-exists.php                            24-May-2024 14:02                4134
function.dba-fetch.php                             24-May-2024 14:02                6440
function.dba-firstkey.php                          24-May-2024 14:02                3668
function.dba-handlers.php                          24-May-2024 14:02                5630
function.dba-insert.php                            24-May-2024 14:02                4741
function.dba-key-split.php                         24-May-2024 14:02                3723
function.dba-list.php                              24-May-2024 14:02                2124
function.dba-nextkey.php                           24-May-2024 14:02                3558
function.dba-open.php                              24-May-2024 14:02               10430
function.dba-optimize.php                          24-May-2024 14:02                3263
function.dba-popen.php                             24-May-2024 14:02                4956
function.dba-replace.php                           24-May-2024 14:02                4573
function.dba-sync.php                              24-May-2024 14:02                3288
function.dbase-add-record.php                      24-May-2024 14:02                6948
function.dbase-close.php                           24-May-2024 14:02                5287
function.dbase-create.php                          24-May-2024 14:02                8285
function.dbase-delete-record.php                   24-May-2024 14:02                5026
function.dbase-get-header-info.php                 24-May-2024 14:02                7034
function.dbase-get-record-with-names.php           24-May-2024 14:02                8777
function.dbase-get-record.php                      24-May-2024 14:02                5726
function.dbase-numfields.php                       24-May-2024 14:02                6025
function.dbase-numrecords.php                      24-May-2024 14:02                6947
function.dbase-open.php                            24-May-2024 14:02                6604
function.dbase-pack.php                            24-May-2024 14:02                6379
function.dbase-replace-record.php                  24-May-2024 14:02                9506
function.dcgettext.php                             24-May-2024 14:02                3581
function.dcngettext.php                            24-May-2024 14:02                4202
function.debug-backtrace.php                       24-May-2024 14:02               11503
function.debug-print-backtrace.php                 24-May-2024 14:02                6489
function.debug-zval-dump.php                       24-May-2024 14:02                9791
function.decbin.php                                24-May-2024 14:02                8826
function.dechex.php                                24-May-2024 14:02                7288
function.decoct.php                                24-May-2024 14:02                4893
function.define.php                                24-May-2024 14:02                8578
function.defined.php                               24-May-2024 14:02                5254
function.deflate-add.php                           24-May-2024 14:02                5995
function.deflate-init.php                          24-May-2024 14:02                7935
function.deg2rad.php                               24-May-2024 14:02                4075
function.delete.php                                24-May-2024 14:02                2400
function.dgettext.php                              24-May-2024 14:02                3316
function.die.php                                   24-May-2024 14:02                1597
function.dio-close.php                             24-May-2024 14:02                4045
function.dio-fcntl.php                             24-May-2024 14:02                9852
function.dio-open.php                              24-May-2024 14:02                8623
function.dio-read.php                              24-May-2024 14:02                3583
function.dio-seek.php                              24-May-2024 14:02                7440
function.dio-stat.php                              24-May-2024 14:02                4417
function.dio-tcsetattr.php                         24-May-2024 14:02                7018
function.dio-truncate.php                          24-May-2024 14:02                3805
function.dio-write.php                             24-May-2024 14:02                3901
function.dir.php                                   24-May-2024 14:02                6829
function.dirname.php                               24-May-2024 14:02                7775
function.disk-free-space.php                       24-May-2024 14:02                5532
function.disk-total-space.php                      24-May-2024 14:02                5213
function.diskfreespace.php                         24-May-2024 14:02                1805
function.dl.php                                    24-May-2024 14:02               11447
function.dngettext.php                             24-May-2024 14:02                3989
function.dns-check-record.php                      24-May-2024 14:02                1763
function.dns-get-mx.php                            24-May-2024 14:02                1729
function.dns-get-record.php                        24-May-2024 14:02               23359
function.dom-import-simplexml.php                  24-May-2024 14:02                7062
function.doubleval.php                             24-May-2024 14:02                1722
function.each.php                                  24-May-2024 14:02               11331
function.easter-date.php                           24-May-2024 14:02               11160
function.easter-days.php                           24-May-2024 14:02                6617
function.echo.php                                  24-May-2024 14:02               13793
function.eio-busy.php                              24-May-2024 14:02                5064
function.eio-cancel.php                            24-May-2024 14:02                7703
function.eio-chmod.php                             24-May-2024 14:02                6334
function.eio-chown.php                             24-May-2024 14:02                6540
function.eio-close.php                             24-May-2024 14:02                5748
function.eio-custom.php                            24-May-2024 14:02               10640
function.eio-dup2.php                              24-May-2024 14:02                5805
function.eio-event-loop.php                        24-May-2024 14:02                5940
function.eio-fallocate.php                         24-May-2024 14:02                7698
function.eio-fchmod.php                            24-May-2024 14:02                6295
function.eio-fchown.php                            24-May-2024 14:02                6618
function.eio-fdatasync.php                         24-May-2024 14:02                5707
function.eio-fstat.php                             24-May-2024 14:02               11858
function.eio-fstatvfs.php                          24-May-2024 14:02                5853
function.eio-fsync.php                             24-May-2024 14:02                5812
function.eio-ftruncate.php                         24-May-2024 14:02                6302
function.eio-futime.php                            24-May-2024 14:02                6675
function.eio-get-event-stream.php                  24-May-2024 14:02                8210
function.eio-get-last-error.php                    24-May-2024 14:02                3180
function.eio-grp-add.php                           24-May-2024 14:02               11797
function.eio-grp-cancel.php                        24-May-2024 14:02                3225
function.eio-grp-limit.php                         24-May-2024 14:02                3133
function.eio-grp.php                               24-May-2024 14:02               12060
function.eio-init.php                              24-May-2024 14:02                2636
function.eio-link.php                              24-May-2024 14:02               12857
function.eio-lstat.php                             24-May-2024 14:02               10138
function.eio-mkdir.php                             24-May-2024 14:02                9423
function.eio-mknod.php                             24-May-2024 14:02               11775
function.eio-nop.php                               24-May-2024 14:02                5425
function.eio-npending.php                          24-May-2024 14:02                3102
function.eio-nready.php                            24-May-2024 14:02                2820
function.eio-nreqs.php                             24-May-2024 14:02                5631
function.eio-nthreads.php                          24-May-2024 14:02                3580
function.eio-open.php                              24-May-2024 14:02               11821
function.eio-poll.php                              24-May-2024 14:02                5816
function.eio-read.php                              24-May-2024 14:02               12874
function.eio-readahead.php                         24-May-2024 14:02                6379
function.eio-readdir.php                           24-May-2024 14:02               19701
function.eio-readlink.php                          24-May-2024 14:02               12509
function.eio-realpath.php                          24-May-2024 14:02                5438
function.eio-rename.php                            24-May-2024 14:02                9532
function.eio-rmdir.php                             24-May-2024 14:02                8402
function.eio-seek.php                              24-May-2024 14:02                7164
function.eio-sendfile.php                          24-May-2024 14:02                6722
function.eio-set-max-idle.php                      24-May-2024 14:02                3235
function.eio-set-max-parallel.php                  24-May-2024 14:02                3290
function.eio-set-max-poll-reqs.php                 24-May-2024 14:02                2563
function.eio-set-max-poll-time.php                 24-May-2024 14:02                2637
function.eio-set-min-parallel.php                  24-May-2024 14:02                3273
function.eio-stat.php                              24-May-2024 14:02               10121
function.eio-statvfs.php                           24-May-2024 14:02                8596
function.eio-symlink.php                           24-May-2024 14:02               11083
function.eio-sync-file-range.php                   24-May-2024 14:02                7502
function.eio-sync.php                              24-May-2024 14:02                2937
function.eio-syncfs.php                            24-May-2024 14:02                5338
function.eio-truncate.php                          24-May-2024 14:02                6255
function.eio-unlink.php                            24-May-2024 14:02                5434
function.eio-utime.php                             24-May-2024 14:02                6346
function.eio-write.php                             24-May-2024 14:02                7042
function.empty.php                                 24-May-2024 14:02               11748
function.enchant-broker-describe.php               24-May-2024 14:02                5241
function.enchant-broker-dict-exists.php            24-May-2024 14:02                5112
function.enchant-broker-free-dict.php              24-May-2024 14:02                3499
function.enchant-broker-free.php                   24-May-2024 14:02                3272
function.enchant-broker-get-dict-path.php          24-May-2024 14:02                3923
function.enchant-broker-get-error.php              24-May-2024 14:02                2831
function.enchant-broker-init.php                   24-May-2024 14:02                2765
function.enchant-broker-list-dicts.php             24-May-2024 14:02                6119
function.enchant-broker-request-dict.php           24-May-2024 14:02                5919
function.enchant-broker-request-pwl-dict.php       24-May-2024 14:02                4212
function.enchant-broker-set-dict-path.php          24-May-2024 14:02                4331
function.enchant-broker-set-ordering.php           24-May-2024 14:02                4161
function.enchant-dict-add-to-personal.php          24-May-2024 14:02                5700
function.enchant-dict-add-to-session.php           24-May-2024 14:02                3501
function.enchant-dict-add.php                      24-May-2024 14:02                6338
function.enchant-dict-check.php                    24-May-2024 14:02                3363
function.enchant-dict-describe.php                 24-May-2024 14:02                5428
function.enchant-dict-get-error.php                24-May-2024 14:02                2846
function.enchant-dict-is-added.php                 24-May-2024 14:02                4460
function.enchant-dict-is-in-session.php            24-May-2024 14:02                3656
function.enchant-dict-quick-check.php              24-May-2024 14:02                7395
function.enchant-dict-store-replacement.php        24-May-2024 14:02                3772
function.enchant-dict-suggest.php                  24-May-2024 14:02                6581
function.end.php                                   24-May-2024 14:02                5152
function.enum-exists.php                           24-May-2024 14:02                5388
function.error-clear-last.php                      24-May-2024 14:02                4469
function.error-get-last.php                        24-May-2024 14:02                4970
function.error-log.php                             24-May-2024 14:02               10344
function.error-reporting.php                       24-May-2024 14:02               10133
function.escapeshellarg.php                        24-May-2024 14:02                5421
function.escapeshellcmd.php                        24-May-2024 14:02                6668
function.eval.php                                  24-May-2024 14:02                8759
function.exec.php                                  24-May-2024 14:02                7449
function.exif-imagetype.php                        24-May-2024 14:02                9554
function.exif-read-data.php                        24-May-2024 14:02               17584
function.exif-tagname.php                          24-May-2024 14:02                4836
function.exif-thumbnail.php                        24-May-2024 14:02                8135
function.exit.php                                  24-May-2024 14:02                9621
function.exp.php                                   24-May-2024 14:02                4364
function.expect-expectl.php                        24-May-2024 14:02               11237
function.expect-popen.php                          24-May-2024 14:02                4653
function.explode.php                               24-May-2024 14:02               15065
function.expm1.php                                 24-May-2024 14:02                4030
function.extension-loaded.php                      24-May-2024 14:02                5724
function.extract.php                               24-May-2024 14:02               14412
function.ezmlm-hash.php                            24-May-2024 14:02                4533
function.fann-cascadetrain-on-data.php             24-May-2024 14:02                7084
function.fann-cascadetrain-on-file.php             24-May-2024 14:02                5959
function.fann-clear-scaling-params.php             24-May-2024 14:02                2857
function.fann-copy.php                             24-May-2024 14:02                3390
function.fann-create-from-file.php                 24-May-2024 14:02                3437
function.fann-create-shortcut-array.php            24-May-2024 14:02                4329
function.fann-create-shortcut.php                  24-May-2024 14:02                5355
function.fann-create-sparse-array.php              24-May-2024 14:02                5017
function.fann-create-sparse.php                    24-May-2024 14:02                5773
function.fann-create-standard-array.php            24-May-2024 14:02                4666
function.fann-create-standard.php                  24-May-2024 14:02                5443
function.fann-create-train-from-callback.php       24-May-2024 14:02                9424
function.fann-create-train.php                     24-May-2024 14:02                4811
function.fann-descale-input.php                    24-May-2024 14:02                4019
function.fann-descale-output.php                   24-May-2024 14:02                4031
function.fann-descale-train.php                    24-May-2024 14:02                4014
function.fann-destroy-train.php                    24-May-2024 14:02                2825
function.fann-destroy.php                          24-May-2024 14:02                2835
function.fann-duplicate-train-data.php             24-May-2024 14:02                3113
function.fann-get-activation-function.php          24-May-2024 14:02                5558
function.fann-get-activation-steepness.php         24-May-2024 14:02                5971
function.fann-get-bias-array.php                   24-May-2024 14:02                2722
function.fann-get-bit-fail-limit.php               24-May-2024 14:02                4077
function.fann-get-bit-fail.php                     24-May-2024 14:02                5175
function.fann-get-cascade-activation-functions-..> 24-May-2024 14:02                4028
function.fann-get-cascade-activation-functions.php 24-May-2024 14:02                4872
function.fann-get-cascade-activation-steepnesse..> 24-May-2024 14:02                4072
function.fann-get-cascade-activation-steepnesse..> 24-May-2024 14:02                4252
function.fann-get-cascade-candidate-change-frac..> 24-May-2024 14:02                5436
function.fann-get-cascade-candidate-limit.php      24-May-2024 14:02                3767
function.fann-get-cascade-candidate-stagnation-..> 24-May-2024 14:02                4531
function.fann-get-cascade-max-cand-epochs.php      24-May-2024 14:02                3640
function.fann-get-cascade-max-out-epochs.php       24-May-2024 14:02                3572
function.fann-get-cascade-min-cand-epochs.php      24-May-2024 14:02                3940
function.fann-get-cascade-min-out-epochs.php       24-May-2024 14:02                3904
function.fann-get-cascade-num-candidate-groups.php 24-May-2024 14:02                4007
function.fann-get-cascade-num-candidates.php       24-May-2024 14:02                6222
function.fann-get-cascade-output-change-fractio..> 24-May-2024 14:02                5369
function.fann-get-cascade-output-stagnation-epo..> 24-May-2024 14:02                4476
function.fann-get-cascade-weight-multiplier.php    24-May-2024 14:02                3669
function.fann-get-connection-array.php             24-May-2024 14:02                2732
function.fann-get-connection-rate.php              24-May-2024 14:02                2851
function.fann-get-errno.php                        24-May-2024 14:02                3401
function.fann-get-errstr.php                       24-May-2024 14:02                3412
function.fann-get-layer-array.php                  24-May-2024 14:02                2824
function.fann-get-learning-momentum.php            24-May-2024 14:02                4114
function.fann-get-learning-rate.php                24-May-2024 14:02                4038
function.fann-get-mse.php                          24-May-2024 14:02                3296
function.fann-get-network-type.php                 24-May-2024 14:02                2808
function.fann-get-num-input.php                    24-May-2024 14:02                2746
function.fann-get-num-layers.php                   24-May-2024 14:02                2765
function.fann-get-num-output.php                   24-May-2024 14:02                2759
function.fann-get-quickprop-decay.php              24-May-2024 14:02                3563
function.fann-get-quickprop-mu.php                 24-May-2024 14:02                3421
function.fann-get-rprop-decrease-factor.php        24-May-2024 14:02                3533
function.fann-get-rprop-delta-max.php              24-May-2024 14:02                3593
function.fann-get-rprop-delta-min.php              24-May-2024 14:02                3379
function.fann-get-rprop-delta-zero.php             24-May-2024 14:02                3770
function.fann-get-rprop-increase-factor.php        24-May-2024 14:02                3527
function.fann-get-sarprop-step-error-shift.php     24-May-2024 14:02                3868
function.fann-get-sarprop-step-error-threshold-..> 24-May-2024 14:02                3975
function.fann-get-sarprop-temperature.php          24-May-2024 14:02                3702
function.fann-get-sarprop-weight-decay-shift.php   24-May-2024 14:02                3851
function.fann-get-total-connections.php            24-May-2024 14:02                2908
function.fann-get-total-neurons.php                24-May-2024 14:02                2983
function.fann-get-train-error-function.php         24-May-2024 14:02                3798
function.fann-get-train-stop-function.php          24-May-2024 14:02                3798
function.fann-get-training-algorithm.php           24-May-2024 14:02                4001
function.fann-init-weights.php                     24-May-2024 14:02                4679
function.fann-length-train-data.php                24-May-2024 14:02                3100
function.fann-merge-train-data.php                 24-May-2024 14:02                3474
function.fann-num-input-train-data.php             24-May-2024 14:02                3763
function.fann-num-output-train-data.php            24-May-2024 14:02                3758
function.fann-print-error.php                      24-May-2024 14:02                3112
function.fann-randomize-weights.php                24-May-2024 14:02                4104
function.fann-read-train-from-file.php             24-May-2024 14:02                5253
function.fann-reset-errno.php                      24-May-2024 14:02                3323
function.fann-reset-errstr.php                     24-May-2024 14:02                3307
function.fann-reset-mse.php                        24-May-2024 14:02                3625
function.fann-run.php                              24-May-2024 14:02                3062
function.fann-save-train.php                       24-May-2024 14:02                3705
function.fann-save.php                             24-May-2024 14:02                4528
function.fann-scale-input-train-data.php           24-May-2024 14:02                4379
function.fann-scale-input.php                      24-May-2024 14:02                4028
function.fann-scale-output-train-data.php          24-May-2024 14:02                4401
function.fann-scale-output.php                     24-May-2024 14:02                4028
function.fann-scale-train-data.php                 24-May-2024 14:02                4370
function.fann-scale-train.php                      24-May-2024 14:02                4033
function.fann-set-activation-function-hidden.php   24-May-2024 14:02                4741
function.fann-set-activation-function-layer.php    24-May-2024 14:02                5272
function.fann-set-activation-function-output.php   24-May-2024 14:02                4759
function.fann-set-activation-function.php          24-May-2024 14:02                6823
function.fann-set-activation-steepness-hidden.php  24-May-2024 14:02                5021
function.fann-set-activation-steepness-layer.php   24-May-2024 14:02                5487
function.fann-set-activation-steepness-output.php  24-May-2024 14:02                4990
function.fann-set-activation-steepness.php         24-May-2024 14:02                6441
function.fann-set-bit-fail-limit.php               24-May-2024 14:02                3692
function.fann-set-callback.php                     24-May-2024 14:02                5928
function.fann-set-cascade-activation-functions.php 24-May-2024 14:02                4319
function.fann-set-cascade-activation-steepnesse..> 24-May-2024 14:02                4537
function.fann-set-cascade-candidate-change-frac..> 24-May-2024 14:02                4011
function.fann-set-cascade-candidate-limit.php      24-May-2024 14:02                3799
function.fann-set-cascade-candidate-stagnation-..> 24-May-2024 14:02                4095
function.fann-set-cascade-max-cand-epochs.php      24-May-2024 14:02                3825
function.fann-set-cascade-max-out-epochs.php       24-May-2024 14:02                3772
function.fann-set-cascade-min-cand-epochs.php      24-May-2024 14:02                4125
function.fann-set-cascade-min-out-epochs.php       24-May-2024 14:02                4107
function.fann-set-cascade-num-candidate-groups.php 24-May-2024 14:02                3880
function.fann-set-cascade-output-change-fractio..> 24-May-2024 14:02                3964
function.fann-set-cascade-output-stagnation-epo..> 24-May-2024 14:02                4052
function.fann-set-cascade-weight-multiplier.php    24-May-2024 14:02                3769
function.fann-set-error-log.php                    24-May-2024 14:02                3133
function.fann-set-input-scaling-params.php         24-May-2024 14:02                4856
function.fann-set-learning-momentum.php            24-May-2024 14:02                4042
function.fann-set-learning-rate.php                24-May-2024 14:02                3976
function.fann-set-output-scaling-params.php        24-May-2024 14:02                4870
function.fann-set-quickprop-decay.php              24-May-2024 14:02                3755
function.fann-set-quickprop-mu.php                 24-May-2024 14:02                3542
function.fann-set-rprop-decrease-factor.php        24-May-2024 14:02                3811
function.fann-set-rprop-delta-max.php              24-May-2024 14:02                3917
function.fann-set-rprop-delta-min.php              24-May-2024 14:02                3710
function.fann-set-rprop-delta-zero.php             24-May-2024 14:02                4108
function.fann-set-rprop-increase-factor.php        24-May-2024 14:02                3817
function.fann-set-sarprop-step-error-shift.php     24-May-2024 14:02                4199
function.fann-set-sarprop-step-error-threshold-..> 24-May-2024 14:02                4357
function.fann-set-sarprop-temperature.php          24-May-2024 14:02                4045
function.fann-set-sarprop-weight-decay-shift.php   24-May-2024 14:02                4205
function.fann-set-scaling-params.php               24-May-2024 14:02                5965
function.fann-set-train-error-function.php         24-May-2024 14:02                4024
function.fann-set-train-stop-function.php          24-May-2024 14:02                4020
function.fann-set-training-algorithm.php           24-May-2024 14:02                3940
function.fann-set-weight-array.php                 24-May-2024 14:02                3384
function.fann-set-weight.php                       24-May-2024 14:02                3848
function.fann-shuffle-train-data.php               24-May-2024 14:02                3056
function.fann-subset-train-data.php                24-May-2024 14:02                4523
function.fann-test-data.php                        24-May-2024 14:02                4435
function.fann-test.php                             24-May-2024 14:02                4834
function.fann-train-epoch.php                      24-May-2024 14:02                4846
function.fann-train-on-data.php                    24-May-2024 14:02                6923
function.fann-train-on-file.php                    24-May-2024 14:02                6855
function.fann-train.php                            24-May-2024 14:02                4856
function.fastcgi-finish-request.php                24-May-2024 14:02                2649
function.fbird-add-user.php                        24-May-2024 14:02                2343
function.fbird-affected-rows.php                   24-May-2024 14:02                2358
function.fbird-backup.php                          24-May-2024 14:02                1785
function.fbird-blob-add.php                        24-May-2024 14:02                2671
function.fbird-blob-cancel.php                     24-May-2024 14:02                3716
function.fbird-blob-close.php                      24-May-2024 14:02                2702
function.fbird-blob-create.php                     24-May-2024 14:02                2702
function.fbird-blob-echo.php                       24-May-2024 14:02                2505
function.fbird-blob-get.php                        24-May-2024 14:02                2498
function.fbird-blob-import.php                     24-May-2024 14:02                2698
function.fbird-blob-info.php                       24-May-2024 14:02                1817
function.fbird-blob-open.php                       24-May-2024 14:02                2495
function.fbird-close.php                           24-May-2024 14:02                2281
function.fbird-commit-ret.php                      24-May-2024 14:02                1810
function.fbird-commit.php                          24-May-2024 14:02                1778
function.fbird-connect.php                         24-May-2024 14:02                2287
function.fbird-db-info.php                         24-May-2024 14:02                1791
function.fbird-delete-user.php                     24-May-2024 14:02                2355
function.fbird-drop-db.php                         24-May-2024 14:02                2303
function.fbird-errcode.php                         24-May-2024 14:02                2126
function.fbird-errmsg.php                          24-May-2024 14:02                2119
function.fbird-execute.php                         24-May-2024 14:02                2131
function.fbird-fetch-assoc.php                     24-May-2024 14:02                2371
function.fbird-fetch-object.php                    24-May-2024 14:02                2382
function.fbird-fetch-row.php                       24-May-2024 14:02                2359
function.fbird-field-info.php                      24-May-2024 14:02                2201
function.fbird-free-event-handler.php              24-May-2024 14:02                2305
function.fbird-free-query.php                      24-May-2024 14:02                1846
function.fbird-free-result.php                     24-May-2024 14:02                1831
function.fbird-gen-id.php                          24-May-2024 14:02                1788
function.fbird-maintain-db.php                     24-May-2024 14:02                1833
function.fbird-modify-user.php                     24-May-2024 14:02                2371
function.fbird-name-result.php                     24-May-2024 14:02                2354
function.fbird-num-fields.php                      24-May-2024 14:02                2190
function.fbird-num-params.php                      24-May-2024 14:02                2349
function.fbird-param-info.php                      24-May-2024 14:02                2354
function.fbird-pconnect.php                        24-May-2024 14:02                2304
function.fbird-prepare.php                         24-May-2024 14:02                1781
function.fbird-query.php                           24-May-2024 14:02                2620
function.fbird-restore.php                         24-May-2024 14:02                1788
function.fbird-rollback-ret.php                    24-May-2024 14:02                1840
function.fbird-rollback.php                        24-May-2024 14:02                1812
function.fbird-server-info.php                     24-May-2024 14:02                1843
function.fbird-service-attach.php                  24-May-2024 14:02                1882
function.fbird-service-detach.php                  24-May-2024 14:02                1894
function.fbird-set-event-handler.php               24-May-2024 14:02                2464
function.fbird-trans.php                           24-May-2024 14:02                1787
function.fbird-wait-event.php                      24-May-2024 14:02                2389
function.fclose.php                                24-May-2024 14:02                4477
function.fdatasync.php                             24-May-2024 14:02                6022
function.fdf-add-doc-javascript.php                24-May-2024 14:02                5553
function.fdf-add-template.php                      24-May-2024 14:02                2955
function.fdf-close.php                             24-May-2024 14:02                3104
function.fdf-create.php                            24-May-2024 14:02                5604
function.fdf-enum-values.php                       24-May-2024 14:02                2528
function.fdf-errno.php                             24-May-2024 14:02                2782
function.fdf-error.php                             24-May-2024 14:02                3225
function.fdf-get-ap.php                            24-May-2024 14:02                4442
function.fdf-get-attachment.php                    24-May-2024 14:02                6103
function.fdf-get-encoding.php                      24-May-2024 14:02                3407
function.fdf-get-file.php                          24-May-2024 14:02                3227
function.fdf-get-flags.php                         24-May-2024 14:02                2448
function.fdf-get-opt.php                           24-May-2024 14:02                2487
function.fdf-get-status.php                        24-May-2024 14:02                3246
function.fdf-get-value.php                         24-May-2024 14:02                4556
function.fdf-get-version.php                       24-May-2024 14:02                3606
function.fdf-header.php                            24-May-2024 14:02                2353
function.fdf-next-field-name.php                   24-May-2024 14:02                5400
function.fdf-open-string.php                       24-May-2024 14:02                4856
function.fdf-open.php                              24-May-2024 14:02                5867
function.fdf-remove-item.php                       24-May-2024 14:02                2461
function.fdf-save-string.php                       24-May-2024 14:02                5630
function.fdf-save.php                              24-May-2024 14:02                4114
function.fdf-set-ap.php                            24-May-2024 14:02                4669
function.fdf-set-encoding.php                      24-May-2024 14:02                3797
function.fdf-set-file.php                          24-May-2024 14:02                6733
function.fdf-set-flags.php                         24-May-2024 14:02                4420
function.fdf-set-javascript-action.php             24-May-2024 14:02                4617
function.fdf-set-on-import-javascript.php          24-May-2024 14:02                3238
function.fdf-set-opt.php                           24-May-2024 14:02                4703
function.fdf-set-status.php                        24-May-2024 14:02                3833
function.fdf-set-submit-form-action.php            24-May-2024 14:02                4916
function.fdf-set-target-frame.php                  24-May-2024 14:02                3833
function.fdf-set-value.php                         24-May-2024 14:02                5270
function.fdf-set-version.php                       24-May-2024 14:02                4057
function.fdiv.php                                  24-May-2024 14:02                6414
function.feof.php                                  24-May-2024 14:02                7826
function.fflush.php                                24-May-2024 14:02                5713
function.fgetc.php                                 24-May-2024 14:02                6508
function.fgetcsv.php                               24-May-2024 14:02               12173
function.fgets.php                                 24-May-2024 14:02                8734
function.fgetss.php                                24-May-2024 14:02                8844
function.file-exists.php                           24-May-2024 14:02                7196
function.file-get-contents.php                     24-May-2024 14:02               18035
function.file-put-contents.php                     24-May-2024 14:02               13839
function.file.php                                  24-May-2024 14:02               12584
function.fileatime.php                             24-May-2024 14:02                6954
function.filectime.php                             24-May-2024 14:02                7065
function.filegroup.php                             24-May-2024 14:02                5739
function.fileinode.php                             24-May-2024 14:02                5259
function.filemtime.php                             24-May-2024 14:02                6782
function.fileowner.php                             24-May-2024 14:02                5620
function.fileperms.php                             24-May-2024 14:02               16198
function.filesize.php                              24-May-2024 14:02                5759
function.filetype.php                              24-May-2024 14:02                6547
function.filter-has-var.php                        24-May-2024 14:02                3479
function.filter-id.php                             24-May-2024 14:02                2916
function.filter-input-array.php                    24-May-2024 14:02               13039
function.filter-input.php                          24-May-2024 14:02                8443
function.filter-list.php                           24-May-2024 14:02                3556
function.filter-var-array.php                      24-May-2024 14:02               12702
function.filter-var.php                            24-May-2024 14:02               12541
function.finfo-buffer.php                          24-May-2024 14:02                7323
function.finfo-close.php                           24-May-2024 14:02                2929
function.finfo-file.php                            24-May-2024 14:02                7931
function.finfo-open.php                            24-May-2024 14:02                9573
function.finfo-set-flags.php                       24-May-2024 14:02                4078
function.floatval.php                              24-May-2024 14:02                6163
function.flock.php                                 24-May-2024 14:02               13809
function.floor.php                                 24-May-2024 14:02                4753
function.flush.php                                 24-May-2024 14:02                4934
function.fmod.php                                  24-May-2024 14:02                4423
function.fnmatch.php                               24-May-2024 14:02                8677
function.fopen.php                                 24-May-2024 14:02               23689
function.forward-static-call-array.php             24-May-2024 14:02                9753
function.forward-static-call.php                   24-May-2024 14:02                9239
function.fpassthru.php                             24-May-2024 14:02                7599
function.fpm-get-status.php                        24-May-2024 14:02                2636
function.fprintf.php                               24-May-2024 14:02                9021
function.fputcsv.php                               24-May-2024 14:02                9239
function.fputs.php                                 24-May-2024 14:02                1693
function.fread.php                                 24-May-2024 14:02               14845
function.frenchtojd.php                            24-May-2024 14:02                4160
function.fscanf.php                                24-May-2024 14:02                8038
function.fseek.php                                 24-May-2024 14:02                8091
function.fsockopen.php                             24-May-2024 14:02               16074
function.fstat.php                                 24-May-2024 14:02                5979
function.fsync.php                                 24-May-2024 14:02                5784
function.ftell.php                                 24-May-2024 14:02                6123
function.ftok.php                                  24-May-2024 14:02                3802
function.ftp-alloc.php                             24-May-2024 14:02                7814
function.ftp-append.php                            24-May-2024 14:02                4539
function.ftp-cdup.php                              24-May-2024 14:02                5987
function.ftp-chdir.php                             24-May-2024 14:02                6871
function.ftp-chmod.php                             24-May-2024 14:02                6430
function.ftp-close.php                             24-May-2024 14:02                5469
function.ftp-connect.php                           24-May-2024 14:02                5834
function.ftp-delete.php                            24-May-2024 14:02                5662
function.ftp-exec.php                              24-May-2024 14:02                6191
function.ftp-fget.php                              24-May-2024 14:02                9224
function.ftp-fput.php                              24-May-2024 14:02                8588
function.ftp-get-option.php                        24-May-2024 14:02                5520
function.ftp-get.php                               24-May-2024 14:02                8488
function.ftp-login.php                             24-May-2024 14:02                6190
function.ftp-mdtm.php                              24-May-2024 14:02                6549
function.ftp-mkdir.php                             24-May-2024 14:02                5865
function.ftp-mlsd.php                              24-May-2024 14:02                9110
function.ftp-nb-continue.php                       24-May-2024 14:02                4898
function.ftp-nb-fget.php                           24-May-2024 14:02                9669
function.ftp-nb-fput.php                           24-May-2024 14:02                9443
function.ftp-nb-get.php                            24-May-2024 14:02               13180
function.ftp-nb-put.php                            24-May-2024 14:02               10513
function.ftp-nlist.php                             24-May-2024 14:02                6045
function.ftp-pasv.php                              24-May-2024 14:02                6711
function.ftp-put.php                               24-May-2024 14:02                8181
function.ftp-pwd.php                               24-May-2024 14:02                5317
function.ftp-quit.php                              24-May-2024 14:02                1691
function.ftp-raw.php                               24-May-2024 14:02                4786
function.ftp-rawlist.php                           24-May-2024 14:02                7317
function.ftp-rename.php                            24-May-2024 14:02                6442
function.ftp-rmdir.php                             24-May-2024 14:02                5958
function.ftp-set-option.php                        24-May-2024 14:02                6289
function.ftp-site.php                              24-May-2024 14:02                6164
function.ftp-size.php                              24-May-2024 14:02                6236
function.ftp-ssl-connect.php                       24-May-2024 14:02                8065
function.ftp-systype.php                           24-May-2024 14:02                4812
function.ftruncate.php                             24-May-2024 14:02                6581
function.func-get-arg.php                          24-May-2024 14:02               14233
function.func-get-args.php                         24-May-2024 14:02               11534
function.func-num-args.php                         24-May-2024 14:02                5522
function.function-exists.php                       24-May-2024 14:02                6211
function.fwrite.php                                24-May-2024 14:02               14644
function.gc-collect-cycles.php                     24-May-2024 14:02                2609
function.gc-disable.php                            24-May-2024 14:02                2609
function.gc-enable.php                             24-May-2024 14:02                2581
function.gc-enabled.php                            24-May-2024 14:02                3453
function.gc-mem-caches.php                         24-May-2024 14:02                2508
function.gc-status.php                             24-May-2024 14:02                8752
function.gd-info.php                               24-May-2024 14:02               10052
function.geoip-asnum-by-name.php                   24-May-2024 14:02                4254
function.geoip-continent-code-by-name.php          24-May-2024 14:02                5764
function.geoip-country-code-by-name.php            24-May-2024 14:02                5489
function.geoip-country-code3-by-name.php           24-May-2024 14:02                5050
function.geoip-country-name-by-name.php            24-May-2024 14:02                5014
function.geoip-database-info.php                   24-May-2024 14:02                4337
function.geoip-db-avail.php                        24-May-2024 14:02                4553
function.geoip-db-filename.php                     24-May-2024 14:02                4213
function.geoip-db-get-all-info.php                 24-May-2024 14:02                6785
function.geoip-domain-by-name.php                  24-May-2024 14:02                4488
function.geoip-id-by-name.php                      24-May-2024 14:02                5560
function.geoip-isp-by-name.php                     24-May-2024 14:02                4492
function.geoip-netspeedcell-by-name.php            24-May-2024 14:02                5230
function.geoip-org-by-name.php                     24-May-2024 14:02                4511
function.geoip-record-by-name.php                  24-May-2024 14:02                7843
function.geoip-region-by-name.php                  24-May-2024 14:02                5172
function.geoip-region-name-by-code.php             24-May-2024 14:02                7220
function.geoip-setup-custom-directory.php          24-May-2024 14:02                4256
function.geoip-time-zone-by-country-and-region.php 24-May-2024 14:02                7430
function.get-browser.php                           24-May-2024 14:02                7990
function.get-called-class.php                      24-May-2024 14:02                4853
function.get-cfg-var.php                           24-May-2024 14:02                4403
function.get-class-methods.php                     24-May-2024 14:02                6418
function.get-class-vars.php                        24-May-2024 14:02               11029
function.get-class.php                             24-May-2024 14:02                9270
function.get-current-user.php                      24-May-2024 14:02                4217
function.get-debug-type.php                        24-May-2024 14:02                9553
function.get-declared-classes.php                  24-May-2024 14:02                4441
function.get-declared-interfaces.php               24-May-2024 14:02                4132
function.get-declared-traits.php                   24-May-2024 14:02                3023
function.get-defined-constants.php                 24-May-2024 14:02                8884
function.get-defined-functions.php                 24-May-2024 14:02                6885
function.get-defined-vars.php                      24-May-2024 14:02                6110
function.get-extension-funcs.php                   24-May-2024 14:02                5634
function.get-headers.php                           24-May-2024 14:02                8602
function.get-html-translation-table.php            24-May-2024 14:02               14214
function.get-include-path.php                      24-May-2024 14:02                4108
function.get-included-files.php                    24-May-2024 14:02                5881
function.get-loaded-extensions.php                 24-May-2024 14:02                5690
function.get-magic-quotes-gpc.php                  24-May-2024 14:02                4251
function.get-magic-quotes-runtime.php              24-May-2024 14:02                3739
function.get-mangled-object-vars.php               24-May-2024 14:02                8235
function.get-meta-tags.php                         24-May-2024 14:02                7967
function.get-object-vars.php                       24-May-2024 14:02                6726
function.get-parent-class.php                      24-May-2024 14:02                7641
function.get-required-files.php                    24-May-2024 14:02                1863
function.get-resource-id.php                       24-May-2024 14:02                4883
function.get-resource-type.php                     24-May-2024 14:02                5438
function.get-resources.php                         24-May-2024 14:02                7993
function.getallheaders.php                         24-May-2024 14:02                4600
function.getcwd.php                                24-May-2024 14:02                4529
function.getdate.php                               24-May-2024 14:02                8975
function.getenv.php                                24-May-2024 14:02                4933
function.gethostbyaddr.php                         24-May-2024 14:02                4471
function.gethostbyname.php                         24-May-2024 14:02                4689
function.gethostbynamel.php                        24-May-2024 14:02                5128
function.gethostname.php                           24-May-2024 14:02                4130
function.getimagesize.php                          24-May-2024 14:02               17526
function.getimagesizefromstring.php                24-May-2024 14:02                5572
function.getlastmod.php                            24-May-2024 14:02                5051
function.getmxrr.php                               24-May-2024 14:02                6684
function.getmygid.php                              24-May-2024 14:02                3195
function.getmyinode.php                            24-May-2024 14:02                3212
function.getmypid.php                              24-May-2024 14:02                3598
function.getmyuid.php                              24-May-2024 14:02                3179
function.getopt.php                                24-May-2024 14:02               12974
function.getprotobyname.php                        24-May-2024 14:02                4661
function.getprotobynumber.php                      24-May-2024 14:02                3299
function.getrandmax.php                            24-May-2024 14:02                3018
function.getrusage.php                             24-May-2024 14:02               10994
function.getservbyname.php                         24-May-2024 14:02                6469
function.getservbyport.php                         24-May-2024 14:02                3706
function.gettext.php                               24-May-2024 14:02                5934
function.gettimeofday.php                          24-May-2024 14:02                5422
function.gettype.php                               24-May-2024 14:02                9015
function.glob.php                                  24-May-2024 14:02                9662
function.gmdate.php                                24-May-2024 14:02                8143
function.gmmktime.php                              24-May-2024 14:02               10528
function.gmp-abs.php                               24-May-2024 14:02                4632
function.gmp-add.php                               24-May-2024 14:02                4676
function.gmp-and.php                               24-May-2024 14:02                5553
function.gmp-binomial.php                          24-May-2024 14:02                4201
function.gmp-clrbit.php                            24-May-2024 14:02                5935
function.gmp-cmp.php                               24-May-2024 14:02                5952
function.gmp-com.php                               24-May-2024 14:02                4117
function.gmp-div-q.php                             24-May-2024 14:02               10780
function.gmp-div-qr.php                            24-May-2024 14:02                7110
function.gmp-div-r.php                             24-May-2024 14:02                6471
function.gmp-div.php                               24-May-2024 14:02                1710
function.gmp-divexact.php                          24-May-2024 14:02                6353
function.gmp-export.php                            24-May-2024 14:02                4539
function.gmp-fact.php                              24-May-2024 14:02                4951
function.gmp-gcd.php                               24-May-2024 14:02                5488
function.gmp-gcdext.php                            24-May-2024 14:02                9699
function.gmp-hamdist.php                           24-May-2024 14:02                6846
function.gmp-import.php                            24-May-2024 14:02                5057
function.gmp-init.php                              24-May-2024 14:02                6000
function.gmp-intval.php                            24-May-2024 14:02                5510
function.gmp-invert.php                            24-May-2024 14:02                5668
function.gmp-jacobi.php                            24-May-2024 14:02                6169
function.gmp-kronecker.php                         24-May-2024 14:02                4325
function.gmp-lcm.php                               24-May-2024 14:02                4275
function.gmp-legendre.php                          24-May-2024 14:02                6185
function.gmp-mod.php                               24-May-2024 14:02                5371
function.gmp-mul.php                               24-May-2024 14:02                5479
function.gmp-neg.php                               24-May-2024 14:02                4581
function.gmp-nextprime.php                         24-May-2024 14:02                5322
function.gmp-or.php                                24-May-2024 14:02                5909
function.gmp-perfect-power.php                     24-May-2024 14:02                3549
function.gmp-perfect-square.php                    24-May-2024 14:02                5826
function.gmp-popcount.php                          24-May-2024 14:02                5089
function.gmp-pow.php                               24-May-2024 14:02                5956
function.gmp-powm.php                              24-May-2024 14:02                6307
function.gmp-prob-prime.php                        24-May-2024 14:02                6150
function.gmp-random-bits.php                       24-May-2024 14:02                5627
function.gmp-random-range.php                      24-May-2024 14:02                6992
function.gmp-random-seed.php                       24-May-2024 14:02                7178
function.gmp-random.php                            24-May-2024 14:02                5189
function.gmp-root.php                              24-May-2024 14:02                3402
function.gmp-rootrem.php                           24-May-2024 14:02                3550
function.gmp-scan0.php                             24-May-2024 14:02                5805
function.gmp-scan1.php                             24-May-2024 14:02                5834
function.gmp-setbit.php                            24-May-2024 14:02               12163
function.gmp-sign.php                              24-May-2024 14:02                5023
function.gmp-sqrt.php                              24-May-2024 14:02                5156
function.gmp-sqrtrem.php                           24-May-2024 14:02                6541
function.gmp-strval.php                            24-May-2024 14:02                5610
function.gmp-sub.php                               24-May-2024 14:02                5506
function.gmp-testbit.php                           24-May-2024 14:02                6034
function.gmp-xor.php                               24-May-2024 14:02                5924
function.gmstrftime.php                            24-May-2024 14:02                6827
function.gnupg-adddecryptkey.php                   24-May-2024 14:02                5434
function.gnupg-addencryptkey.php                   24-May-2024 14:02                4967
function.gnupg-addsignkey.php                      24-May-2024 14:02                5439
function.gnupg-cleardecryptkeys.php                24-May-2024 14:02                4519
function.gnupg-clearencryptkeys.php                24-May-2024 14:02                4520
function.gnupg-clearsignkeys.php                   24-May-2024 14:02                4463
function.gnupg-decrypt.php                         24-May-2024 14:02                6127
function.gnupg-decryptverify.php                   24-May-2024 14:02                7221
function.gnupg-deletekey.php                       24-May-2024 14:02                5221
function.gnupg-encrypt.php                         24-May-2024 14:02                5990
function.gnupg-encryptsign.php                     24-May-2024 14:02                6888
function.gnupg-export.php                          24-May-2024 14:02                5170
function.gnupg-getengineinfo.php                   24-May-2024 14:02                5613
function.gnupg-geterror.php                        24-May-2024 14:02                4343
function.gnupg-geterrorinfo.php                    24-May-2024 14:02                5716
function.gnupg-getprotocol.php                     24-May-2024 14:02                4539
function.gnupg-gettrustlist.php                    24-May-2024 14:02                5309
function.gnupg-import.php                          24-May-2024 14:02                5476
function.gnupg-init.php                            24-May-2024 14:02                3355
function.gnupg-keyinfo.php                         24-May-2024 14:02                5355
function.gnupg-listsignatures.php                  24-May-2024 14:02                5533
function.gnupg-setarmor.php                        24-May-2024 14:02                5792
function.gnupg-seterrormode.php                    24-May-2024 14:02                5797
function.gnupg-setsignmode.php                     24-May-2024 14:02                5864
function.gnupg-sign.php                            24-May-2024 14:02                6212
function.gnupg-verify.php                          24-May-2024 14:02                8430
function.grapheme-extract.php                      24-May-2024 14:02                8010
function.grapheme-stripos.php                      24-May-2024 14:02                7800
function.grapheme-stristr.php                      24-May-2024 14:02                7919
function.grapheme-strlen.php                       24-May-2024 14:02                5480
function.grapheme-strpos.php                       24-May-2024 14:02                7451
function.grapheme-strripos.php                     24-May-2024 14:02                7805
function.grapheme-strrpos.php                      24-May-2024 14:02                7448
function.grapheme-strstr.php                       24-May-2024 14:02                7586
function.grapheme-substr.php                       24-May-2024 14:02                7807
function.gregoriantojd.php                         24-May-2024 14:02                5760
function.gzclose.php                               24-May-2024 14:02                4368
function.gzcompress.php                            24-May-2024 14:02                6168
function.gzdecode.php                              24-May-2024 14:02                3861
function.gzdeflate.php                             24-May-2024 14:02                5777
function.gzencode.php                              24-May-2024 14:02                7156
function.gzeof.php                                 24-May-2024 14:02                4273
function.gzfile.php                                24-May-2024 14:02                4888
function.gzgetc.php                                24-May-2024 14:02                4843
function.gzgets.php                                24-May-2024 14:02                6408
function.gzgetss.php                               24-May-2024 14:02                6291
function.gzinflate.php                             24-May-2024 14:02                5514
function.gzopen.php                                24-May-2024 14:02                5903
function.gzpassthru.php                            24-May-2024 14:02                4872
function.gzputs.php                                24-May-2024 14:02                1677
function.gzread.php                                24-May-2024 14:02                6943
function.gzrewind.php                              24-May-2024 14:02                3407
function.gzseek.php                                24-May-2024 14:02                6626
function.gztell.php                                24-May-2024 14:02                3606
function.gzuncompress.php                          24-May-2024 14:02                5461
function.gzwrite.php                               24-May-2024 14:02                6856
function.halt-compiler.php                         24-May-2024 14:02                5044
function.hash-algos.php                            24-May-2024 14:02                5221
function.hash-copy.php                             24-May-2024 14:02                4936
function.hash-equals.php                           24-May-2024 14:02                7038
function.hash-file.php                             24-May-2024 14:02                6620
function.hash-final.php                            24-May-2024 14:02                5849
function.hash-hkdf.php                             24-May-2024 14:02                9986
function.hash-hmac-algos.php                       24-May-2024 14:02                5378
function.hash-hmac-file.php                        24-May-2024 14:02                6849
function.hash-hmac.php                             24-May-2024 14:02                6677
function.hash-init.php                             24-May-2024 14:02                8075
function.hash-pbkdf2.php                           24-May-2024 14:02               11144
function.hash-update-file.php                      24-May-2024 14:02                5119
function.hash-update-stream.php                    24-May-2024 14:02                6689
function.hash-update.php                           24-May-2024 14:02                3952
function.hash.php                                  24-May-2024 14:02               10732
function.header-register-callback.php              24-May-2024 14:02                6982
function.header-remove.php                         24-May-2024 14:02                6162
function.header.php                                24-May-2024 14:02               18582
function.headers-list.php                          24-May-2024 14:02                5949
function.headers-sent.php                          24-May-2024 14:02                7811
function.hebrev.php                                24-May-2024 14:02                3445
function.hebrevc.php                               24-May-2024 14:02                3551
function.hex2bin.php                               24-May-2024 14:02                5792
function.hexdec.php                                24-May-2024 14:02                5774
function.highlight-file.php                        24-May-2024 14:02                5606
function.highlight-string.php                      24-May-2024 14:02                6405
function.hrtime.php                                24-May-2024 14:02                5256
function.html-entity-decode.php                    24-May-2024 14:02               15099
function.htmlentities.php                          24-May-2024 14:02               18960
function.htmlspecialchars-decode.php               24-May-2024 14:02                9222
function.htmlspecialchars.php                      24-May-2024 14:02               24834
function.http-build-query.php                      24-May-2024 14:02               19923
function.http-response-code.php                    24-May-2024 14:02                7176
function.hypot.php                                 24-May-2024 14:02                3127
function.ibase-add-user.php                        24-May-2024 14:02                5201
function.ibase-affected-rows.php                   24-May-2024 14:02                3472
function.ibase-backup.php                          24-May-2024 14:02               10518
function.ibase-blob-add.php                        24-May-2024 14:02                4015
function.ibase-blob-cancel.php                     24-May-2024 14:02                3724
function.ibase-blob-close.php                      24-May-2024 14:02                3994
function.ibase-blob-create.php                     24-May-2024 14:02                4066
function.ibase-blob-echo.php                       24-May-2024 14:02                4251
function.ibase-blob-get.php                        24-May-2024 14:02                6593
function.ibase-blob-import.php                     24-May-2024 14:02                8010
function.ibase-blob-info.php                       24-May-2024 14:02                3537
function.ibase-blob-open.php                       24-May-2024 14:02                4461
function.ibase-close.php                           24-May-2024 14:02                3826
function.ibase-commit-ret.php                      24-May-2024 14:02                3345
function.ibase-commit.php                          24-May-2024 14:02                3146
function.ibase-connect.php                         24-May-2024 14:02               10542
function.ibase-db-info.php                         24-May-2024 14:02                2779
function.ibase-delete-user.php                     24-May-2024 14:02                3617
function.ibase-drop-db.php                         24-May-2024 14:02                3724
function.ibase-errcode.php                         24-May-2024 14:02                2709
function.ibase-errmsg.php                          24-May-2024 14:02                2702
function.ibase-execute.php                         24-May-2024 14:02                6977
function.ibase-fetch-assoc.php                     24-May-2024 14:02                4747
function.ibase-fetch-object.php                    24-May-2024 14:02                6708
function.ibase-fetch-row.php                       24-May-2024 14:02                4564
function.ibase-field-info.php                      24-May-2024 14:02                6971
function.ibase-free-event-handler.php              24-May-2024 14:02                3562
function.ibase-free-query.php                      24-May-2024 14:02                2861
function.ibase-free-result.php                     24-May-2024 14:02                2953
function.ibase-gen-id.php                          24-May-2024 14:02                2898
function.ibase-maintain-db.php                     24-May-2024 14:02                3216
function.ibase-modify-user.php                     24-May-2024 14:02                5206
function.ibase-name-result.php                     24-May-2024 14:02                5816
function.ibase-num-fields.php                      24-May-2024 14:02                6432
function.ibase-num-params.php                      24-May-2024 14:02                3462
function.ibase-param-info.php                      24-May-2024 14:02                3714
function.ibase-pconnect.php                        24-May-2024 14:02                7941
function.ibase-prepare.php                         24-May-2024 14:02                4686
function.ibase-query.php                           24-May-2024 14:02                7270
function.ibase-restore.php                         24-May-2024 14:02               10831
function.ibase-rollback-ret.php                    24-May-2024 14:02                3386
function.ibase-rollback.php                        24-May-2024 14:02                3191
function.ibase-server-info.php                     24-May-2024 14:02                9879
function.ibase-service-attach.php                  24-May-2024 14:02               11057
function.ibase-service-detach.php                  24-May-2024 14:02                6172
function.ibase-set-event-handler.php               24-May-2024 14:02                7887
function.ibase-trans.php                           24-May-2024 14:02                5908
function.ibase-wait-event.php                      24-May-2024 14:02                4363
function.iconv-get-encoding.php                    24-May-2024 14:02                5610
function.iconv-mime-decode-headers.php             24-May-2024 14:02                9764
function.iconv-mime-decode.php                     24-May-2024 14:02                7763
function.iconv-mime-encode.php                     24-May-2024 14:02               12304
function.iconv-set-encoding.php                    24-May-2024 14:02                5136
function.iconv-strlen.php                          24-May-2024 14:02                4244
function.iconv-strpos.php                          24-May-2024 14:02                7218
function.iconv-strrpos.php                         24-May-2024 14:02                6192
function.iconv-substr.php                          24-May-2024 14:02                7951
function.iconv.php                                 24-May-2024 14:02                7123
function.idate.php                                 24-May-2024 14:02               10746
function.idn-to-ascii.php                          24-May-2024 14:02                6986
function.idn-to-utf8.php                           24-May-2024 14:02                6983
function.igbinary-serialize.php                    24-May-2024 14:02                9964
function.igbinary-unserialize.php                  24-May-2024 14:02               10007
function.ignore-user-abort.php                     24-May-2024 14:02                6881
function.image-type-to-extension.php               24-May-2024 14:02                5254
function.image-type-to-mime-type.php               24-May-2024 14:02                8789
function.image2wbmp.php                            24-May-2024 14:02                6179
function.imageaffine.php                           24-May-2024 14:02                3728
function.imageaffinematrixconcat.php               24-May-2024 14:02                3226
function.imageaffinematrixget.php                  24-May-2024 14:02                3317
function.imagealphablending.php                    24-May-2024 14:02                7126
function.imageantialias.php                        24-May-2024 14:02               10183
function.imagearc.php                              24-May-2024 14:02               13242
function.imageavif.php                             24-May-2024 14:02                6150
function.imagebmp.php                              24-May-2024 14:02                8257
function.imagechar.php                             24-May-2024 14:02                8998
function.imagecharup.php                           24-May-2024 14:02                8818
function.imagecolorallocate.php                    24-May-2024 14:02                9975
function.imagecolorallocatealpha.php               24-May-2024 14:02               16155
function.imagecolorat.php                          24-May-2024 14:02                8980
function.imagecolorclosest.php                     24-May-2024 14:02               11715
function.imagecolorclosestalpha.php                24-May-2024 14:02               12793
function.imagecolorclosesthwb.php                  24-May-2024 14:02                6522
function.imagecolordeallocate.php                  24-May-2024 14:02                5293
function.imagecolorexact.php                       24-May-2024 14:02                7942
function.imagecolorexactalpha.php                  24-May-2024 14:02                8856
function.imagecolormatch.php                       24-May-2024 14:02                8045
function.imagecolorresolve.php                     24-May-2024 14:02                7157
function.imagecolorresolvealpha.php                24-May-2024 14:02                7848
function.imagecolorset.php                         24-May-2024 14:02                8471
function.imagecolorsforindex.php                   24-May-2024 14:02                6366
function.imagecolorstotal.php                      24-May-2024 14:02                5315
function.imagecolortransparent.php                 24-May-2024 14:02                8123
function.imageconvolution.php                      24-May-2024 14:02               11480
function.imagecopy.php                             24-May-2024 14:02                8524
function.imagecopymerge.php                        24-May-2024 14:02                9145
function.imagecopymergegray.php                    24-May-2024 14:02                9636
function.imagecopyresampled.php                    24-May-2024 14:02               18430
function.imagecopyresized.php                      24-May-2024 14:02               13337
function.imagecreate.php                           24-May-2024 14:02                7765
function.imagecreatefromavif.php                   24-May-2024 14:02                2945
function.imagecreatefrombmp.php                    24-May-2024 14:02                5722
function.imagecreatefromgd.php                     24-May-2024 14:02                5312
function.imagecreatefromgd2.php                    24-May-2024 14:02                5500
function.imagecreatefromgd2part.php                24-May-2024 14:02                8128
function.imagecreatefromgif.php                    24-May-2024 14:02                9493
function.imagecreatefromjpeg.php                   24-May-2024 14:02                8846
function.imagecreatefrompng.php                    24-May-2024 14:02                8789
function.imagecreatefromstring.php                 24-May-2024 14:02                7039
function.imagecreatefromtga.php                    24-May-2024 14:02                3583
function.imagecreatefromwbmp.php                   24-May-2024 14:02                8499
function.imagecreatefromwebp.php                   24-May-2024 14:02                5136
function.imagecreatefromxbm.php                    24-May-2024 14:02                5021
function.imagecreatefromxpm.php                    24-May-2024 14:02                6249
function.imagecreatetruecolor.php                  24-May-2024 14:02                7098
function.imagecrop.php                             24-May-2024 14:02                3343
function.imagecropauto.php                         24-May-2024 14:02                4246
function.imagedashedline.php                       24-May-2024 14:02               12081
function.imagedestroy.php                          24-May-2024 14:02                4157
function.imageellipse.php                          24-May-2024 14:02                9744
function.imagefill.php                             24-May-2024 14:02                7085
function.imagefilledarc.php                        24-May-2024 14:02               18586
function.imagefilledellipse.php                    24-May-2024 14:02                9271
function.imagefilledpolygon.php                    24-May-2024 14:02                9936
function.imagefilledrectangle.php                  24-May-2024 14:02                7858
function.imagefilltoborder.php                     24-May-2024 14:02               10233
function.imagefilter.php                           24-May-2024 14:02               30641
function.imageflip.php                             24-May-2024 14:02                9311
function.imagefontheight.php                       24-May-2024 14:02                5691
function.imagefontwidth.php                        24-May-2024 14:02                5671
function.imageftbbox.php                           24-May-2024 14:02               13016
function.imagefttext.php                           24-May-2024 14:02               14787
function.imagegammacorrect.php                     24-May-2024 14:02                5352
function.imagegd.php                               24-May-2024 14:02                9149
function.imagegd2.php                              24-May-2024 14:02               10955
function.imagegetclip.php                          24-May-2024 14:02                6055
function.imagegetinterpolation.php                 24-May-2024 14:02                3726
function.imagegif.php                              24-May-2024 14:02               16315
function.imagegrabscreen.php                       24-May-2024 14:02                4114
function.imagegrabwindow.php                       24-May-2024 14:02                9072
function.imageinterlace.php                        24-May-2024 14:02                5216
function.imageistruecolor.php                      24-May-2024 14:02                6866
function.imagejpeg.php                             24-May-2024 14:02               15120
function.imagelayereffect.php                      24-May-2024 14:02               11277
function.imageline.php                             24-May-2024 14:02               15044
function.imageloadfont.php                         24-May-2024 14:02                8830
function.imageopenpolygon.php                      24-May-2024 14:02               10454
function.imagepalettecopy.php                      24-May-2024 14:02                6835
function.imagepalettetotruecolor.php               24-May-2024 14:02                9246
function.imagepng.php                              24-May-2024 14:02                8303
function.imagepolygon.php                          24-May-2024 14:02                8555
function.imagerectangle.php                        24-May-2024 14:02               10057
function.imageresolution.php                       24-May-2024 14:02                7869
function.imagerotate.php                           24-May-2024 14:02                9062
function.imagesavealpha.php                        24-May-2024 14:02                6531
function.imagescale.php                            24-May-2024 14:02                5571
function.imagesetbrush.php                         24-May-2024 14:02                8967
function.imagesetclip.php                          24-May-2024 14:02                5264
function.imagesetinterpolation.php                 24-May-2024 14:02               10824
function.imagesetpixel.php                         24-May-2024 14:02               10960
function.imagesetstyle.php                         24-May-2024 14:02               12647
function.imagesetthickness.php                     24-May-2024 14:02                7856
function.imagesettile.php                          24-May-2024 14:02                7963
function.imagestring.php                           24-May-2024 14:02                9035
function.imagestringup.php                         24-May-2024 14:02                8204
function.imagesx.php                               24-May-2024 14:02                4597
function.imagesy.php                               24-May-2024 14:02                4625
function.imagetruecolortopalette.php               24-May-2024 14:02                6367
function.imagettfbbox.php                          24-May-2024 14:02               18713
function.imagettftext.php                          24-May-2024 14:02               17280
function.imagetypes.php                            24-May-2024 14:02                3485
function.imagewbmp.php                             24-May-2024 14:02               14305
function.imagewebp.php                             24-May-2024 14:02                7196
function.imagexbm.php                              24-May-2024 14:02               10149
function.imap-8bit.php                             24-May-2024 14:02                3192
function.imap-alerts.php                           24-May-2024 14:02                3288
function.imap-append.php                           24-May-2024 14:02                9699
function.imap-base64.php                           24-May-2024 14:02                3551
function.imap-binary.php                           24-May-2024 14:02                3155
function.imap-body.php                             24-May-2024 14:02                5670
function.imap-bodystruct.php                       24-May-2024 14:02                4771
function.imap-check.php                            24-May-2024 14:02                6092
function.imap-clearflag-full.php                   24-May-2024 14:02                6529
function.imap-close.php                            24-May-2024 14:02                5042
function.imap-create.php                           24-May-2024 14:02                1778
function.imap-createmailbox.php                    24-May-2024 14:02               13912
function.imap-delete.php                           24-May-2024 14:02               10557
function.imap-deletemailbox.php                    24-May-2024 14:02                5024
function.imap-errors.php                           24-May-2024 14:02                3475
function.imap-expunge.php                          24-May-2024 14:02                3670
function.imap-fetch-overview.php                   24-May-2024 14:02               11357
function.imap-fetchbody.php                        24-May-2024 14:02                6270
function.imap-fetchheader.php                      24-May-2024 14:02                5921
function.imap-fetchmime.php                        24-May-2024 14:02                6459
function.imap-fetchstructure.php                   24-May-2024 14:02                9773
function.imap-fetchtext.php                        24-May-2024 14:02                1759
function.imap-gc.php                               24-May-2024 14:02                5907
function.imap-get-quota.php                        24-May-2024 14:02               12252
function.imap-get-quotaroot.php                    24-May-2024 14:02                9211
function.imap-getacl.php                           24-May-2024 14:02                5964
function.imap-getmailboxes.php                     24-May-2024 14:02               12286
function.imap-getsubscribed.php                    24-May-2024 14:02                8021
function.imap-header.php                           24-May-2024 14:02                1970
function.imap-headerinfo.php                       24-May-2024 14:02               11831
function.imap-headers.php                          24-May-2024 14:02                3551
function.imap-is-open.php                          24-May-2024 14:02                4234
function.imap-last-error.php                       24-May-2024 14:02                3204
function.imap-list.php                             24-May-2024 14:02                8799
function.imap-listmailbox.php                      24-May-2024 14:02                1764
function.imap-listscan.php                         24-May-2024 14:02                7079
function.imap-listsubscribed.php                   24-May-2024 14:02                1785
function.imap-lsub.php                             24-May-2024 14:02                6124
function.imap-mail-compose.php                     24-May-2024 14:02               16592
function.imap-mail-copy.php                        24-May-2024 14:02                6352
function.imap-mail-move.php                        24-May-2024 14:02                6732
function.imap-mail.php                             24-May-2024 14:02                7444
function.imap-mailboxmsginfo.php                   24-May-2024 14:02                9321
function.imap-mime-header-decode.php               24-May-2024 14:02                6514
function.imap-msgno.php                            24-May-2024 14:02                4240
function.imap-mutf7-to-utf8.php                    24-May-2024 14:02                3377
function.imap-num-msg.php                          24-May-2024 14:02                4097
function.imap-num-recent.php                       24-May-2024 14:02                3904
function.imap-open.php                             24-May-2024 14:02               21806
function.imap-ping.php                             24-May-2024 14:02                4966
function.imap-qprint.php                           24-May-2024 14:02                3201
function.imap-rename.php                           24-May-2024 14:02                1781
function.imap-renamemailbox.php                    24-May-2024 14:02                5689
function.imap-reopen.php                           24-May-2024 14:02                8848
function.imap-rfc822-parse-adrlist.php             24-May-2024 14:02                7904
function.imap-rfc822-parse-headers.php             24-May-2024 14:02                3754
function.imap-rfc822-write-address.php             24-May-2024 14:02                5442
function.imap-savebody.php                         24-May-2024 14:02                6664
function.imap-scan.php                             24-May-2024 14:02                1746
function.imap-scanmailbox.php                      24-May-2024 14:02                1776
function.imap-search.php                           24-May-2024 14:02               13609
function.imap-set-quota.php                        24-May-2024 14:02                6808
function.imap-setacl.php                           24-May-2024 14:02                5580
function.imap-setflag-full.php                     24-May-2024 14:02                8692
function.imap-sort.php                             24-May-2024 14:02                8606
function.imap-status.php                           24-May-2024 14:02               10811
function.imap-subscribe.php                        24-May-2024 14:02                4532
function.imap-thread.php                           24-May-2024 14:02                7944
function.imap-timeout.php                          24-May-2024 14:02                4802
function.imap-uid.php                              24-May-2024 14:02                4650
function.imap-undelete.php                         24-May-2024 14:02                5045
function.imap-unsubscribe.php                      24-May-2024 14:02                4609
function.imap-utf7-decode.php                      24-May-2024 14:02                3784
function.imap-utf7-encode.php                      24-May-2024 14:02                3301
function.imap-utf8-to-mutf7.php                    24-May-2024 14:02                3380
function.imap-utf8.php                             24-May-2024 14:02                4270
function.implode.php                               24-May-2024 14:02                7953
function.in-array.php                              24-May-2024 14:02               11300
function.include-once.php                          24-May-2024 14:02                2404
function.include.php                               24-May-2024 14:02               20961
function.inet-ntop.php                             24-May-2024 14:02                6978
function.inet-pton.php                             24-May-2024 14:02                5478
function.inflate-add.php                           24-May-2024 14:02                6311
function.inflate-get-read-len.php                  24-May-2024 14:02                3523
function.inflate-get-status.php                    24-May-2024 14:02                3294
function.inflate-init.php                          24-May-2024 14:02                7134
function.ini-alter.php                             24-May-2024 14:02                1719
function.ini-get-all.php                           24-May-2024 14:02               10280
function.ini-get.php                               24-May-2024 14:02               11431
function.ini-parse-quantity.php                    24-May-2024 14:02                7653
function.ini-restore.php                           24-May-2024 14:02                6490
function.ini-set.php                               24-May-2024 14:02                5751
function.inotify-add-watch.php                     24-May-2024 14:02                4377
function.inotify-init.php                          24-May-2024 14:02                9103
function.inotify-queue-len.php                     24-May-2024 14:02                3882
function.inotify-read.php                          24-May-2024 14:02                4580
function.inotify-rm-watch.php                      24-May-2024 14:02                3737
function.intdiv.php                                24-May-2024 14:02                7008
function.interface-exists.php                      24-May-2024 14:02                5295
function.intl-error-name.php                       24-May-2024 14:02                5184
function.intl-get-error-code.php                   24-May-2024 14:02                4565
function.intl-get-error-message.php                24-May-2024 14:02                4535
function.intl-is-failure.php                       24-May-2024 14:02                5603
function.intval.php                                24-May-2024 14:02               12492
function.ip2long.php                               24-May-2024 14:02               10096
function.iptcembed.php                             24-May-2024 14:02               11825
function.iptcparse.php                             24-May-2024 14:02                4615
function.is-a.php                                  24-May-2024 14:02                8030
function.is-array.php                              24-May-2024 14:02                5686
function.is-bool.php                               24-May-2024 14:02                5591
function.is-callable.php                           24-May-2024 14:02               10613
function.is-countable.php                          24-May-2024 14:02                6408
function.is-dir.php                                24-May-2024 14:02                6729
function.is-double.php                             24-May-2024 14:02                1722
function.is-executable.php                         24-May-2024 14:02                5694
function.is-file.php                               24-May-2024 14:02                6047
function.is-finite.php                             24-May-2024 14:02                3339
function.is-float.php                              24-May-2024 14:02                5401
function.is-infinite.php                           24-May-2024 14:02                3488
function.is-int.php                                24-May-2024 14:02                6809
function.is-integer.php                            24-May-2024 14:02                1715
function.is-iterable.php                           24-May-2024 14:02                5872
function.is-link.php                               24-May-2024 14:02                5805
function.is-long.php                               24-May-2024 14:02                1696
function.is-nan.php                                24-May-2024 14:02                4686
function.is-null.php                               24-May-2024 14:02                6103
function.is-numeric.php                            24-May-2024 14:02                8071
function.is-object.php                             24-May-2024 14:02                7376
function.is-readable.php                           24-May-2024 14:02                6501
function.is-real.php                               24-May-2024 14:02                1708
function.is-resource.php                           24-May-2024 14:02                4580
function.is-scalar.php                             24-May-2024 14:02                8191
function.is-soap-fault.php                         24-May-2024 14:02                8091
function.is-string.php                             24-May-2024 14:02                6721
function.is-subclass-of.php                        24-May-2024 14:02               13552
function.is-tainted.php                            24-May-2024 14:02                2433
function.is-uploaded-file.php                      24-May-2024 14:02                7006
function.is-writable.php                           24-May-2024 14:02                6113
function.is-writeable.php                          24-May-2024 14:02                1772
function.isset.php                                 24-May-2024 14:02               17355
function.iterator-apply.php                        24-May-2024 14:02                6249
function.iterator-count.php                        24-May-2024 14:02                7837
function.iterator-to-array.php                     24-May-2024 14:02                8216
function.jddayofweek.php                           24-May-2024 14:02                3733
function.jdmonthname.php                           24-May-2024 14:02                4435
function.jdtofrench.php                            24-May-2024 14:02                3215
function.jdtogregorian.php                         24-May-2024 14:02                3231
function.jdtojewish.php                            24-May-2024 14:02                5870
function.jdtojulian.php                            24-May-2024 14:02                3240
function.jdtounix.php                              24-May-2024 14:02                3280
function.jewishtojd.php                            24-May-2024 14:02                4048
function.join.php                                  24-May-2024 14:02                1664
function.jpeg2wbmp.php                             24-May-2024 14:02                6317
function.json-decode.php                           24-May-2024 14:02               19452
function.json-encode.php                           24-May-2024 14:02               30365
function.json-last-error-msg.php                   24-May-2024 14:02                2879
function.json-last-error.php                       24-May-2024 14:02               12286
function.json-validate.php                         24-May-2024 14:02                8668
function.juliantojd.php                            24-May-2024 14:02                4599
function.key-exists.php                            24-May-2024 14:02                1749
function.key.php                                   24-May-2024 14:02                6873
function.krsort.php                                24-May-2024 14:02                6070
function.ksort.php                                 24-May-2024 14:02                5859
function.lcfirst.php                               24-May-2024 14:02                5538
function.lcg-value.php                             24-May-2024 14:02                4732
function.lchgrp.php                                24-May-2024 14:02                5998
function.lchown.php                                24-May-2024 14:02                5856
function.ldap-8859-to-t61.php                      24-May-2024 14:02                3217
function.ldap-add-ext.php                          24-May-2024 14:02                5638
function.ldap-add.php                              24-May-2024 14:02                8584
function.ldap-bind-ext.php                         24-May-2024 14:02                5949
function.ldap-bind.php                             24-May-2024 14:02                8457
function.ldap-close.php                            24-May-2024 14:02                1729
function.ldap-compare.php                          24-May-2024 14:02                8720
function.ldap-connect-wallet.php                   24-May-2024 14:02                4510
function.ldap-connect.php                          24-May-2024 14:02                7514
function.ldap-control-paged-result-response.php    24-May-2024 14:02                4850
function.ldap-control-paged-result.php             24-May-2024 14:02               13504
function.ldap-count-entries.php                    24-May-2024 14:02                4408
function.ldap-count-references.php                 24-May-2024 14:02                4621
function.ldap-delete-ext.php                       24-May-2024 14:02                5172
function.ldap-delete.php                           24-May-2024 14:02                3521
function.ldap-dn2ufn.php                           24-May-2024 14:02                2622
function.ldap-err2str.php                          24-May-2024 14:02                4815
function.ldap-errno.php                            24-May-2024 14:02                6953
function.ldap-error.php                            24-May-2024 14:02                3977
function.ldap-escape.php                           24-May-2024 14:02                3590
function.ldap-exop-passwd.php                      24-May-2024 14:02               10491
function.ldap-exop-refresh.php                     24-May-2024 14:02                5115
function.ldap-exop-sync.php                        24-May-2024 14:02                5544
function.ldap-exop-whoami.php                      24-May-2024 14:02                3889
function.ldap-exop.php                             24-May-2024 14:02               12452
function.ldap-explode-dn.php                       24-May-2024 14:02                3698
function.ldap-first-attribute.php                  24-May-2024 14:02                5570
function.ldap-first-entry.php                      24-May-2024 14:02                4157
function.ldap-first-reference.php                  24-May-2024 14:02                2361
function.ldap-free-result.php                      24-May-2024 14:02                3278
function.ldap-get-attributes.php                   24-May-2024 14:02                7440
function.ldap-get-dn.php                           24-May-2024 14:02                3067
function.ldap-get-entries.php                      24-May-2024 14:02                4849
function.ldap-get-option.php                       24-May-2024 14:02               12022
function.ldap-get-values-len.php                   24-May-2024 14:02                4374
function.ldap-get-values.php                       24-May-2024 14:02                7646
function.ldap-list.php                             24-May-2024 14:02               12755
function.ldap-mod-add.php                          24-May-2024 14:02                4591
function.ldap-mod-del.php                          24-May-2024 14:02                4345
function.ldap-mod-replace.php                      24-May-2024 14:02                4652
function.ldap-mod_add-ext.php                      24-May-2024 14:02                5646
function.ldap-mod_del-ext.php                      24-May-2024 14:02                5657
function.ldap-mod_replace-ext.php                  24-May-2024 14:02                5726
function.ldap-modify-batch.php                     24-May-2024 14:02               18955
function.ldap-modify.php                           24-May-2024 14:02                4224
function.ldap-next-attribute.php                   24-May-2024 14:02                5061
function.ldap-next-entry.php                       24-May-2024 14:02                4412
function.ldap-next-reference.php                   24-May-2024 14:02                2349
function.ldap-parse-exop.php                       24-May-2024 14:02                5844
function.ldap-parse-reference.php                  24-May-2024 14:02                2546
function.ldap-parse-result.php                     24-May-2024 14:02                7847
function.ldap-read.php                             24-May-2024 14:02                9761
function.ldap-rename-ext.php                       24-May-2024 14:02                5993
function.ldap-rename.php                           24-May-2024 14:02                5457
function.ldap-sasl-bind.php                        24-May-2024 14:02                5867
function.ldap-search.php                           24-May-2024 14:02               14667
function.ldap-set-option.php                       24-May-2024 14:02               15982
function.ldap-set-rebind-proc.php                  24-May-2024 14:02                2411
function.ldap-sort.php                             24-May-2024 14:02                6697
function.ldap-start-tls.php                        24-May-2024 14:02                2097
function.ldap-t61-to-8859.php                      24-May-2024 14:02                2170
function.ldap-unbind.php                           24-May-2024 14:02                3162
function.levenshtein.php                           24-May-2024 14:02               12296
function.libxml-clear-errors.php                   24-May-2024 14:02                2740
function.libxml-disable-entity-loader.php          24-May-2024 14:02                3833
function.libxml-get-errors.php                     24-May-2024 14:02               10543
function.libxml-get-external-entity-loader.php     24-May-2024 14:02                3538
function.libxml-get-last-error.php                 24-May-2024 14:02                2992
function.libxml-set-external-entity-loader.php     24-May-2024 14:02                7951
function.libxml-set-streams-context.php            24-May-2024 14:02                5192
function.libxml-use-internal-errors.php            24-May-2024 14:02                6049
function.link.php                                  24-May-2024 14:02                6048
function.linkinfo.php                              24-May-2024 14:02                5006
function.list.php                                  24-May-2024 14:02               17717
function.localeconv.php                            24-May-2024 14:02                9747
function.localtime.php                             24-May-2024 14:02                9683
function.log.php                                   24-May-2024 14:02                3878
function.log10.php                                 24-May-2024 14:02                2754
function.log1p.php                                 24-May-2024 14:02                4129
function.long2ip.php                               24-May-2024 14:02                3203
function.lstat.php                                 24-May-2024 14:02                6380
function.ltrim.php                                 24-May-2024 14:02                9680
function.lzf-compress.php                          24-May-2024 14:02                3024
function.lzf-decompress.php                        24-May-2024 14:02                3119
function.lzf-optimized-for.php                     24-May-2024 14:02                2308
function.mail.php                                  24-May-2024 14:02               24661
function.mailparse-determine-best-xfer-encoding..> 24-May-2024 14:02                4394
function.mailparse-msg-create.php                  24-May-2024 14:02                3458
function.mailparse-msg-extract-part-file.php       24-May-2024 14:02                5556
function.mailparse-msg-extract-part.php            24-May-2024 14:02                4236
function.mailparse-msg-extract-whole-part-file.php 24-May-2024 14:02                4257
function.mailparse-msg-free.php                    24-May-2024 14:02                3702
function.mailparse-msg-get-part-data.php           24-May-2024 14:02                2664
function.mailparse-msg-get-part.php                24-May-2024 14:02                2947
function.mailparse-msg-get-structure.php           24-May-2024 14:02                2679
function.mailparse-msg-parse-file.php              24-May-2024 14:02                4355
function.mailparse-msg-parse.php                   24-May-2024 14:02                3668
function.mailparse-rfc822-parse-addresses.php      24-May-2024 14:02                5856
function.mailparse-stream-encode.php               24-May-2024 14:02                6088
function.mailparse-uudecode-all.php                24-May-2024 14:02                7120
function.max.php                                   24-May-2024 14:02               12464
function.mb-check-encoding.php                     24-May-2024 14:02                3627
function.mb-chr.php                                24-May-2024 14:02                7116
function.mb-convert-case.php                       24-May-2024 14:02               10309
function.mb-convert-encoding.php                   24-May-2024 14:02                7367
function.mb-convert-kana.php                       24-May-2024 14:02                9054
function.mb-convert-variables.php                  24-May-2024 14:02                6705
function.mb-decode-mimeheader.php                  24-May-2024 14:02                3413
function.mb-decode-numericentity.php               24-May-2024 14:02               33408
function.mb-detect-encoding.php                    24-May-2024 14:02                7281
function.mb-detect-order.php                       24-May-2024 14:02                8539
function.mb-encode-mimeheader.php                  24-May-2024 14:02                8791
function.mb-encode-numericentity.php               24-May-2024 14:02               12803
function.mb-encoding-aliases.php                   24-May-2024 14:02                5918
function.mb-ereg-match.php                         24-May-2024 14:02                4730
function.mb-ereg-replace-callback.php              24-May-2024 14:02               12434
function.mb-ereg-replace.php                       24-May-2024 14:02                7296
function.mb-ereg-search-getpos.php                 24-May-2024 14:02                4120
function.mb-ereg-search-getregs.php                24-May-2024 14:02                4453
function.mb-ereg-search-init.php                   24-May-2024 14:02                5249
function.mb-ereg-search-pos.php                    24-May-2024 14:02                5030
function.mb-ereg-search-regs.php                   24-May-2024 14:02                4811
function.mb-ereg-search-setpos.php                 24-May-2024 14:02                4208
function.mb-ereg-search.php                        24-May-2024 14:02                4866
function.mb-ereg.php                               24-May-2024 14:02                5196
function.mb-eregi-replace.php                      24-May-2024 14:02                6511
function.mb-eregi.php                              24-May-2024 14:02                5237
function.mb-get-info.php                           24-May-2024 14:02                4950
function.mb-http-input.php                         24-May-2024 14:02                4133
function.mb-http-output.php                        24-May-2024 14:02                4490
function.mb-internal-encoding.php                  24-May-2024 14:02                5823
function.mb-language.php                           24-May-2024 14:02                4157
function.mb-list-encodings.php                     24-May-2024 14:02                4841
function.mb-ord.php                                24-May-2024 14:02                6933
function.mb-output-handler.php                     24-May-2024 14:02                6960
function.mb-parse-str.php                          24-May-2024 14:02                4401
function.mb-preferred-mime-name.php                24-May-2024 14:02                4460
function.mb-regex-encoding.php                     24-May-2024 14:02                4553
function.mb-regex-set-options.php                  24-May-2024 14:02                6605
function.mb-scrub.php                              24-May-2024 14:02                4210
function.mb-send-mail.php                          24-May-2024 14:02                9020
function.mb-split.php                              24-May-2024 14:02                4828
function.mb-str-pad.php                            24-May-2024 14:02                8615
function.mb-str-split.php                          24-May-2024 14:02                5433
function.mb-strcut.php                             24-May-2024 14:02                6886
function.mb-strimwidth.php                         24-May-2024 14:02                6478
function.mb-stripos.php                            24-May-2024 14:02                5737
function.mb-stristr.php                            24-May-2024 14:02                6099
function.mb-strlen.php                             24-May-2024 14:02                5279
function.mb-strpos.php                             24-May-2024 14:02                5648
function.mb-strrchr.php                            24-May-2024 14:02                5893
function.mb-strrichr.php                           24-May-2024 14:02                5986
function.mb-strripos.php                           24-May-2024 14:02                5775
function.mb-strrpos.php                            24-May-2024 14:02                7097
function.mb-strstr.php                             24-May-2024 14:02                5888
function.mb-strtolower.php                         24-May-2024 14:02                7205
function.mb-strtoupper.php                         24-May-2024 14:02                7219
function.mb-strwidth.php                           24-May-2024 14:02                4732
function.mb-substitute-character.php               24-May-2024 14:02                6363
function.mb-substr-count.php                       24-May-2024 14:02                5618
function.mb-substr.php                             24-May-2024 14:02                6641
function.mcrypt-create-iv.php                      24-May-2024 14:02                6976
function.mcrypt-decrypt.php                        24-May-2024 14:02                6048
function.mcrypt-enc-get-algorithms-name.php        24-May-2024 14:02                5409
function.mcrypt-enc-get-block-size.php             24-May-2024 14:02                3085
function.mcrypt-enc-get-iv-size.php                24-May-2024 14:02                3210
function.mcrypt-enc-get-key-size.php               24-May-2024 14:02                3089
function.mcrypt-enc-get-modes-name.php             24-May-2024 14:02                5311
function.mcrypt-enc-get-supported-key-sizes.php    24-May-2024 14:02                5093
function.mcrypt-enc-is-block-algorithm-mode.php    24-May-2024 14:02                3659
function.mcrypt-enc-is-block-algorithm.php         24-May-2024 14:02                3380
function.mcrypt-enc-is-block-mode.php              24-May-2024 14:02                3487
function.mcrypt-enc-self-test.php                  24-May-2024 14:02                3171
function.mcrypt-encrypt.php                        24-May-2024 14:02               14016
function.mcrypt-generic-deinit.php                 24-May-2024 14:02                4115
function.mcrypt-generic-init.php                   24-May-2024 14:02                5314
function.mcrypt-generic.php                        24-May-2024 14:02                5952
function.mcrypt-get-block-size.php                 24-May-2024 14:02                6759
function.mcrypt-get-cipher-name.php                24-May-2024 14:02                5136
function.mcrypt-get-iv-size.php                    24-May-2024 14:02                6575
function.mcrypt-get-key-size.php                   24-May-2024 14:02                6919
function.mcrypt-list-algorithms.php                24-May-2024 14:02                4865
function.mcrypt-list-modes.php                     24-May-2024 14:02                4730
function.mcrypt-module-close.php                   24-May-2024 14:02                3551
function.mcrypt-module-get-algo-block-size.php     24-May-2024 14:02                3601
function.mcrypt-module-get-algo-key-size.php       24-May-2024 14:02                3668
function.mcrypt-module-get-supported-key-sizes.php 24-May-2024 14:02                4740
function.mcrypt-module-is-block-algorithm-mode.php 24-May-2024 14:02                4594
function.mcrypt-module-is-block-algorithm.php      24-May-2024 14:02                4135
function.mcrypt-module-is-block-mode.php           24-May-2024 14:02                4630
function.mcrypt-module-open.php                    24-May-2024 14:02               14170
function.mcrypt-module-self-test.php               24-May-2024 14:02                5155
function.md5-file.php                              24-May-2024 14:02                5936
function.md5.php                                   24-May-2024 14:02                6172
function.mdecrypt-generic.php                      24-May-2024 14:02               10940
function.memcache-debug.php                        24-May-2024 14:02                3852
function.memory-get-peak-usage.php                 24-May-2024 14:02                4351
function.memory-get-usage.php                      24-May-2024 14:02                6445
function.memory-reset-peak-usage.php               24-May-2024 14:02                5045
function.metaphone.php                             24-May-2024 14:02                6410
function.method-exists.php                         24-May-2024 14:02                6566
function.mhash-count.php                           24-May-2024 14:02                4690
function.mhash-get-block-size.php                  24-May-2024 14:02                4633
function.mhash-get-hash-name.php                   24-May-2024 14:02                4588
function.mhash-keygen-s2k.php                      24-May-2024 14:02                5760
function.mhash.php                                 24-May-2024 14:02                4910
function.microtime.php                             24-May-2024 14:02               10158
function.mime-content-type.php                     24-May-2024 14:02                4985
function.min.php                                   24-May-2024 14:02               12651
function.mkdir.php                                 24-May-2024 14:02                8286
function.mktime.php                                24-May-2024 14:02               22415
function.money-format.php                          24-May-2024 14:02               18500
function.mongodb.bson-fromjson.php                 24-May-2024 14:02                5796
function.mongodb.bson-fromphp.php                  24-May-2024 14:02                6147
function.mongodb.bson-tocanonicalextendedjson.php  24-May-2024 14:02               13688
function.mongodb.bson-tojson.php                   24-May-2024 14:02               15050
function.mongodb.bson-tophp.php                    24-May-2024 14:02                9042
function.mongodb.bson-torelaxedextendedjson.php    24-May-2024 14:02               13385
function.mongodb.driver.monitoring.addsubscribe..> 24-May-2024 14:02                5131
function.mongodb.driver.monitoring.removesubscr..> 24-May-2024 14:02                4988
function.move-uploaded-file.php                    24-May-2024 14:02                8808
function.mqseries-back.php                         24-May-2024 14:02                6512
function.mqseries-begin.php                        24-May-2024 14:02                7474
function.mqseries-close.php                        24-May-2024 14:02                6695
function.mqseries-cmit.php                         24-May-2024 14:02                6439
function.mqseries-conn.php                         24-May-2024 14:02                6020
function.mqseries-connx.php                        24-May-2024 14:02               12722
function.mqseries-disc.php                         24-May-2024 14:02                5722
function.mqseries-get.php                          24-May-2024 14:02               12340
function.mqseries-inq.php                          24-May-2024 14:02                9398
function.mqseries-open.php                         24-May-2024 14:02                7331
function.mqseries-put.php                          24-May-2024 14:02               12619
function.mqseries-put1.php                         24-May-2024 14:02                6364
function.mqseries-set.php                          24-May-2024 14:02                6290
function.mqseries-strerror.php                     24-May-2024 14:02                4303
function.msg-get-queue.php                         24-May-2024 14:02                4772
function.msg-queue-exists.php                      24-May-2024 14:02                3555
function.msg-receive.php                           24-May-2024 14:02               10317
function.msg-remove-queue.php                      24-May-2024 14:02                4011
function.msg-send.php                              24-May-2024 14:02                7487
function.msg-set-queue.php                         24-May-2024 14:02                4739
function.msg-stat-queue.php                        24-May-2024 14:02                5828
function.mt-getrandmax.php                         24-May-2024 14:02                3329
function.mt-rand.php                               24-May-2024 14:02                9972
function.mt-srand.php                              24-May-2024 14:02                8526
function.mysql-affected-rows.php                   24-May-2024 14:02               12347
function.mysql-client-encoding.php                 24-May-2024 14:02                6341
function.mysql-close.php                           24-May-2024 14:02                7577
function.mysql-connect.php                         24-May-2024 14:02               17845
function.mysql-create-db.php                       24-May-2024 14:02                8643
function.mysql-data-seek.php                       24-May-2024 14:02               12199
function.mysql-db-name.php                         24-May-2024 14:02                7964
function.mysql-db-query.php                        24-May-2024 14:02                9913
function.mysql-drop-db.php                         24-May-2024 14:02                7929
function.mysql-errno.php                           24-May-2024 14:02                8359
function.mysql-error.php                           24-May-2024 14:02                8387
function.mysql-escape-string.php                   24-May-2024 14:02                6638
function.mysql-fetch-array.php                     24-May-2024 14:02               16012
function.mysql-fetch-assoc.php                     24-May-2024 14:02               11805
function.mysql-fetch-field.php                     24-May-2024 14:02               13386
function.mysql-fetch-lengths.php                   24-May-2024 14:02                7796
function.mysql-fetch-object.php                    24-May-2024 14:02               12172
function.mysql-fetch-row.php                       24-May-2024 14:02                7893
function.mysql-field-flags.php                     24-May-2024 14:02                8744
function.mysql-field-len.php                       24-May-2024 14:02                7180
function.mysql-field-name.php                      24-May-2024 14:02                9295
function.mysql-field-seek.php                      24-May-2024 14:02                5234
function.mysql-field-table.php                     24-May-2024 14:02                7811
function.mysql-field-type.php                      24-May-2024 14:02               11866
function.mysql-free-result.php                     24-May-2024 14:02                7905
function.mysql-get-client-info.php                 24-May-2024 14:02                5284
function.mysql-get-host-info.php                   24-May-2024 14:02                7140
function.mysql-get-proto-info.php                  24-May-2024 14:02                6719
function.mysql-get-server-info.php                 24-May-2024 14:02                7221
function.mysql-info.php                            24-May-2024 14:02                6508
function.mysql-insert-id.php                       24-May-2024 14:02                8426
function.mysql-list-dbs.php                        24-May-2024 14:02                8950
function.mysql-list-fields.php                     24-May-2024 14:02                9117
function.mysql-list-processes.php                  24-May-2024 14:02                7709
function.mysql-list-tables.php                     24-May-2024 14:02                9823
function.mysql-num-fields.php                      24-May-2024 14:02                6785
function.mysql-num-rows.php                        24-May-2024 14:02                8294
function.mysql-pconnect.php                        24-May-2024 14:02                8670
function.mysql-ping.php                            24-May-2024 14:02                8095
function.mysql-query.php                           24-May-2024 14:02               14343
function.mysql-real-escape-string.php              24-May-2024 14:02               15572
function.mysql-result.php                          24-May-2024 14:02               10032
function.mysql-select-db.php                       24-May-2024 14:02                7862
function.mysql-set-charset.php                     24-May-2024 14:02                6051
function.mysql-stat.php                            24-May-2024 14:02                9433
function.mysql-tablename.php                       24-May-2024 14:02                8322
function.mysql-thread-id.php                       24-May-2024 14:02                6756
function.mysql-unbuffered-query.php                24-May-2024 14:02                7478
function.mysql-xdevapi-expression.php              24-May-2024 14:02                4908
function.mysql-xdevapi-getsession.php              24-May-2024 14:02               13122
function.mysqli-connect.php                        24-May-2024 14:02                5189
function.mysqli-escape-string.php                  24-May-2024 14:02                1866
function.mysqli-execute.php                        24-May-2024 14:02                2519
function.mysqli-get-client-stats.php               24-May-2024 14:02                8435
function.mysqli-get-links-stats.php                24-May-2024 14:02                3530
function.mysqli-report.php                         24-May-2024 14:02                1772
function.mysqli-set-opt.php                        24-May-2024 14:02                1869
function.natcasesort.php                           24-May-2024 14:02                7229
function.natsort.php                               24-May-2024 14:02               11005
function.net-get-interfaces.php                    24-May-2024 14:02                4798
function.next.php                                  24-May-2024 14:02                7893
function.ngettext.php                              24-May-2024 14:02                5669
function.nl-langinfo.php                           24-May-2024 14:02               14165
function.nl2br.php                                 24-May-2024 14:02                7611
function.number-format.php                         24-May-2024 14:02                9766
function.oauth-get-sbs.php                         24-May-2024 14:02                3202
function.oauth-urlencode.php                       24-May-2024 14:02                2649
function.ob-clean.php                              24-May-2024 14:02                3404
function.ob-end-clean.php                          24-May-2024 14:02                5383
function.ob-end-flush.php                          24-May-2024 14:02                6237
function.ob-flush.php                              24-May-2024 14:02                3631
function.ob-get-clean.php                          24-May-2024 14:02                5183
function.ob-get-contents.php                       24-May-2024 14:02                4609
function.ob-get-flush.php                          24-May-2024 14:02                5742
function.ob-get-length.php                         24-May-2024 14:02                4582
function.ob-get-level.php                          24-May-2024 14:02                2826
function.ob-get-status.php                         24-May-2024 14:02                7560
function.ob-gzhandler.php                          24-May-2024 14:02                5978
function.ob-iconv-handler.php                      24-May-2024 14:02                5301
function.ob-implicit-flush.php                     24-May-2024 14:02                3935
function.ob-list-handlers.php                      24-May-2024 14:02                5923
function.ob-start.php                              24-May-2024 14:02               21496
function.ob-tidyhandler.php                        24-May-2024 14:02                4505
function.oci-bind-array-by-name.php                24-May-2024 14:02               14095
function.oci-bind-by-name.php                      24-May-2024 14:02               81655
function.oci-cancel.php                            24-May-2024 14:02                2768
function.oci-client-version.php                    24-May-2024 14:02                4079
function.oci-close.php                             24-May-2024 14:02               19568
function.oci-commit.php                            24-May-2024 14:02               11387
function.oci-connect.php                           24-May-2024 14:02               35003
function.oci-define-by-name.php                    24-May-2024 14:02               24415
function.oci-error.php                             24-May-2024 14:02               11293
function.oci-execute.php                           24-May-2024 14:02               22217
function.oci-fetch-all.php                         24-May-2024 14:02               25796
function.oci-fetch-array.php                       24-May-2024 14:02               65330
function.oci-fetch-assoc.php                       24-May-2024 14:02                9009
function.oci-fetch-object.php                      24-May-2024 14:02               18476
function.oci-fetch-row.php                         24-May-2024 14:02                8947
function.oci-fetch.php                             24-May-2024 14:02               13832
function.oci-field-is-null.php                     24-May-2024 14:02                8522
function.oci-field-name.php                        24-May-2024 14:02               10346
function.oci-field-precision.php                   24-May-2024 14:02                9225
function.oci-field-scale.php                       24-May-2024 14:02                9175
function.oci-field-size.php                        24-May-2024 14:02               10770
function.oci-field-type-raw.php                    24-May-2024 14:02                8463
function.oci-field-type.php                        24-May-2024 14:02               10932
function.oci-free-descriptor.php                   24-May-2024 14:02                3608
function.oci-free-statement.php                    24-May-2024 14:02                3058
function.oci-get-implicit-resultset.php            24-May-2024 14:02               28303
function.oci-internal-debug.php                    24-May-2024 14:02                3130
function.oci-lob-copy.php                          24-May-2024 14:02                4694
function.oci-lob-is-equal.php                      24-May-2024 14:02                2924
function.oci-new-collection.php                    24-May-2024 14:02                5722
function.oci-new-connect.php                       24-May-2024 14:02               16102
function.oci-new-cursor.php                        24-May-2024 14:02                4936
function.oci-new-descriptor.php                    24-May-2024 14:02               18886
function.oci-num-fields.php                        24-May-2024 14:02                7664
function.oci-num-rows.php                          24-May-2024 14:02                8448
function.oci-parse.php                             24-May-2024 14:02               12670
function.oci-password-change.php                   24-May-2024 14:02               14065
function.oci-pconnect.php                          24-May-2024 14:02               15079
function.oci-register-taf-callback.php             24-May-2024 14:02                5939
function.oci-result.php                            24-May-2024 14:02                9386
function.oci-rollback.php                          24-May-2024 14:02               14759
function.oci-server-version.php                    24-May-2024 14:02                5264
function.oci-set-action.php                        24-May-2024 14:02                8654
function.oci-set-call-timout.php                   24-May-2024 14:02                6264
function.oci-set-client-identifier.php             24-May-2024 14:02                8381
function.oci-set-client-info.php                   24-May-2024 14:02                8567
function.oci-set-db-operation.php                  24-May-2024 14:02                8140
function.oci-set-edition.php                       24-May-2024 14:02               10046
function.oci-set-module-name.php                   24-May-2024 14:02                8771
function.oci-set-prefetch-lob.php                  24-May-2024 14:02                9531
function.oci-set-prefetch.php                      24-May-2024 14:02               22313
function.oci-statement-type.php                    24-May-2024 14:02                7081
function.oci-unregister-taf-callback.php           24-May-2024 14:02                3795
function.ocibindbyname.php                         24-May-2024 14:02                2008
function.ocicancel.php                             24-May-2024 14:02                1950
function.ocicloselob.php                           24-May-2024 14:02                1947
function.ocicollappend.php                         24-May-2024 14:02                2012
function.ocicollassign.php                         24-May-2024 14:02                2017
function.ocicollassignelem.php                     24-May-2024 14:02                2062
function.ocicollgetelem.php                        24-May-2024 14:02                2029
function.ocicollmax.php                            24-May-2024 14:02                1981
function.ocicollsize.php                           24-May-2024 14:02                1984
function.ocicolltrim.php                           24-May-2024 14:02                1994
function.ocicolumnisnull.php                       24-May-2024 14:02                2020
function.ocicolumnname.php                         24-May-2024 14:02                2012
function.ocicolumnprecision.php                    24-May-2024 14:02                2055
function.ocicolumnscale.php                        24-May-2024 14:02                2019
function.ocicolumnsize.php                         24-May-2024 14:02                2000
function.ocicolumntype.php                         24-May-2024 14:02                2004
function.ocicolumntyperaw.php                      24-May-2024 14:02                2027
function.ocicommit.php                             24-May-2024 14:02                1964
function.ocidefinebyname.php                       24-May-2024 14:02                2010
function.ocierror.php                              24-May-2024 14:02                1941
function.ociexecute.php                            24-May-2024 14:02                1945
function.ocifetch.php                              24-May-2024 14:02                1935
function.ocifetchinto.php                          24-May-2024 14:02                2681
function.ocifetchstatement.php                     24-May-2024 14:02                2027
function.ocifreecollection.php                     24-May-2024 14:02                2044
function.ocifreecursor.php                         24-May-2024 14:02                2018
function.ocifreedesc.php                           24-May-2024 14:02                1960
function.ocifreestatement.php                      24-May-2024 14:02                2038
function.ociinternaldebug.php                      24-May-2024 14:02                2051
function.ociloadlob.php                            24-May-2024 14:02                1945
function.ocilogoff.php                             24-May-2024 14:02                1934
function.ocilogon.php                              24-May-2024 14:02                1949
function.ocinewcollection.php                      24-May-2024 14:02                2035
function.ocinewcursor.php                          24-May-2024 14:02                2003
function.ocinewdescriptor.php                      24-May-2024 14:02                2025
function.ocinlogon.php                             24-May-2024 14:02                1974
function.ocinumcols.php                            24-May-2024 14:02                1960
function.ociparse.php                              24-May-2024 14:02                1929
function.ociplogon.php                             24-May-2024 14:02                1944
function.ociresult.php                             24-May-2024 14:02                1942
function.ocirollback.php                           24-May-2024 14:02                1964
function.ocirowcount.php                           24-May-2024 14:02                1967
function.ocisavelob.php                            24-May-2024 14:02                1945
function.ocisavelobfile.php                        24-May-2024 14:02                1983
function.ociserverversion.php                      24-May-2024 14:02                2039
function.ocisetprefetch.php                        24-May-2024 14:02                2025
function.ocistatementtype.php                      24-May-2024 14:02                2045
function.ociwritelobtofile.php                     24-May-2024 14:02                2024
function.ociwritetemporarylob.php                  24-May-2024 14:02                2047
function.octdec.php                                24-May-2024 14:02                5096
function.odbc-autocommit.php                       24-May-2024 14:02                4654
function.odbc-binmode.php                          24-May-2024 14:02                7232
function.odbc-close-all.php                        24-May-2024 14:02                2652
function.odbc-close.php                            24-May-2024 14:02                2980
function.odbc-columnprivileges.php                 24-May-2024 14:02                5645
function.odbc-columns.php                          24-May-2024 14:02                6192
function.odbc-commit.php                           24-May-2024 14:02                2820
function.odbc-connect.php                          24-May-2024 14:02                8929
function.odbc-connection-string-is-quoted.php      24-May-2024 14:02                3744
function.odbc-connection-string-quote.php          24-May-2024 14:02                5794
function.odbc-connection-string-should-quote.php   24-May-2024 14:02                4008
function.odbc-cursor.php                           24-May-2024 14:02                2582
function.odbc-data-source.php                      24-May-2024 14:02                3522
function.odbc-do.php                               24-May-2024 14:02                1708
function.odbc-error.php                            24-May-2024 14:02                3713
function.odbc-errormsg.php                         24-May-2024 14:02                3751
function.odbc-exec.php                             24-May-2024 14:02                4032
function.odbc-execute.php                          24-May-2024 14:02                7375
function.odbc-fetch-array.php                      24-May-2024 14:02                4354
function.odbc-fetch-into.php                       24-May-2024 14:02                5283
function.odbc-fetch-object.php                     24-May-2024 14:02                4359
function.odbc-fetch-row.php                        24-May-2024 14:02                4390
function.odbc-field-len.php                        24-May-2024 14:02                3484
function.odbc-field-name.php                       24-May-2024 14:02                3097
function.odbc-field-num.php                        24-May-2024 14:02                3117
function.odbc-field-precision.php                  24-May-2024 14:02                2253
function.odbc-field-scale.php                      24-May-2024 14:02                3118
function.odbc-field-type.php                       24-May-2024 14:02                3086
function.odbc-foreignkeys.php                      24-May-2024 14:02                7388
function.odbc-free-result.php                      24-May-2024 14:02                3493
function.odbc-gettypeinfo.php                      24-May-2024 14:02                4648
function.odbc-longreadlen.php                      24-May-2024 14:02                3634
function.odbc-next-result.php                      24-May-2024 14:02                9087
function.odbc-num-fields.php                       24-May-2024 14:02                2701
function.odbc-num-rows.php                         24-May-2024 14:02                3380
function.odbc-pconnect.php                         24-May-2024 14:02                4732
function.odbc-prepare.php                          24-May-2024 14:02                6572
function.odbc-primarykeys.php                      24-May-2024 14:02                4430
function.odbc-procedurecolumns.php                 24-May-2024 14:02                6537
function.odbc-procedures.php                       24-May-2024 14:02                5394
function.odbc-result-all.php                       24-May-2024 14:02                3212
function.odbc-result.php                           24-May-2024 14:02                5763
function.odbc-rollback.php                         24-May-2024 14:02                2837
function.odbc-setoption.php                        24-May-2024 14:02                7428
function.odbc-specialcolumns.php                   24-May-2024 14:02                6540
function.odbc-statistics.php                       24-May-2024 14:02                5741
function.odbc-tableprivileges.php                  24-May-2024 14:02                4984
function.odbc-tables.php                           24-May-2024 14:02                7984
function.opcache-compile-file.php                  24-May-2024 14:02                3917
function.opcache-get-configuration.php             24-May-2024 14:02                3341
function.opcache-get-status.php                    24-May-2024 14:02                3890
function.opcache-invalidate.php                    24-May-2024 14:02                4434
function.opcache-is-script-cached.php              24-May-2024 14:02                3488
function.opcache-reset.php                         24-May-2024 14:02                3435
function.openal-buffer-create.php                  24-May-2024 14:02                2737
function.openal-buffer-data.php                    24-May-2024 14:02                5079
function.openal-buffer-destroy.php                 24-May-2024 14:02                3247
function.openal-buffer-get.php                     24-May-2024 14:02                3929
function.openal-buffer-loadwav.php                 24-May-2024 14:02                3817
function.openal-context-create.php                 24-May-2024 14:02                3448
function.openal-context-current.php                24-May-2024 14:02                3314
function.openal-context-destroy.php                24-May-2024 14:02                3297
function.openal-context-process.php                24-May-2024 14:02                3695
function.openal-context-suspend.php                24-May-2024 14:02                3689
function.openal-device-close.php                   24-May-2024 14:02                3264
function.openal-device-open.php                    24-May-2024 14:02                3469
function.openal-listener-get.php                   24-May-2024 14:02                3505
function.openal-listener-set.php                   24-May-2024 14:02                3918
function.openal-source-create.php                  24-May-2024 14:02                2958
function.openal-source-destroy.php                 24-May-2024 14:02                3263
function.openal-source-get.php                     24-May-2024 14:02                5721
function.openal-source-pause.php                   24-May-2024 14:02                3594
function.openal-source-play.php                    24-May-2024 14:02                3587
function.openal-source-rewind.php                  24-May-2024 14:02                3603
function.openal-source-set.php                     24-May-2024 14:02                6491
function.openal-source-stop.php                    24-May-2024 14:02                3569
function.openal-stream.php                         24-May-2024 14:02                4382
function.opendir.php                               24-May-2024 14:02                8465
function.openlog.php                               24-May-2024 14:02               10368
function.openssl-cipher-iv-length.php              24-May-2024 14:02                4533
function.openssl-cipher-key-length.php             24-May-2024 14:02                4482
function.openssl-cms-decrypt.php                   24-May-2024 14:02                5253
function.openssl-cms-encrypt.php                   24-May-2024 14:02                6399
function.openssl-cms-read.php                      24-May-2024 14:02                3361
function.openssl-cms-sign.php                      24-May-2024 14:02                7902
function.openssl-cms-verify.php                    24-May-2024 14:02                7223
function.openssl-csr-export-to-file.php            24-May-2024 14:02                4916
function.openssl-csr-export.php                    24-May-2024 14:02                4830
function.openssl-csr-get-public-key.php            24-May-2024 14:02                2470
function.openssl-csr-get-subject.php               24-May-2024 14:02                2429
function.openssl-csr-new.php                       24-May-2024 14:02               15561
function.openssl-csr-sign.php                      24-May-2024 14:02               10018
function.openssl-decrypt.php                       24-May-2024 14:02                6189
function.openssl-dh-compute-key.php                24-May-2024 14:02                3225
function.openssl-digest.php                        24-May-2024 14:02                4665
function.openssl-encrypt.php                       24-May-2024 14:02                6395
function.openssl-error-string.php                  24-May-2024 14:02                3584
function.openssl-free-key.php                      24-May-2024 14:02                2731
function.openssl-get-cert-locations.php            24-May-2024 14:02                4132
function.openssl-get-cipher-methods.php            24-May-2024 14:02                8789
function.openssl-get-curve-names.php               24-May-2024 14:02                7227
function.openssl-get-md-methods.php                24-May-2024 14:02                7167
function.openssl-get-privatekey.php                24-May-2024 14:02                1936
function.openssl-get-publickey.php                 24-May-2024 14:02                1908
function.openssl-open.php                          24-May-2024 14:02                8035
function.openssl-pbkdf2.php                        24-May-2024 14:02                4133
function.openssl-pkcs12-export-to-file.php         24-May-2024 14:02                4634
function.openssl-pkcs12-export.php                 24-May-2024 14:02                4604
function.openssl-pkcs12-read.php                   24-May-2024 14:02                5644
function.openssl-pkcs7-decrypt.php                 24-May-2024 14:02                6184
function.openssl-pkcs7-encrypt.php                 24-May-2024 14:02                9336
function.openssl-pkcs7-read.php                    24-May-2024 14:02                7041
function.openssl-pkcs7-sign.php                    24-May-2024 14:02                9368
function.openssl-pkcs7-verify.php                  24-May-2024 14:02                6936
function.openssl-pkey-derive.php                   24-May-2024 14:02                7966
function.openssl-pkey-export-to-file.php           24-May-2024 14:02                5055
function.openssl-pkey-export.php                   24-May-2024 14:02                4921
function.openssl-pkey-free.php                     24-May-2024 14:02                2717
function.openssl-pkey-get-details.php              24-May-2024 14:02                7615
function.openssl-pkey-get-private.php              24-May-2024 14:02                3975
function.openssl-pkey-get-public.php               24-May-2024 14:02                3607
function.openssl-pkey-new.php                      24-May-2024 14:02                3765
function.openssl-private-decrypt.php               24-May-2024 14:02                5634
function.openssl-private-encrypt.php               24-May-2024 14:02                5326
function.openssl-public-decrypt.php                24-May-2024 14:02                5388
function.openssl-public-encrypt.php                24-May-2024 14:02                5751
function.openssl-random-pseudo-bytes.php           24-May-2024 14:02                8510
function.openssl-seal.php                          24-May-2024 14:02               10047
function.openssl-sign.php                          24-May-2024 14:02               11415
function.openssl-spki-export-challenge.php         24-May-2024 14:02                7416
function.openssl-spki-export.php                   24-May-2024 14:02                8509
function.openssl-spki-new.php                      24-May-2024 14:02                9301
function.openssl-spki-verify.php                   24-May-2024 14:02                7880
function.openssl-verify.php                        24-May-2024 14:02               12332
function.openssl-x509-check-private-key.php        24-May-2024 14:02                3408
function.openssl-x509-checkpurpose.php             24-May-2024 14:02                6398
function.openssl-x509-export-to-file.php           24-May-2024 14:02                4283
function.openssl-x509-export.php                   24-May-2024 14:02                4225
function.openssl-x509-fingerprint.php              24-May-2024 14:02                5386
function.openssl-x509-free.php                     24-May-2024 14:02                2713
function.openssl-x509-parse.php                    24-May-2024 14:02                3675
function.openssl-x509-read.php                     24-May-2024 14:02                2917
function.openssl-x509-verify.php                   24-May-2024 14:02               12223
function.ord.php                                   24-May-2024 14:02                7203
function.output-add-rewrite-var.php                24-May-2024 14:02                7032
function.output-reset-rewrite-vars.php             24-May-2024 14:02                6556
function.pack.php                                  24-May-2024 14:02               12774
function.parse-ini-file.php                        24-May-2024 14:02               16209
function.parse-ini-string.php                      24-May-2024 14:02                7581
function.parse-str.php                             24-May-2024 14:02               10142
function.parse-url.php                             24-May-2024 14:02               15652
function.passthru.php                              24-May-2024 14:02                5780
function.password-algos.php                        24-May-2024 14:02                3454
function.password-get-info.php                     24-May-2024 14:02                3632
function.password-hash.php                         24-May-2024 14:02               19612
function.password-needs-rehash.php                 24-May-2024 14:02                7055
function.password-verify.php                       24-May-2024 14:02                6499
function.pathinfo.php                              24-May-2024 14:02               12831
function.pclose.php                                24-May-2024 14:02                4982
function.pcntl-alarm.php                           24-May-2024 14:02                3011
function.pcntl-async-signals.php                   24-May-2024 14:02                4284
function.pcntl-errno.php                           24-May-2024 14:02                1796
function.pcntl-exec.php                            24-May-2024 14:02                3862
function.pcntl-fork.php                            24-May-2024 14:02                5060
function.pcntl-get-last-error.php                  24-May-2024 14:02                2839
function.pcntl-getpriority.php                     24-May-2024 14:02                5925
function.pcntl-rfork.php                           24-May-2024 14:02                7720
function.pcntl-setpriority.php                     24-May-2024 14:02                5783
function.pcntl-signal-dispatch.php                 24-May-2024 14:02                5707
function.pcntl-signal-get-handler.php              24-May-2024 14:02                6848
function.pcntl-signal.php                          24-May-2024 14:02               11359
function.pcntl-sigprocmask.php                     24-May-2024 14:02                6166
function.pcntl-sigtimedwait.php                    24-May-2024 14:02                5211
function.pcntl-sigwaitinfo.php                     24-May-2024 14:02                7570
function.pcntl-strerror.php                        24-May-2024 14:02                3044
function.pcntl-unshare.php                         24-May-2024 14:02                4677
function.pcntl-wait.php                            24-May-2024 14:02                8127
function.pcntl-waitpid.php                         24-May-2024 14:02                9574
function.pcntl-wexitstatus.php                     24-May-2024 14:02                3827
function.pcntl-wifexited.php                       24-May-2024 14:02                3549
function.pcntl-wifsignaled.php                     24-May-2024 14:02                3601
function.pcntl-wifstopped.php                      24-May-2024 14:02                3671
function.pcntl-wstopsig.php                        24-May-2024 14:02                3832
function.pcntl-wtermsig.php                        24-May-2024 14:02                4007
function.pfsockopen.php                            24-May-2024 14:02                4036
function.pg-affected-rows.php                      24-May-2024 14:02                6279
function.pg-cancel-query.php                       24-May-2024 14:02                6899
function.pg-client-encoding.php                    24-May-2024 14:02                5980
function.pg-close.php                              24-May-2024 14:02                5512
function.pg-connect-poll.php                       24-May-2024 14:02                3463
function.pg-connect.php                            24-May-2024 14:02               11263
function.pg-connection-busy.php                    24-May-2024 14:02                5170
function.pg-connection-reset.php                   24-May-2024 14:02                5168
function.pg-connection-status.php                  24-May-2024 14:02                4949
function.pg-consume-input.php                      24-May-2024 14:02                3623
function.pg-convert.php                            24-May-2024 14:02                8356
function.pg-copy-from.php                          24-May-2024 14:02                7610
function.pg-copy-to.php                            24-May-2024 14:02                6699
function.pg-dbname.php                             24-May-2024 14:02                4338
function.pg-delete.php                             24-May-2024 14:02                9314
function.pg-end-copy.php                           24-May-2024 14:02                6294
function.pg-escape-bytea.php                       24-May-2024 14:02                7854
function.pg-escape-identifier.php                  24-May-2024 14:02                7786
function.pg-escape-literal.php                     24-May-2024 14:02                8151
function.pg-escape-string.php                      24-May-2024 14:02                7666
function.pg-execute.php                            24-May-2024 14:02                9348
function.pg-fetch-all-columns.php                  24-May-2024 14:02                7049
function.pg-fetch-all.php                          24-May-2024 14:02                7579
function.pg-fetch-array.php                        24-May-2024 14:02               12834
function.pg-fetch-assoc.php                        24-May-2024 14:02                9454
function.pg-fetch-object.php                       24-May-2024 14:02               11860
function.pg-fetch-result.php                       24-May-2024 14:02                9286
function.pg-fetch-row.php                          24-May-2024 14:02                9952
function.pg-field-is-null.php                      24-May-2024 14:02                8411
function.pg-field-name.php                         24-May-2024 14:02                8934
function.pg-field-num.php                          24-May-2024 14:02                6524
function.pg-field-prtlen.php                       24-May-2024 14:02               10798
function.pg-field-size.php                         24-May-2024 14:02                9181
function.pg-field-table.php                        24-May-2024 14:02                8681
function.pg-field-type-oid.php                     24-May-2024 14:02                7455
function.pg-field-type.php                         24-May-2024 14:02                6826
function.pg-flush.php                              24-May-2024 14:02                3630
function.pg-free-result.php                        24-May-2024 14:02                7322
function.pg-get-notify.php                         24-May-2024 14:02                7556
function.pg-get-pid.php                            24-May-2024 14:02                4486
function.pg-get-result.php                         24-May-2024 14:02                8514
function.pg-host.php                               24-May-2024 14:02                5332
function.pg-insert.php                             24-May-2024 14:02               11650
function.pg-last-error.php                         24-May-2024 14:02                6440
function.pg-last-notice.php                        24-May-2024 14:02                8081
function.pg-last-oid.php                           24-May-2024 14:02                7567
function.pg-lo-close.php                           24-May-2024 14:02                7138
function.pg-lo-create.php                          24-May-2024 14:02                8612
function.pg-lo-export.php                          24-May-2024 14:02                8175
function.pg-lo-import.php                          24-May-2024 14:02                7416
function.pg-lo-open.php                            24-May-2024 14:02                8865
function.pg-lo-read-all.php                        24-May-2024 14:02                6360
function.pg-lo-read.php                            24-May-2024 14:02                7133
function.pg-lo-seek.php                            24-May-2024 14:02                7929
function.pg-lo-tell.php                            24-May-2024 14:02                6902
function.pg-lo-truncate.php                        24-May-2024 14:02                6614
function.pg-lo-unlink.php                          24-May-2024 14:02                7168
function.pg-lo-write.php                           24-May-2024 14:02                8230
function.pg-meta-data.php                          24-May-2024 14:02                7529
function.pg-num-fields.php                         24-May-2024 14:02                5945
function.pg-num-rows.php                           24-May-2024 14:02                5918
function.pg-options.php                            24-May-2024 14:02                4686
function.pg-parameter-status.php                   24-May-2024 14:02                8458
function.pg-pconnect.php                           24-May-2024 14:02                9146
function.pg-ping.php                               24-May-2024 14:02                5029
function.pg-port.php                               24-May-2024 14:02                4815
function.pg-prepare.php                            24-May-2024 14:02                9271
function.pg-put-line.php                           24-May-2024 14:02                8693
function.pg-query-params.php                       24-May-2024 14:02               10675
function.pg-query.php                              24-May-2024 14:02               11276
function.pg-result-error-field.php                 24-May-2024 14:02                9693
function.pg-result-error.php                       24-May-2024 14:02                8129
function.pg-result-seek.php                        24-May-2024 14:02                7265
function.pg-result-status.php                      24-May-2024 14:02                8662
function.pg-select.php                             24-May-2024 14:02               12216
function.pg-send-execute.php                       24-May-2024 14:02               10456
function.pg-send-prepare.php                       24-May-2024 14:02               10614
function.pg-send-query-params.php                  24-May-2024 14:02                8060
function.pg-send-query.php                         24-May-2024 14:02                9811
function.pg-set-client-encoding.php                24-May-2024 14:02                8805
function.pg-set-error-context-visibility.php       24-May-2024 14:02                6602
function.pg-set-error-verbosity.php                24-May-2024 14:02                8966
function.pg-socket.php                             24-May-2024 14:02                3116
function.pg-trace.php                              24-May-2024 14:02                9069
function.pg-transaction-status.php                 24-May-2024 14:02                6025
function.pg-tty.php                                24-May-2024 14:02                5164
function.pg-unescape-bytea.php                     24-May-2024 14:02                6358
function.pg-untrace.php                            24-May-2024 14:02                5416
function.pg-update.php                             24-May-2024 14:02               10331
function.pg-version.php                            24-May-2024 14:02                5663
function.php-ini-loaded-file.php                   24-May-2024 14:02                4640
function.php-ini-scanned-files.php                 24-May-2024 14:02                6218
function.php-sapi-name.php                         24-May-2024 14:02                6167
function.php-strip-whitespace.php                  24-May-2024 14:02                5328
function.php-uname.php                             24-May-2024 14:02                9286
function.phpcredits.php                            24-May-2024 14:02                8528
function.phpdbg-break-file.php                     24-May-2024 14:02                3781
function.phpdbg-break-function.php                 24-May-2024 14:02                3517
function.phpdbg-break-method.php                   24-May-2024 14:02                3851
function.phpdbg-break-next.php                     24-May-2024 14:02                3157
function.phpdbg-clear.php                          24-May-2024 14:02                3448
function.phpdbg-color.php                          24-May-2024 14:02                3717
function.phpdbg-end-oplog.php                      24-May-2024 14:02                2691
function.phpdbg-exec.php                           24-May-2024 14:02                3181
function.phpdbg-get-executable.php                 24-May-2024 14:02                2634
function.phpdbg-prompt.php                         24-May-2024 14:02                2860
function.phpdbg-start-oplog.php                    24-May-2024 14:02                2339
function.phpinfo.php                               24-May-2024 14:02               10767
function.phpversion.php                            24-May-2024 14:02                9844
function.pi.php                                    24-May-2024 14:02                3257
function.png2wbmp.php                              24-May-2024 14:02                6291
function.popen.php                                 24-May-2024 14:02                7855
function.pos.php                                   24-May-2024 14:02                1644
function.posix-access.php                          24-May-2024 14:02                6905
function.posix-ctermid.php                         24-May-2024 14:02                4310
function.posix-eaccess.php                         24-May-2024 14:02                7530
function.posix-errno.php                           24-May-2024 14:02                1802
function.posix-fpathconf.php                       24-May-2024 14:02                6507
function.posix-get-last-error.php                  24-May-2024 14:02                4118
function.posix-getcwd.php                          24-May-2024 14:02                4118
function.posix-getegid.php                         24-May-2024 14:02                5170
function.posix-geteuid.php                         24-May-2024 14:02                5195
function.posix-getgid.php                          24-May-2024 14:02                4598
function.posix-getgrgid.php                        24-May-2024 14:02                6395
function.posix-getgrnam.php                        24-May-2024 14:02                6242
function.posix-getgroups.php                       24-May-2024 14:02                3842
function.posix-getlogin.php                        24-May-2024 14:02                3377
function.posix-getpgid.php                         24-May-2024 14:02                4624
function.posix-getpgrp.php                         24-May-2024 14:02                2489
function.posix-getpid.php                          24-May-2024 14:02                3239
function.posix-getppid.php                         24-May-2024 14:02                2881
function.posix-getpwnam.php                        24-May-2024 14:02                7004
function.posix-getpwuid.php                        24-May-2024 14:02                6929
function.posix-getrlimit.php                       24-May-2024 14:02                7071
function.posix-getsid.php                          24-May-2024 14:02                4678
function.posix-getuid.php                          24-May-2024 14:02                3304
function.posix-initgroups.php                      24-May-2024 14:02                3409
function.posix-isatty.php                          24-May-2024 14:02                3854
function.posix-kill.php                            24-May-2024 14:02                3531
function.posix-mkfifo.php                          24-May-2024 14:02                3698
function.posix-mknod.php                           24-May-2024 14:02                7602
function.posix-pathconf.php                        24-May-2024 14:02                5696
function.posix-setegid.php                         24-May-2024 14:02                5234
function.posix-seteuid.php                         24-May-2024 14:02                3229
function.posix-setgid.php                          24-May-2024 14:02                5473
function.posix-setpgid.php                         24-May-2024 14:02                3458
function.posix-setrlimit.php                       24-May-2024 14:02                4774
function.posix-setsid.php                          24-May-2024 14:02                2411
function.posix-setuid.php                          24-May-2024 14:02                5582
function.posix-strerror.php                        24-May-2024 14:02                4917
function.posix-sysconf.php                         24-May-2024 14:02                3785
function.posix-times.php                           24-May-2024 14:02                4363
function.posix-ttyname.php                         24-May-2024 14:02                3590
function.posix-uname.php                           24-May-2024 14:02                4525
function.pow.php                                   24-May-2024 14:02                6915
function.preg-filter.php                           24-May-2024 14:02                9239
function.preg-grep.php                             24-May-2024 14:02                5654
function.preg-last-error-msg.php                   24-May-2024 14:02                4146
function.preg-last-error.php                       24-May-2024 14:02                4704
function.preg-match-all.php                        24-May-2024 14:02               26071
function.preg-match.php                            24-May-2024 14:02               21206
function.preg-quote.php                            24-May-2024 14:02                8513
function.preg-replace-callback-array.php           24-May-2024 14:02                8668
function.preg-replace-callback.php                 24-May-2024 14:02               16244
function.preg-replace.php                          24-May-2024 14:02               22030
function.preg-split.php                            24-May-2024 14:02               13007
function.prev.php                                  24-May-2024 14:02                7752
function.print-r.php                               24-May-2024 14:02                9388
function.print.php                                 24-May-2024 14:02                7435
function.printf.php                                24-May-2024 14:02                4412
function.proc-close.php                            24-May-2024 14:02                3646
function.proc-get-status.php                       24-May-2024 14:02                7026
function.proc-nice.php                             24-May-2024 14:02                4156
function.proc-open.php                             24-May-2024 14:02               16195
function.proc-terminate.php                        24-May-2024 14:02                4750
function.property-exists.php                       24-May-2024 14:02                9202
function.ps-add-bookmark.php                       24-May-2024 14:02                5369
function.ps-add-launchlink.php                     24-May-2024 14:02                6073
function.ps-add-locallink.php                      24-May-2024 14:02                6863
function.ps-add-note.php                           24-May-2024 14:02                7646
function.ps-add-pdflink.php                        24-May-2024 14:02                7232
function.ps-add-weblink.php                        24-May-2024 14:02                6142
function.ps-arc.php                                24-May-2024 14:02                5571
function.ps-arcn.php                               24-May-2024 14:02                5571
function.ps-begin-page.php                         24-May-2024 14:02                7515
function.ps-begin-pattern.php                      24-May-2024 14:02               13470
function.ps-begin-template.php                     24-May-2024 14:02               11613
function.ps-circle.php                             24-May-2024 14:02                5003
function.ps-clip.php                               24-May-2024 14:02                3221
function.ps-close-image.php                        24-May-2024 14:02                4058
function.ps-close.php                              24-May-2024 14:02                3905
function.ps-closepath-stroke.php                   24-May-2024 14:02                3295
function.ps-closepath.php                          24-May-2024 14:02                3478
function.ps-continue-text.php                      24-May-2024 14:02                4329
function.ps-curveto.php                            24-May-2024 14:02                5353
function.ps-delete.php                             24-May-2024 14:02                3805
function.ps-end-page.php                           24-May-2024 14:02                3523
function.ps-end-pattern.php                        24-May-2024 14:02                3422
function.ps-end-template.php                       24-May-2024 14:02                3424
function.ps-fill-stroke.php                        24-May-2024 14:02                3499
function.ps-fill.php                               24-May-2024 14:02                3436
function.ps-findfont.php                           24-May-2024 14:02                7636
function.ps-get-buffer.php                         24-May-2024 14:02                3432
function.ps-get-parameter.php                      24-May-2024 14:02                8336
function.ps-get-value.php                          24-May-2024 14:02                9739
function.ps-hyphenate.php                          24-May-2024 14:02                7542
function.ps-include-file.php                       24-May-2024 14:02                3318
function.ps-lineto.php                             24-May-2024 14:02                8464
function.ps-makespotcolor.php                      24-May-2024 14:02               10469
function.ps-moveto.php                             24-May-2024 14:02                4074
function.ps-new.php                                24-May-2024 14:02                2847
function.ps-open-file.php                          24-May-2024 14:02                3884
function.ps-open-image-file.php                    24-May-2024 14:02                5168
function.ps-open-image.php                         24-May-2024 14:02                7301
function.ps-open-memory-image.php                  24-May-2024 14:02                2998
function.ps-place-image.php                        24-May-2024 14:02                5523
function.ps-rect.php                               24-May-2024 14:02                5248
function.ps-restore.php                            24-May-2024 14:02                3644
function.ps-rotate.php                             24-May-2024 14:02               12432
function.ps-save.php                               24-May-2024 14:02                3341
function.ps-scale.php                              24-May-2024 14:02                3993
function.ps-set-border-color.php                   24-May-2024 14:02                5118
function.ps-set-border-dash.php                    24-May-2024 14:02                4714
function.ps-set-border-style.php                   24-May-2024 14:02                4761
function.ps-set-info.php                           24-May-2024 14:02                6493
function.ps-set-parameter.php                      24-May-2024 14:02                4162
function.ps-set-text-pos.php                       24-May-2024 14:02                9639
function.ps-set-value.php                          24-May-2024 14:02                5016
function.ps-setcolor.php                           24-May-2024 14:02                6146
function.ps-setdash.php                            24-May-2024 14:02                3862
function.ps-setflat.php                            24-May-2024 14:02                3316
function.ps-setfont.php                            24-May-2024 14:02                4330
function.ps-setgray.php                            24-May-2024 14:02                3518
function.ps-setlinecap.php                         24-May-2024 14:02                4132
function.ps-setlinejoin.php                        24-May-2024 14:02                4124
function.ps-setlinewidth.php                       24-May-2024 14:02                4008
function.ps-setmiterlimit.php                      24-May-2024 14:02                4494
function.ps-setoverprintmode.php                   24-May-2024 14:02                3349
function.ps-setpolydash.php                        24-May-2024 14:02                8027
function.ps-shading-pattern.php                    24-May-2024 14:02                4357
function.ps-shading.php                            24-May-2024 14:02                7354
function.ps-shfill.php                             24-May-2024 14:02                4199
function.ps-show-boxed.php                         24-May-2024 14:02               12724
function.ps-show-xy.php                            24-May-2024 14:02                4463
function.ps-show-xy2.php                           24-May-2024 14:02                3280
function.ps-show.php                               24-May-2024 14:02                6085
function.ps-show2.php                              24-May-2024 14:02                3471
function.ps-string-geometry.php                    24-May-2024 14:02                5114
function.ps-stringwidth.php                        24-May-2024 14:02                4576
function.ps-stroke.php                             24-May-2024 14:02                3644
function.ps-symbol-name.php                        24-May-2024 14:02                4083
function.ps-symbol-width.php                       24-May-2024 14:02                4636
function.ps-symbol.php                             24-May-2024 14:02                3949
function.ps-translate.php                          24-May-2024 14:02               14441
function.pspell-add-to-personal.php                24-May-2024 14:02                5764
function.pspell-add-to-session.php                 24-May-2024 14:02                3367
function.pspell-check.php                          24-May-2024 14:02                4331
function.pspell-clear-session.php                  24-May-2024 14:02                5134
function.pspell-config-create.php                  24-May-2024 14:02                7652
function.pspell-config-data-dir.php                24-May-2024 14:02                2831
function.pspell-config-dict-dir.php                24-May-2024 14:02                2821
function.pspell-config-ignore.php                  24-May-2024 14:02                5041
function.pspell-config-mode.php                    24-May-2024 14:02                5924
function.pspell-config-personal.php                24-May-2024 14:02                5889
function.pspell-config-repl.php                    24-May-2024 14:02                6243
function.pspell-config-runtogether.php             24-May-2024 14:02                5741
function.pspell-config-save-repl.php               24-May-2024 14:02                4674
function.pspell-new-config.php                     24-May-2024 14:02                5150
function.pspell-new-personal.php                   24-May-2024 14:02               10343
function.pspell-new.php                            24-May-2024 14:02                8812
function.pspell-save-wordlist.php                  24-May-2024 14:02                5530
function.pspell-store-replacement.php              24-May-2024 14:02                7246
function.pspell-suggest.php                        24-May-2024 14:02                4710
function.putenv.php                                24-May-2024 14:02                4132
function.quoted-printable-decode.php               24-May-2024 14:02                3660
function.quoted-printable-encode.php               24-May-2024 14:02                3599
function.quotemeta.php                             24-May-2024 14:02                4810
function.rad2deg.php                               24-May-2024 14:02                3665
function.radius-acct-open.php                      24-May-2024 14:02                3312
function.radius-add-server.php                     24-May-2024 14:02                7830
function.radius-auth-open.php                      24-May-2024 14:02                3324
function.radius-close.php                          24-May-2024 14:02                2722
function.radius-config.php                         24-May-2024 14:02                4133
function.radius-create-request.php                 24-May-2024 14:02                5381
function.radius-cvt-addr.php                       24-May-2024 14:02                6246
function.radius-cvt-int.php                        24-May-2024 14:02                5646
function.radius-cvt-string.php                     24-May-2024 14:02                5700
function.radius-demangle-mppe-key.php              24-May-2024 14:02                3277
function.radius-demangle.php                       24-May-2024 14:02                3008
function.radius-get-attr.php                       24-May-2024 14:02                6498
function.radius-get-tagged-attr-data.php           24-May-2024 14:02                6592
function.radius-get-tagged-attr-tag.php            24-May-2024 14:02                6645
function.radius-get-vendor-attr.php                24-May-2024 14:02                8241
function.radius-put-addr.php                       24-May-2024 14:02                5719
function.radius-put-attr.php                       24-May-2024 14:02                8955
function.radius-put-int.php                        24-May-2024 14:02                7692
function.radius-put-string.php                     24-May-2024 14:02                8072
function.radius-put-vendor-addr.php                24-May-2024 14:02                5673
function.radius-put-vendor-attr.php                24-May-2024 14:02                7939
function.radius-put-vendor-int.php                 24-May-2024 14:02                6451
function.radius-put-vendor-string.php              24-May-2024 14:02                6844
function.radius-request-authenticator.php          24-May-2024 14:02                3205
function.radius-salt-encrypt-attr.php              24-May-2024 14:02                4299
function.radius-send-request.php                   24-May-2024 14:02                4045
function.radius-server-secret.php                  24-May-2024 14:02                2736
function.radius-strerror.php                       24-May-2024 14:02                2678
function.rand.php                                  24-May-2024 14:02                9853
function.random-bytes.php                          24-May-2024 14:02                8498
function.random-int.php                            24-May-2024 14:02                8367
function.range.php                                 24-May-2024 14:02                7308
function.rar-wrapper-cache-stats.php               24-May-2024 14:02                2415
function.rawurldecode.php                          24-May-2024 14:02                4729
function.rawurlencode.php                          24-May-2024 14:02                6407
function.read-exif-data.php                        24-May-2024 14:02                1765
function.readdir.php                               24-May-2024 14:02                9845
function.readfile.php                              24-May-2024 14:02               10038
function.readgzfile.php                            24-May-2024 14:02                4699
function.readline-add-history.php                  24-May-2024 14:02                2851
function.readline-callback-handler-install.php     24-May-2024 14:02                9615
function.readline-callback-handler-remove.php      24-May-2024 14:02                3800
function.readline-callback-read-char.php           24-May-2024 14:02                3727
function.readline-clear-history.php                24-May-2024 14:02                2374
function.readline-completion-function.php          24-May-2024 14:02                3143
function.readline-info.php                         24-May-2024 14:02                3419
function.readline-list-history.php                 24-May-2024 14:02                2222
function.readline-on-new-line.php                  24-May-2024 14:02                2179
function.readline-read-history.php                 24-May-2024 14:02                2886
function.readline-redisplay.php                    24-May-2024 14:02                2099
function.readline-write-history.php                24-May-2024 14:02                2838
function.readline.php                              24-May-2024 14:02                4860
function.readlink.php                              24-May-2024 14:02                4770
function.realpath-cache-get.php                    24-May-2024 14:02                4197
function.realpath-cache-size.php                   24-May-2024 14:02                3635
function.realpath.php                              24-May-2024 14:02                9173
function.recode-file.php                           24-May-2024 14:02                5899
function.recode-string.php                         24-May-2024 14:02                5204
function.recode.php                                24-May-2024 14:02                1766
function.register-shutdown-function.php            24-May-2024 14:02                7569
function.register-tick-function.php                24-May-2024 14:02                6928
function.rename.php                                24-May-2024 14:02                7002
function.require-once.php                          24-May-2024 14:02                1840
function.require.php                               24-May-2024 14:02                2031
function.reset.php                                 24-May-2024 14:02                6329
function.restore-error-handler.php                 24-May-2024 14:02                5938
function.restore-exception-handler.php             24-May-2024 14:02                6757
function.restore-include-path.php                  24-May-2024 14:02                4845
function.return.php                                24-May-2024 14:02                4051
function.rewind.php                                24-May-2024 14:02                6506
function.rewinddir.php                             24-May-2024 14:02                3182
function.rmdir.php                                 24-May-2024 14:02                5194
function.rnp-backend-string.php                    24-May-2024 14:02                2278
function.rnp-backend-version.php                   24-May-2024 14:02                2211
function.rnp-decrypt.php                           24-May-2024 14:02                3253
function.rnp-dump-packets-to-json.php              24-May-2024 14:02                3167
function.rnp-dump-packets.php                      24-May-2024 14:02                3121
function.rnp-ffi-create.php                        24-May-2024 14:02                3216
function.rnp-ffi-destroy.php                       24-May-2024 14:02                2458
function.rnp-ffi-set-pass-provider.php             24-May-2024 14:02                6744
function.rnp-import-keys.php                       24-May-2024 14:02                3505
function.rnp-import-signatures.php                 24-May-2024 14:02                3495
function.rnp-key-export-autocrypt.php              24-May-2024 14:02                4556
function.rnp-key-export-revocation.php             24-May-2024 14:02                5207
function.rnp-key-export.php                        24-May-2024 14:02                3475
function.rnp-key-get-info.php                      24-May-2024 14:02                7994
function.rnp-key-remove.php                        24-May-2024 14:02                3615
function.rnp-key-revoke.php                        24-May-2024 14:02                4853
function.rnp-list-keys.php                         24-May-2024 14:02                3158
function.rnp-load-keys-from-path.php               24-May-2024 14:02                3854
function.rnp-load-keys.php                         24-May-2024 14:02                3810
function.rnp-locate-key.php                        24-May-2024 14:02                3578
function.rnp-op-encrypt.php                        24-May-2024 14:02                7946
function.rnp-op-generate-key.php                   24-May-2024 14:02                7565
function.rnp-op-sign-cleartext.php                 24-May-2024 14:02                5215
function.rnp-op-sign-detached.php                  24-May-2024 14:02                5094
function.rnp-op-sign.php                           24-May-2024 14:02                6175
function.rnp-op-verify-detached.php                24-May-2024 14:02                7105
function.rnp-op-verify.php                         24-May-2024 14:02                6844
function.rnp-save-keys-to-path.php                 24-May-2024 14:02                3868
function.rnp-save-keys.php                         24-May-2024 14:02                3841
function.rnp-supported-features.php                24-May-2024 14:02                2935
function.rnp-version-string-full.php               24-May-2024 14:02                2296
function.rnp-version-string.php                    24-May-2024 14:02                2193
function.round.php                                 24-May-2024 14:02               20913
function.rpmaddtag.php                             24-May-2024 14:02                3349
function.rpmdbinfo.php                             24-May-2024 14:02                5239
function.rpmdbsearch.php                           24-May-2024 14:02                6139
function.rpmgetsymlink.php                         24-May-2024 14:02                2985
function.rpminfo.php                               24-May-2024 14:02                5421
function.rpmvercmp.php                             24-May-2024 14:02                4923
function.rrd-create.php                            24-May-2024 14:02                3110
function.rrd-error.php                             24-May-2024 14:02                2145
function.rrd-fetch.php                             24-May-2024 14:02                3082
function.rrd-first.php                             24-May-2024 14:02                3013
function.rrd-graph.php                             24-May-2024 14:02                3345
function.rrd-info.php                              24-May-2024 14:02                2583
function.rrd-last.php                              24-May-2024 14:02                2579
function.rrd-lastupdate.php                        24-May-2024 14:02                2749
function.rrd-restore.php                           24-May-2024 14:02                3434
function.rrd-tune.php                              24-May-2024 14:02                3177
function.rrd-update.php                            24-May-2024 14:02                3210
function.rrd-version.php                           24-May-2024 14:02                2259
function.rrd-xport.php                             24-May-2024 14:02                2829
function.rrdc-disconnect.php                       24-May-2024 14:02                2572
function.rsort.php                                 24-May-2024 14:02                6421
function.rtrim.php                                 24-May-2024 14:02                9682
function.runkit-constant-add.php                   24-May-2024 14:02                4048
function.runkit-constant-redefine.php              24-May-2024 14:02                3907
function.runkit-constant-remove.php                24-May-2024 14:02                3731
function.runkit-function-add.php                   24-May-2024 14:02                6377
function.runkit-function-copy.php                  24-May-2024 14:02                5669
function.runkit-function-redefine.php              24-May-2024 14:02                6555
function.runkit-function-remove.php                24-May-2024 14:02                4250
function.runkit-function-rename.php                24-May-2024 14:02                4547
function.runkit-import.php                         24-May-2024 14:02                5714
function.runkit-method-add.php                     24-May-2024 14:02                8788
function.runkit-method-copy.php                    24-May-2024 14:02                7360
function.runkit-method-redefine.php                24-May-2024 14:02                9462
function.runkit-method-remove.php                  24-May-2024 14:02                6600
function.runkit-method-rename.php                  24-May-2024 14:02                6731
function.runkit-superglobals.php                   24-May-2024 14:02                2506
function.runkit7-object-id.php                     24-May-2024 14:02                3768
function.runkit7-zval-inspect.php                  24-May-2024 14:02                5125
function.sapi-windows-cp-conv.php                  24-May-2024 14:02                4767
function.sapi-windows-cp-get.php                   24-May-2024 14:02                3476
function.sapi-windows-cp-is-utf8.php               24-May-2024 14:02                2757
function.sapi-windows-cp-set.php                   24-May-2024 14:02                3090
function.sapi-windows-generate-ctrl-event.php      24-May-2024 14:02                7799
function.sapi-windows-set-ctrl-handler.php         24-May-2024 14:02                7598
function.sapi-windows-vt100-support.php            24-May-2024 14:02               11212
function.scandir.php                               24-May-2024 14:02                9465
function.scoutapm-get-calls.php                    24-May-2024 14:02                4472
function.scoutapm-list-instrumented-functions.php  24-May-2024 14:02                3809
function.seaslog-get-author.php                    24-May-2024 14:02                3129
function.seaslog-get-version.php                   24-May-2024 14:02                3127
function.sem-acquire.php                           24-May-2024 14:02                5010
function.sem-get.php                               24-May-2024 14:02                5834
function.sem-release.php                           24-May-2024 14:02                3652
function.sem-remove.php                            24-May-2024 14:02                3626
function.serialize.php                             24-May-2024 14:02               10360
function.session-abort.php                         24-May-2024 14:02                4134
function.session-cache-expire.php                  24-May-2024 14:02                6782
function.session-cache-limiter.php                 24-May-2024 14:02                8307
function.session-commit.php                        24-May-2024 14:02                1856
function.session-create-id.php                     24-May-2024 14:02               10153
function.session-decode.php                        24-May-2024 14:02                3905
function.session-destroy.php                       24-May-2024 14:02                6949
function.session-encode.php                        24-May-2024 14:02                3617
function.session-gc.php                            24-May-2024 14:02                7795
function.session-get-cookie-params.php             24-May-2024 14:02                5009
function.session-id.php                            24-May-2024 14:02                5307
function.session-module-name.php                   24-May-2024 14:02                2804
function.session-name.php                          24-May-2024 14:02                5754
function.session-regenerate-id.php                 24-May-2024 14:02                6715
function.session-register-shutdown.php             24-May-2024 14:02                2798
function.session-reset.php                         24-May-2024 14:02                3331
function.session-save-path.php                     24-May-2024 14:02                3915
function.session-set-cookie-params.php             24-May-2024 14:02                7510
function.session-set-save-handler.php              24-May-2024 14:02               29705
function.session-start.php                         24-May-2024 14:02               15297
function.session-status.php                        24-May-2024 14:02                3186
function.session-unset.php                         24-May-2024 14:02                3299
function.session-write-close.php                   24-May-2024 14:02                3255
function.set-error-handler.php                     24-May-2024 14:02               26115
function.set-exception-handler.php                 24-May-2024 14:02                9214
function.set-file-buffer.php                       24-May-2024 14:02                1825
function.set-include-path.php                      24-May-2024 14:02                6418
function.set-time-limit.php                        24-May-2024 14:02                4856
function.setcookie.php                             24-May-2024 14:02               26521
function.setlocale.php                             24-May-2024 14:02               16162
function.setrawcookie.php                          24-May-2024 14:02                6594
function.settype.php                               24-May-2024 14:02                6434
function.sha1-file.php                             24-May-2024 14:02                6338
function.sha1.php                                  24-May-2024 14:02                6049
function.shell-exec.php                            24-May-2024 14:02                4800
function.shm-attach.php                            24-May-2024 14:02                7981
function.shm-detach.php                            24-May-2024 14:02                3863
function.shm-get-var.php                           24-May-2024 14:02                3749
function.shm-has-var.php                           24-May-2024 14:02                3749
function.shm-put-var.php                           24-May-2024 14:02                4890
function.shm-remove-var.php                        24-May-2024 14:02                3638
function.shm-remove.php                            24-May-2024 14:02                3358
function.shmop-close.php                           24-May-2024 14:02                4523
function.shmop-delete.php                          24-May-2024 14:02                4347
function.shmop-open.php                            24-May-2024 14:02                8861
function.shmop-read.php                            24-May-2024 14:02                5647
function.shmop-size.php                            24-May-2024 14:02                4424
function.shmop-write.php                           24-May-2024 14:02                5782
function.show-source.php                           24-May-2024 14:02                1770
function.shuffle.php                               24-May-2024 14:02                5114
function.simdjson-decode.php                       24-May-2024 14:02               17032
function.simdjson-is-valid.php                     24-May-2024 14:02               10501
function.simdjson-key-count.php                    24-May-2024 14:02                4826
function.simdjson-key-exists.php                   24-May-2024 14:02                4621
function.simdjson-key-value.php                    24-May-2024 14:02                7385
function.similar-text.php                          24-May-2024 14:02                4296
function.simplexml-import-dom.php                  24-May-2024 14:02                6880
function.simplexml-load-file.php                   24-May-2024 14:02               11051
function.simplexml-load-string.php                 24-May-2024 14:02               10457
function.sin.php                                   24-May-2024 14:02                4610
function.sinh.php                                  24-May-2024 14:02                3240
function.sizeof.php                                24-May-2024 14:02                1661
function.sleep.php                                 24-May-2024 14:02                6792
function.snmp-get-quick-print.php                  24-May-2024 14:02                3714
function.snmp-get-valueretrieval.php               24-May-2024 14:02                4463
function.snmp-read-mib.php                         24-May-2024 14:02                4899
function.snmp-set-enum-print.php                   24-May-2024 14:02                5395
function.snmp-set-oid-numeric-print.php            24-May-2024 14:02                2346
function.snmp-set-oid-output-format.php            24-May-2024 14:02                7825
function.snmp-set-quick-print.php                  24-May-2024 14:02                7247
function.snmp-set-valueretrieval.php               24-May-2024 14:02                9537
function.snmp2-get.php                             24-May-2024 14:02                5816
function.snmp2-getnext.php                         24-May-2024 14:02                6184
function.snmp2-real-walk.php                       24-May-2024 14:02                6623
function.snmp2-set.php                             24-May-2024 14:02               11081
function.snmp2-walk.php                            24-May-2024 14:02                7108
function.snmp3-get.php                             24-May-2024 14:02                8925
function.snmp3-getnext.php                         24-May-2024 14:02                9253
function.snmp3-real-walk.php                       24-May-2024 14:02                9938
function.snmp3-set.php                             24-May-2024 14:02               13856
function.snmp3-walk.php                            24-May-2024 14:02               10398
function.snmpget.php                               24-May-2024 14:02                5810
function.snmpgetnext.php                           24-May-2024 14:02                6059
function.snmprealwalk.php                          24-May-2024 14:02                6493
function.snmpset.php                               24-May-2024 14:02               11112
function.snmpwalk.php                              24-May-2024 14:02                7129
function.snmpwalkoid.php                           24-May-2024 14:02                7789
function.socket-accept.php                         24-May-2024 14:02                5874
function.socket-addrinfo-bind.php                  24-May-2024 14:02                5258
function.socket-addrinfo-connect.php               24-May-2024 14:02                5059
function.socket-addrinfo-explain.php               24-May-2024 14:02                4411
function.socket-addrinfo-lookup.php                24-May-2024 14:02                6050
function.socket-atmark.php                         24-May-2024 14:02                4939
function.socket-bind.php                           24-May-2024 14:02               10475
function.socket-clear-error.php                    24-May-2024 14:02                3681
function.socket-close.php                          24-May-2024 14:02                3860
function.socket-cmsg-space.php                     24-May-2024 14:02                3718
function.socket-connect.php                        24-May-2024 14:02                6575
function.socket-create-listen.php                  24-May-2024 14:02                6344
function.socket-create-pair.php                    24-May-2024 14:02               19682
function.socket-create.php                         24-May-2024 14:02               12312
function.socket-export-stream.php                  24-May-2024 14:02                3523
function.socket-get-option.php                     24-May-2024 14:02               25748
function.socket-get-status.php                     24-May-2024 14:02                1841
function.socket-getopt.php                         24-May-2024 14:02                1829
function.socket-getpeername.php                    24-May-2024 14:02                7724
function.socket-getsockname.php                    24-May-2024 14:02                7020
function.socket-import-stream.php                  24-May-2024 14:02                4529
function.socket-last-error.php                     24-May-2024 14:02                6207
function.socket-listen.php                         24-May-2024 14:02                6780
function.socket-read.php                           24-May-2024 14:02                7222
function.socket-recv.php                           24-May-2024 14:02               15724
function.socket-recvfrom.php                       24-May-2024 14:02               13376
function.socket-recvmsg.php                        24-May-2024 14:02                3764
function.socket-select.php                         24-May-2024 14:02               15703
function.socket-send.php                           24-May-2024 14:02                6164
function.socket-sendmsg.php                        24-May-2024 14:02                3896
function.socket-sendto.php                         24-May-2024 14:02                9103
function.socket-set-block.php                      24-May-2024 14:02                5573
function.socket-set-blocking.php                   24-May-2024 14:02                1859
function.socket-set-nonblock.php                   24-May-2024 14:02                6012
function.socket-set-option.php                     24-May-2024 14:02               10782
function.socket-set-timeout.php                    24-May-2024 14:02                1828
function.socket-setopt.php                         24-May-2024 14:02                1823
function.socket-shutdown.php                       24-May-2024 14:02                4378
function.socket-strerror.php                       24-May-2024 14:02                7278
function.socket-write.php                          24-May-2024 14:02                6441
function.socket-wsaprotocol-info-export.php        24-May-2024 14:02                5027
function.socket-wsaprotocol-info-import.php        24-May-2024 14:02                4412
function.socket-wsaprotocol-info-release.php       24-May-2024 14:02                3663
function.sodium-add.php                            24-May-2024 14:02                3211
function.sodium-base642bin.php                     24-May-2024 14:02                4587
function.sodium-bin2base64.php                     24-May-2024 14:02                4117
function.sodium-bin2hex.php                        24-May-2024 14:02                2814
function.sodium-compare.php                        24-May-2024 14:02                3438
function.sodium-crypto-aead-aes256gcm-decrypt.php  24-May-2024 14:02                4811
function.sodium-crypto-aead-aes256gcm-encrypt.php  24-May-2024 14:02                4618
function.sodium-crypto-aead-aes256gcm-is-availa..> 24-May-2024 14:02                2859
function.sodium-crypto-aead-aes256gcm-keygen.php   24-May-2024 14:02                2849
function.sodium-crypto-aead-chacha20poly1305-de..> 24-May-2024 14:02                4676
function.sodium-crypto-aead-chacha20poly1305-en..> 24-May-2024 14:02                4492
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-May-2024 14:02                4906
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-May-2024 14:02                4658
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-May-2024 14:02                3043
function.sodium-crypto-aead-chacha20poly1305-ke..> 24-May-2024 14:02                2978
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-May-2024 14:02                5084
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-May-2024 14:02                4876
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-May-2024 14:02                3019
function.sodium-crypto-auth-keygen.php             24-May-2024 14:02                2670
function.sodium-crypto-auth-verify.php             24-May-2024 14:02                4003
function.sodium-crypto-auth.php                    24-May-2024 14:02                3470
function.sodium-crypto-box-keypair-from-secretk..> 24-May-2024 14:02                3549
function.sodium-crypto-box-keypair.php             24-May-2024 14:02                2951
function.sodium-crypto-box-open.php                24-May-2024 14:02                4111
function.sodium-crypto-box-publickey-from-secre..> 24-May-2024 14:02                3380
function.sodium-crypto-box-publickey.php           24-May-2024 14:02                3093
function.sodium-crypto-box-seal-open.php           24-May-2024 14:02                6155
function.sodium-crypto-box-seal.php                24-May-2024 14:02                7288
function.sodium-crypto-box-secretkey.php           24-May-2024 14:02                3060
function.sodium-crypto-box-seed-keypair.php        24-May-2024 14:02                3119
function.sodium-crypto-box.php                     24-May-2024 14:02                4436
function.sodium-crypto-core-ristretto255-add.php   24-May-2024 14:02                6182
function.sodium-crypto-core-ristretto255-from-h..> 24-May-2024 14:02                5542
function.sodium-crypto-core-ristretto255-is-val..> 24-May-2024 14:02                5707
function.sodium-crypto-core-ristretto255-random..> 24-May-2024 14:02                5690
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 14:02                6449
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 14:02                3688
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 14:02                5541
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 14:02                3947
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 14:02                5525
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 14:02                5849
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 14:02                3632
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 14:02                6440
function.sodium-crypto-core-ristretto255-sub.php   24-May-2024 14:02                6219
function.sodium-crypto-generichash-final.php       24-May-2024 14:02                6904
function.sodium-crypto-generichash-init.php        24-May-2024 14:02                6951
function.sodium-crypto-generichash-keygen.php      24-May-2024 14:02                2480
function.sodium-crypto-generichash-update.php      24-May-2024 14:02                6586
function.sodium-crypto-generichash.php             24-May-2024 14:02                3875
function.sodium-crypto-kdf-derive-from-key.php     24-May-2024 14:02                4086
function.sodium-crypto-kdf-keygen.php              24-May-2024 14:02                2582
function.sodium-crypto-kx-client-session-keys.php  24-May-2024 14:02                3502
function.sodium-crypto-kx-keypair.php              24-May-2024 14:02                5026
function.sodium-crypto-kx-publickey.php            24-May-2024 14:02                2912
function.sodium-crypto-kx-secretkey.php            24-May-2024 14:02                2923
function.sodium-crypto-kx-seed-keypair.php         24-May-2024 14:02                2885
function.sodium-crypto-kx-server-session-keys.php  24-May-2024 14:02                3568
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-May-2024 14:02                3490
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-May-2024 14:02                3693
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-May-2024 14:02                6568
function.sodium-crypto-pwhash-str-needs-rehash.php 24-May-2024 14:02                4045
function.sodium-crypto-pwhash-str-verify.php       24-May-2024 14:02                4924
function.sodium-crypto-pwhash-str.php              24-May-2024 14:02                8759
function.sodium-crypto-pwhash.php                  24-May-2024 14:02               10556
function.sodium-crypto-scalarmult-base.php         24-May-2024 14:02                2073
function.sodium-crypto-scalarmult-ristretto255-..> 24-May-2024 14:02                3601
function.sodium-crypto-scalarmult-ristretto255.php 24-May-2024 14:02                3950
function.sodium-crypto-scalarmult.php              24-May-2024 14:02                3094
function.sodium-crypto-secretbox-keygen.php        24-May-2024 14:02                6297
function.sodium-crypto-secretbox-open.php          24-May-2024 14:02                8909
function.sodium-crypto-secretbox.php               24-May-2024 14:02                8913
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 14:02               11008
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 14:02               10342
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 14:02                2746
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 14:02                5852
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 14:02                5960
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 14:02                3006
function.sodium-crypto-shorthash-keygen.php        24-May-2024 14:02                2754
function.sodium-crypto-shorthash.php               24-May-2024 14:02                3303
function.sodium-crypto-sign-detached.php           24-May-2024 14:02                3296
function.sodium-crypto-sign-ed25519-pk-to-curve..> 24-May-2024 14:02                2983
function.sodium-crypto-sign-ed25519-sk-to-curve..> 24-May-2024 14:02                3136
function.sodium-crypto-sign-keypair-from-secret..> 24-May-2024 14:02                3375
function.sodium-crypto-sign-keypair.php            24-May-2024 14:02                2468
function.sodium-crypto-sign-open.php               24-May-2024 14:02                3380
function.sodium-crypto-sign-publickey-from-secr..> 24-May-2024 14:02                2938
function.sodium-crypto-sign-publickey.php          24-May-2024 14:02                2948
function.sodium-crypto-sign-secretkey.php          24-May-2024 14:02                2924
function.sodium-crypto-sign-seed-keypair.php       24-May-2024 14:02                3157
function.sodium-crypto-sign-verify-detached.php    24-May-2024 14:02                3683
function.sodium-crypto-sign.php                    24-May-2024 14:02                3374
function.sodium-crypto-stream-keygen.php           24-May-2024 14:02                2651
function.sodium-crypto-stream-xchacha20-keygen.php 24-May-2024 14:02                2809
function.sodium-crypto-stream-xchacha20-xor-ic.php 24-May-2024 14:02                9849
function.sodium-crypto-stream-xchacha20-xor.php    24-May-2024 14:02                4921
function.sodium-crypto-stream-xchacha20.php        24-May-2024 14:02                3830
function.sodium-crypto-stream-xor.php              24-May-2024 14:02                3713
function.sodium-crypto-stream.php                  24-May-2024 14:02                3549
function.sodium-hex2bin.php                        24-May-2024 14:02                3422
function.sodium-increment.php                      24-May-2024 14:02                2546
function.sodium-memcmp.php                         24-May-2024 14:02                3742
function.sodium-memzero.php                        24-May-2024 14:02                2638
function.sodium-pad.php                            24-May-2024 14:02                2871
function.sodium-unpad.php                          24-May-2024 14:02                2826
function.solr-get-version.php                      24-May-2024 14:02                4007
function.sort.php                                  24-May-2024 14:02               12670
function.soundex.php                               24-May-2024 14:02                6530
function.spl-autoload-call.php                     24-May-2024 14:02                2714
function.spl-autoload-extensions.php               24-May-2024 14:02                3489
function.spl-autoload-functions.php                24-May-2024 14:02                2712
function.spl-autoload-register.php                 24-May-2024 14:02               10677
function.spl-autoload-unregister.php               24-May-2024 14:02                3149
function.spl-autoload.php                          24-May-2024 14:02                4008
function.spl-classes.php                           24-May-2024 14:02                3844
function.spl-object-hash.php                       24-May-2024 14:02                4162
function.spl-object-id.php                         24-May-2024 14:02                4163
function.sprintf.php                               24-May-2024 14:02               32412
function.sqlsrv-begin-transaction.php              24-May-2024 14:02               11384
function.sqlsrv-cancel.php                         24-May-2024 14:02               10398
function.sqlsrv-client-info.php                    24-May-2024 14:02                6879
function.sqlsrv-close.php                          24-May-2024 14:02                5668
function.sqlsrv-commit.php                         24-May-2024 14:02               11243
function.sqlsrv-configure.php                      24-May-2024 14:02                4859
function.sqlsrv-connect.php                        24-May-2024 14:02               12494
function.sqlsrv-errors.php                         24-May-2024 14:02               10262
function.sqlsrv-execute.php                        24-May-2024 14:02               10321
function.sqlsrv-fetch-array.php                    24-May-2024 14:02               15970
function.sqlsrv-fetch-object.php                   24-May-2024 14:02               12920
function.sqlsrv-fetch.php                          24-May-2024 14:02               11074
function.sqlsrv-field-metadata.php                 24-May-2024 14:02                8995
function.sqlsrv-free-stmt.php                      24-May-2024 14:02                7786
function.sqlsrv-get-config.php                     24-May-2024 14:02                3393
function.sqlsrv-get-field.php                      24-May-2024 14:02               10294
function.sqlsrv-has-rows.php                       24-May-2024 14:02                6390
function.sqlsrv-next-result.php                    24-May-2024 14:02                9310
function.sqlsrv-num-fields.php                     24-May-2024 14:02                8268
function.sqlsrv-num-rows.php                       24-May-2024 14:02                7951
function.sqlsrv-prepare.php                        24-May-2024 14:02               14569
function.sqlsrv-query.php                          24-May-2024 14:02               11922
function.sqlsrv-rollback.php                       24-May-2024 14:02               10654
function.sqlsrv-rows-affected.php                  24-May-2024 14:02                8001
function.sqlsrv-send-stream-data.php               24-May-2024 14:02                8570
function.sqlsrv-server-info.php                    24-May-2024 14:02                6217
function.sqrt.php                                  24-May-2024 14:02                3906
function.srand.php                                 24-May-2024 14:02                7223
function.sscanf.php                                24-May-2024 14:02               10382
function.ssdeep-fuzzy-compare.php                  24-May-2024 14:02                3311
function.ssdeep-fuzzy-hash-filename.php            24-May-2024 14:02                3033
function.ssdeep-fuzzy-hash.php                     24-May-2024 14:02                2875
function.ssh2-auth-agent.php                       24-May-2024 14:02                4802
function.ssh2-auth-hostbased-file.php              24-May-2024 14:02                7775
function.ssh2-auth-none.php                        24-May-2024 14:02                4902
function.ssh2-auth-password.php                    24-May-2024 14:02                5061
function.ssh2-auth-pubkey-file.php                 24-May-2024 14:02                7276
function.ssh2-connect.php                          24-May-2024 14:02               15794
function.ssh2-disconnect.php                       24-May-2024 14:02                3144
function.ssh2-exec.php                             24-May-2024 14:02                7666
function.ssh2-fetch-stream.php                     24-May-2024 14:02                5581
function.ssh2-fingerprint.php                      24-May-2024 14:02                5573
function.ssh2-forward-accept.php                   24-May-2024 14:02                3135
function.ssh2-forward-listen.php                   24-May-2024 14:02                4580
function.ssh2-methods-negotiated.php               24-May-2024 14:02                8039
function.ssh2-poll.php                             24-May-2024 14:02                3621
function.ssh2-publickey-add.php                    24-May-2024 14:02                8491
function.ssh2-publickey-init.php                   24-May-2024 14:02                4734
function.ssh2-publickey-list.php                   24-May-2024 14:02                8891
function.ssh2-publickey-remove.php                 24-May-2024 14:02                4778
function.ssh2-scp-recv.php                         24-May-2024 14:02                5582
function.ssh2-scp-send.php                         24-May-2024 14:02                6187
function.ssh2-send-eof.php                         24-May-2024 14:02                3496
function.ssh2-sftp-chmod.php                       24-May-2024 14:02                6035
function.ssh2-sftp-lstat.php                       24-May-2024 14:02                7364
function.ssh2-sftp-mkdir.php                       24-May-2024 14:02                6898
function.ssh2-sftp-readlink.php                    24-May-2024 14:02                5396
function.ssh2-sftp-realpath.php                    24-May-2024 14:02                5617
function.ssh2-sftp-rename.php                      24-May-2024 14:02                5613
function.ssh2-sftp-rmdir.php                       24-May-2024 14:02                5604
function.ssh2-sftp-stat.php                        24-May-2024 14:02                7279
function.ssh2-sftp-symlink.php                     24-May-2024 14:02                5814
function.ssh2-sftp-unlink.php                      24-May-2024 14:02                5079
function.ssh2-sftp.php                             24-May-2024 14:02                5205
function.ssh2-shell.php                            24-May-2024 14:02                8125
function.ssh2-tunnel.php                           24-May-2024 14:02                5402
function.stat.php                                  24-May-2024 14:02               12404
function.stats-absolute-deviation.php              24-May-2024 14:02                2869
function.stats-cdf-beta.php                        24-May-2024 14:02                5233
function.stats-cdf-binomial.php                    24-May-2024 14:02                5218
function.stats-cdf-cauchy.php                      24-May-2024 14:02                5253
function.stats-cdf-chisquare.php                   24-May-2024 14:02                4572
function.stats-cdf-exponential.php                 24-May-2024 14:02                4603
function.stats-cdf-f.php                           24-May-2024 14:02                5158
function.stats-cdf-gamma.php                       24-May-2024 14:02                5217
function.stats-cdf-laplace.php                     24-May-2024 14:02                5238
function.stats-cdf-logistic.php                    24-May-2024 14:02                5273
function.stats-cdf-negative-binomial.php           24-May-2024 14:02                5361
function.stats-cdf-noncentral-chisquare.php        24-May-2024 14:02                5463
function.stats-cdf-noncentral-f.php                24-May-2024 14:02                6037
function.stats-cdf-noncentral-t.php                24-May-2024 14:02                5323
function.stats-cdf-normal.php                      24-May-2024 14:02                5255
function.stats-cdf-poisson.php                     24-May-2024 14:02                4537
function.stats-cdf-t.php                           24-May-2024 14:02                4465
function.stats-cdf-uniform.php                     24-May-2024 14:02                5218
function.stats-cdf-weibull.php                     24-May-2024 14:02                5255
function.stats-covariance.php                      24-May-2024 14:02                3066
function.stats-dens-beta.php                       24-May-2024 14:02                3552
function.stats-dens-cauchy.php                     24-May-2024 14:02                3610
function.stats-dens-chisquare.php                  24-May-2024 14:02                3280
function.stats-dens-exponential.php                24-May-2024 14:02                3270
function.stats-dens-f.php                          24-May-2024 14:02                3550
function.stats-dens-gamma.php                      24-May-2024 14:02                3603
function.stats-dens-laplace.php                    24-May-2024 14:02                3637
function.stats-dens-logistic.php                   24-May-2024 14:02                3649
function.stats-dens-normal.php                     24-May-2024 14:02                3620
function.stats-dens-pmf-binomial.php               24-May-2024 14:02                3674
function.stats-dens-pmf-hypergeometric.php         24-May-2024 14:02                4326
function.stats-dens-pmf-negative-binomial.php      24-May-2024 14:02                3803
function.stats-dens-pmf-poisson.php                24-May-2024 14:02                3271
function.stats-dens-t.php                          24-May-2024 14:02                3184
function.stats-dens-uniform.php                    24-May-2024 14:02                3585
function.stats-dens-weibull.php                    24-May-2024 14:02                3617
function.stats-harmonic-mean.php                   24-May-2024 14:02                2765
function.stats-kurtosis.php                        24-May-2024 14:02                2773
function.stats-rand-gen-beta.php                   24-May-2024 14:02                3079
function.stats-rand-gen-chisquare.php              24-May-2024 14:02                2752
function.stats-rand-gen-exponential.php            24-May-2024 14:02                2750
function.stats-rand-gen-f.php                      24-May-2024 14:02                3133
function.stats-rand-gen-funiform.php               24-May-2024 14:02                3060
function.stats-rand-gen-gamma.php                  24-May-2024 14:02                3146
function.stats-rand-gen-ibinomial-negative.php     24-May-2024 14:02                3226
function.stats-rand-gen-ibinomial.php              24-May-2024 14:02                3150
function.stats-rand-gen-int.php                    24-May-2024 14:02                2321
function.stats-rand-gen-ipoisson.php               24-May-2024 14:02                2725
function.stats-rand-gen-iuniform.php               24-May-2024 14:02                3127
function.stats-rand-gen-noncentral-chisquare.php   24-May-2024 14:02                3268
function.stats-rand-gen-noncentral-f.php           24-May-2024 14:02                3621
function.stats-rand-gen-noncentral-t.php           24-May-2024 14:02                3181
function.stats-rand-gen-normal.php                 24-May-2024 14:02                3094
function.stats-rand-gen-t.php                      24-May-2024 14:02                2644
function.stats-rand-get-seeds.php                  24-May-2024 14:02                2364
function.stats-rand-phrase-to-seeds.php            24-May-2024 14:02                2733
function.stats-rand-ranf.php                       24-May-2024 14:02                2365
function.stats-rand-setall.php                     24-May-2024 14:02                3002
function.stats-skew.php                            24-May-2024 14:02                2739
function.stats-standard-deviation.php              24-May-2024 14:02                3911
function.stats-stat-binomial-coef.php              24-May-2024 14:02                3039
function.stats-stat-correlation.php                24-May-2024 14:02                3246
function.stats-stat-factorial.php                  24-May-2024 14:02                2612
function.stats-stat-independent-t.php              24-May-2024 14:02                3388
function.stats-stat-innerproduct.php               24-May-2024 14:02                3188
function.stats-stat-paired-t.php                   24-May-2024 14:02                3125
function.stats-stat-percentile.php                 24-May-2024 14:02                2991
function.stats-stat-powersum.php                   24-May-2024 14:02                2983
function.stats-variance.php                        24-May-2024 14:02                3410
function.stomp-connect-error.php                   24-May-2024 14:02                3750
function.stomp-version.php                         24-May-2024 14:02                3186
function.str-contains.php                          24-May-2024 14:02                8517
function.str-decrement.php                         24-May-2024 14:02                6559
function.str-ends-with.php                         24-May-2024 14:02                8444
function.str-getcsv.php                            24-May-2024 14:02                4464
function.str-increment.php                         24-May-2024 14:02                6246
function.str-ireplace.php                          24-May-2024 14:02                8533
function.str-pad.php                               24-May-2024 14:02                7988
function.str-repeat.php                            24-May-2024 14:02                4797
function.str-replace.php                           24-May-2024 14:02               16942
function.str-rot13.php                             24-May-2024 14:02                3711
function.str-shuffle.php                           24-May-2024 14:02                4156
function.str-split.php                             24-May-2024 14:02                7151
function.str-starts-with.php                       24-May-2024 14:02                8472
function.str-word-count.php                        24-May-2024 14:02                9137
function.strcasecmp.php                            24-May-2024 14:02                5803
function.strchr.php                                24-May-2024 14:02                1678
function.strcmp.php                                24-May-2024 14:02                5684
function.strcoll.php                               24-May-2024 14:02                5903
function.strcspn.php                               24-May-2024 14:02               10963
function.stream-bucket-append.php                  24-May-2024 14:02                2375
function.stream-bucket-make-writeable.php          24-May-2024 14:02                2312
function.stream-bucket-new.php                     24-May-2024 14:02                2386
function.stream-bucket-prepend.php                 24-May-2024 14:02                6491
function.stream-context-create.php                 24-May-2024 14:02                7216
function.stream-context-get-default.php            24-May-2024 14:02                8438
function.stream-context-get-options.php            24-May-2024 14:02                4588
function.stream-context-get-params.php             24-May-2024 14:02                5762
function.stream-context-set-default.php            24-May-2024 14:02                6393
function.stream-context-set-option.php             24-May-2024 14:02                5003
function.stream-context-set-options.php            24-May-2024 14:02                6484
function.stream-context-set-params.php             24-May-2024 14:02                5033
function.stream-copy-to-stream.php                 24-May-2024 14:02                7505
function.stream-filter-append.php                  24-May-2024 14:02               11979
function.stream-filter-prepend.php                 24-May-2024 14:02                9218
function.stream-filter-register.php                24-May-2024 14:02               18792
function.stream-filter-remove.php                  24-May-2024 14:02                6748
function.stream-get-contents.php                   24-May-2024 14:02                8443
function.stream-get-filters.php                    24-May-2024 14:02                3952
function.stream-get-line.php                       24-May-2024 14:02                4872
function.stream-get-meta-data.php                  24-May-2024 14:02               10466
function.stream-get-transports.php                 24-May-2024 14:02                3940
function.stream-get-wrappers.php                   24-May-2024 14:02                4719
function.stream-is-local.php                       24-May-2024 14:02                4199
function.stream-isatty.php                         24-May-2024 14:02                4034
function.stream-notification-callback.php          24-May-2024 14:02               22632
function.stream-register-wrapper.php               24-May-2024 14:02                1951
function.stream-resolve-include-path.php           24-May-2024 14:02                4325
function.stream-select.php                         24-May-2024 14:02               16087
function.stream-set-blocking.php                   24-May-2024 14:02                5116
function.stream-set-chunk-size.php                 24-May-2024 14:02                3700
function.stream-set-read-buffer.php                24-May-2024 14:02                3908
function.stream-set-timeout.php                    24-May-2024 14:02                9040
function.stream-set-write-buffer.php               24-May-2024 14:02                6333
function.stream-socket-accept.php                  24-May-2024 14:02                6881
function.stream-socket-client.php                  24-May-2024 14:02               16813
function.stream-socket-enable-crypto.php           24-May-2024 14:02               10363
function.stream-socket-get-name.php                24-May-2024 14:02                3773
function.stream-socket-pair.php                    24-May-2024 14:02               10417
function.stream-socket-recvfrom.php                24-May-2024 14:02               10558
function.stream-socket-sendto.php                  24-May-2024 14:02                7479
function.stream-socket-server.php                  24-May-2024 14:02               14817
function.stream-socket-shutdown.php                24-May-2024 14:02                6645
function.stream-supports-lock.php                  24-May-2024 14:02                3278
function.stream-wrapper-register.php               24-May-2024 14:02                9922
function.stream-wrapper-restore.php                24-May-2024 14:02                3012
function.stream-wrapper-unregister.php             24-May-2024 14:02                3225
function.strftime.php                              24-May-2024 14:02               56131
function.strip-tags.php                            24-May-2024 14:02                8645
function.stripcslashes.php                         24-May-2024 14:02                3112
function.stripos.php                               24-May-2024 14:02               10168
function.stripslashes.php                          24-May-2024 14:02                7690
function.stristr.php                               24-May-2024 14:02                9980
function.strlen.php                                24-May-2024 14:02                6351
function.strnatcasecmp.php                         24-May-2024 14:02                5586
function.strnatcmp.php                             24-May-2024 14:02                8600
function.strncasecmp.php                           24-May-2024 14:02                5070
function.strncmp.php                               24-May-2024 14:02                5064
function.strpbrk.php                               24-May-2024 14:02                5386
function.strpos.php                                24-May-2024 14:02               12038
function.strptime.php                              24-May-2024 14:02               10893
function.strrchr.php                               24-May-2024 14:02                7053
function.strrev.php                                24-May-2024 14:02                3233
function.strripos.php                              24-May-2024 14:02                9093
function.strrpos.php                               24-May-2024 14:02               10280
function.strspn.php                                24-May-2024 14:02               10360
function.strstr.php                                24-May-2024 14:02                8681
function.strtok.php                                24-May-2024 14:02               10348
function.strtolower.php                            24-May-2024 14:02                5113
function.strtotime.php                             24-May-2024 14:02               15705
function.strtoupper.php                            24-May-2024 14:02                5095
function.strtr.php                                 24-May-2024 14:02               12054
function.strval.php                                24-May-2024 14:02                6399
function.substr-compare.php                        24-May-2024 14:02               10685
function.substr-count.php                          24-May-2024 14:02                9199
function.substr-replace.php                        24-May-2024 14:02               15335
function.substr.php                                24-May-2024 14:02               22534
function.svn-add.php                               24-May-2024 14:02                6450
function.svn-auth-get-parameter.php                24-May-2024 14:02                4141
function.svn-auth-set-parameter.php                24-May-2024 14:02                5642
function.svn-blame.php                             24-May-2024 14:02                5130
function.svn-cat.php                               24-May-2024 14:02                4980
function.svn-checkout.php                          24-May-2024 14:02                7621
function.svn-cleanup.php                           24-May-2024 14:02                5372
function.svn-client-version.php                    24-May-2024 14:02                3392
function.svn-commit.php                            24-May-2024 14:02                8276
function.svn-delete.php                            24-May-2024 14:02                4824
function.svn-diff.php                              24-May-2024 14:02               13945
function.svn-export.php                            24-May-2024 14:02                5361
function.svn-fs-abort-txn.php                      24-May-2024 14:02                2725
function.svn-fs-apply-text.php                     24-May-2024 14:02                2882
function.svn-fs-begin-txn2.php                     24-May-2024 14:02                2821
function.svn-fs-change-node-prop.php               24-May-2024 14:02                3363
function.svn-fs-check-path.php                     24-May-2024 14:02                2985
function.svn-fs-contents-changed.php               24-May-2024 14:02                3386
function.svn-fs-copy.php                           24-May-2024 14:02                3357
function.svn-fs-delete.php                         24-May-2024 14:02                2898
function.svn-fs-dir-entries.php                    24-May-2024 14:02                3000
function.svn-fs-file-contents.php                  24-May-2024 14:02                2993
function.svn-fs-file-length.php                    24-May-2024 14:02                2916
function.svn-fs-is-dir.php                         24-May-2024 14:02                2853
function.svn-fs-is-file.php                        24-May-2024 14:02                2848
function.svn-fs-make-dir.php                       24-May-2024 14:02                2920
function.svn-fs-make-file.php                      24-May-2024 14:02                2920
function.svn-fs-node-created-rev.php               24-May-2024 14:02                2943
function.svn-fs-node-prop.php                      24-May-2024 14:02                3021
function.svn-fs-props-changed.php                  24-May-2024 14:02                3385
function.svn-fs-revision-prop.php                  24-May-2024 14:02                3068
function.svn-fs-revision-root.php                  24-May-2024 14:02                2938
function.svn-fs-txn-root.php                       24-May-2024 14:02                2681
function.svn-fs-youngest-rev.php                   24-May-2024 14:02                2727
function.svn-import.php                            24-May-2024 14:02                6281
function.svn-log.php                               24-May-2024 14:02                9353
function.svn-ls.php                                24-May-2024 14:02                7443
function.svn-mkdir.php                             24-May-2024 14:02                3358
function.svn-repos-create.php                      24-May-2024 14:02                3101
function.svn-repos-fs-begin-txn-for-commit.php     24-May-2024 14:02                3407
function.svn-repos-fs-commit-txn.php               24-May-2024 14:02                2770
function.svn-repos-fs.php                          24-May-2024 14:02                2684
function.svn-repos-hotcopy.php                     24-May-2024 14:02                3075
function.svn-repos-open.php                        24-May-2024 14:02                2656
function.svn-repos-recover.php                     24-May-2024 14:02                2738
function.svn-revert.php                            24-May-2024 14:02                3619
function.svn-status.php                            24-May-2024 14:02               15353
function.svn-update.php                            24-May-2024 14:02                6327
function.swoole-async-dns-lookup.php               24-May-2024 14:02                3903
function.swoole-async-read.php                     24-May-2024 14:02                4511
function.swoole-async-readfile.php                 24-May-2024 14:02                3925
function.swoole-async-set.php                      24-May-2024 14:02                2463
function.swoole-async-write.php                    24-May-2024 14:02                3805
function.swoole-async-writefile.php                24-May-2024 14:02                3833
function.swoole-clear-error.php                    24-May-2024 14:02                2324
function.swoole-client-select.php                  24-May-2024 14:02                3543
function.swoole-cpu-num.php                        24-May-2024 14:02                2173
function.swoole-errno.php                          24-May-2024 14:02                2150
function.swoole-error-log.php                      24-May-2024 14:02                3614
function.swoole-event-add.php                      24-May-2024 14:02                3550
function.swoole-event-defer.php                    24-May-2024 14:02                2688
function.swoole-event-del.php                      24-May-2024 14:02                2654
function.swoole-event-exit.php                     24-May-2024 14:02                2216
function.swoole-event-set.php                      24-May-2024 14:02                3538
function.swoole-event-wait.php                     24-May-2024 14:02                2187
function.swoole-event-write.php                    24-May-2024 14:02                2926
function.swoole-get-local-ip.php                   24-May-2024 14:02                2244
function.swoole-last-error.php                     24-May-2024 14:02                2199
function.swoole-load-module.php                    24-May-2024 14:02                2357
function.swoole-select.php                         24-May-2024 14:02                3510
function.swoole-set-process-name.php               24-May-2024 14:02                2683
function.swoole-strerror.php                       24-May-2024 14:02                2637
function.swoole-timer-after.php                    24-May-2024 14:02                3061
function.swoole-timer-exists.php                   24-May-2024 14:02                2474
function.swoole-timer-tick.php                     24-May-2024 14:02                2938
function.swoole-version.php                        24-May-2024 14:02                2178
function.symlink.php                               24-May-2024 14:02                6021
function.sys-get-temp-dir.php                      24-May-2024 14:02                4034
function.sys-getloadavg.php                        24-May-2024 14:02                3841
function.syslog.php                                24-May-2024 14:02                9611
function.system.php                                24-May-2024 14:02                7939
function.taint.php                                 24-May-2024 14:02                2729
function.tan.php                                   24-May-2024 14:02                4338
function.tanh.php                                  24-May-2024 14:02                3254
function.tcpwrap-check.php                         24-May-2024 14:02                5985
function.tempnam.php                               24-May-2024 14:02                6538
function.textdomain.php                            24-May-2024 14:02                2883
function.tidy-access-count.php                     24-May-2024 14:02                6476
function.tidy-config-count.php                     24-May-2024 14:02                4381
function.tidy-error-count.php                      24-May-2024 14:02                5396
function.tidy-get-output.php                       24-May-2024 14:02                4362
function.tidy-warning-count.php                    24-May-2024 14:02                4953
function.time-nanosleep.php                        24-May-2024 14:02                8935
function.time-sleep-until.php                      24-May-2024 14:02                6481
function.time.php                                  24-May-2024 14:02                5543
function.timezone-abbreviations-list.php           24-May-2024 14:02                1951
function.timezone-identifiers-list.php             24-May-2024 14:02                1967
function.timezone-location-get.php                 24-May-2024 14:02                1923
function.timezone-name-from-abbr.php               24-May-2024 14:02                6269
function.timezone-name-get.php                     24-May-2024 14:02                1867
function.timezone-offset-get.php                   24-May-2024 14:02                1865
function.timezone-open.php                         24-May-2024 14:02                1855
function.timezone-transitions-get.php              24-May-2024 14:02                1926
function.timezone-version-get.php                  24-May-2024 14:02                3370
function.tmpfile.php                               24-May-2024 14:02                5293
function.token-get-all.php                         24-May-2024 14:02               14576
function.token-name.php                            24-May-2024 14:02                4223
function.touch.php                                 24-May-2024 14:02                7850
function.trader-acos.php                           24-May-2024 14:02                2549
function.trader-ad.php                             24-May-2024 14:02                3477
function.trader-add.php                            24-May-2024 14:02                2857
function.trader-adosc.php                          24-May-2024 14:02                4356
function.trader-adx.php                            24-May-2024 14:02                3567
function.trader-adxr.php                           24-May-2024 14:02                3585
function.trader-apo.php                            24-May-2024 14:02                3769
function.trader-aroon.php                          24-May-2024 14:02                3124
function.trader-aroonosc.php                       24-May-2024 14:02                3160
function.trader-asin.php                           24-May-2024 14:02                2555
function.trader-atan.php                           24-May-2024 14:02                2557
function.trader-atr.php                            24-May-2024 14:02                3555
function.trader-avgprice.php                       24-May-2024 14:02                3531
function.trader-bbands.php                         24-May-2024 14:02                4556
function.trader-beta.php                           24-May-2024 14:02                3089
function.trader-bop.php                            24-May-2024 14:02                3484
function.trader-cci.php                            24-May-2024 14:02                3563
function.trader-cdl2crows.php                      24-May-2024 14:02                3556
function.trader-cdl3blackcrows.php                 24-May-2024 14:02                3618
function.trader-cdl3inside.php                     24-May-2024 14:02                3616
function.trader-cdl3linestrike.php                 24-May-2024 14:02                3615
function.trader-cdl3outside.php                    24-May-2024 14:02                3630
function.trader-cdl3starsinsouth.php               24-May-2024 14:02                3661
function.trader-cdl3whitesoldiers.php              24-May-2024 14:02                3686
function.trader-cdlabandonedbaby.php               24-May-2024 14:02                4069
function.trader-cdladvanceblock.php                24-May-2024 14:02                3641
function.trader-cdlbelthold.php                    24-May-2024 14:02                3594
function.trader-cdlbreakaway.php                   24-May-2024 14:02                3605
function.trader-cdlclosingmarubozu.php             24-May-2024 14:02                3684
function.trader-cdlconcealbabyswall.php            24-May-2024 14:02                3708
function.trader-cdlcounterattack.php               24-May-2024 14:02                3665
function.trader-cdldarkcloudcover.php              24-May-2024 14:02                4068
function.trader-cdldoji.php                        24-May-2024 14:02                3551
function.trader-cdldojistar.php                    24-May-2024 14:02                3590
function.trader-cdldragonflydoji.php               24-May-2024 14:02                3641
function.trader-cdlengulfing.php                   24-May-2024 14:02                3627
function.trader-cdleveningdojistar.php             24-May-2024 14:02                4085
function.trader-cdleveningstar.php                 24-May-2024 14:02                4064
function.trader-cdlgapsidesidewhite.php            24-May-2024 14:02                3721
function.trader-cdlgravestonedoji.php              24-May-2024 14:02                3659
function.trader-cdlhammer.php                      24-May-2024 14:02                3579
function.trader-cdlhangingman.php                  24-May-2024 14:02                3601
function.trader-cdlharami.php                      24-May-2024 14:02                3579
function.trader-cdlharamicross.php                 24-May-2024 14:02                3620
function.trader-cdlhighwave.php                    24-May-2024 14:02                3596
function.trader-cdlhikkake.php                     24-May-2024 14:02                3584
function.trader-cdlhikkakemod.php                  24-May-2024 14:02                3627
function.trader-cdlhomingpigeon.php                24-May-2024 14:02                3649
function.trader-cdlidentical3crows.php             24-May-2024 14:02                3672
function.trader-cdlinneck.php                      24-May-2024 14:02                3612
function.trader-cdlinvertedhammer.php              24-May-2024 14:02                3648
function.trader-cdlkicking.php                     24-May-2024 14:02                3597
function.trader-cdlkickingbylength.php             24-May-2024 14:02                3708
function.trader-cdlladderbottom.php                24-May-2024 14:02                3658
function.trader-cdllongleggeddoji.php              24-May-2024 14:02                3655
function.trader-cdllongline.php                    24-May-2024 14:02                3607
function.trader-cdlmarubozu.php                    24-May-2024 14:02                3589
function.trader-cdlmatchinglow.php                 24-May-2024 14:02                3624
function.trader-cdlmathold.php                     24-May-2024 14:02                4001
function.trader-cdlmorningdojistar.php             24-May-2024 14:02                4077
function.trader-cdlmorningstar.php                 24-May-2024 14:02                4038
function.trader-cdlonneck.php                      24-May-2024 14:02                3584
function.trader-cdlpiercing.php                    24-May-2024 14:02                3595
function.trader-cdlrickshawman.php                 24-May-2024 14:02                3629
function.trader-cdlrisefall3methods.php            24-May-2024 14:02                3708
function.trader-cdlseparatinglines.php             24-May-2024 14:02                3685
function.trader-cdlshootingstar.php                24-May-2024 14:02                3645
function.trader-cdlshortline.php                   24-May-2024 14:02                3619
function.trader-cdlspinningtop.php                 24-May-2024 14:02                3625
function.trader-cdlstalledpattern.php              24-May-2024 14:02                3665
function.trader-cdlsticksandwich.php               24-May-2024 14:02                3642
function.trader-cdltakuri.php                      24-May-2024 14:02                3611
function.trader-cdltasukigap.php                   24-May-2024 14:02                3595
function.trader-cdlthrusting.php                   24-May-2024 14:02                3602
function.trader-cdltristar.php                     24-May-2024 14:02                3600
function.trader-cdlunique3river.php                24-May-2024 14:02                3645
function.trader-cdlupsidegap2crows.php             24-May-2024 14:02                3702
function.trader-cdlxsidegap3methods.php            24-May-2024 14:02                3691
function.trader-ceil.php                           24-May-2024 14:02                2585
function.trader-cmo.php                            24-May-2024 14:02                2803
function.trader-correl.php                         24-May-2024 14:02                3141
function.trader-cos.php                            24-May-2024 14:02                2541
function.trader-cosh.php                           24-May-2024 14:02                2556
function.trader-dema.php                           24-May-2024 14:02                2807
function.trader-div.php                            24-May-2024 14:02                2885
function.trader-dx.php                             24-May-2024 14:02                3545
function.trader-ema.php                            24-May-2024 14:02                2791
function.trader-errno.php                          24-May-2024 14:02                2284
function.trader-exp.php                            24-May-2024 14:02                2588
function.trader-floor.php                          24-May-2024 14:02                2570
function.trader-get-compat.php                     24-May-2024 14:02                2489
function.trader-get-unstable-period.php            24-May-2024 14:02                2773
function.trader-ht-dcperiod.php                    24-May-2024 14:02                2568
function.trader-ht-dcphase.php                     24-May-2024 14:02                2536
function.trader-ht-phasor.php                      24-May-2024 14:02                2520
function.trader-ht-sine.php                        24-May-2024 14:02                2494
function.trader-ht-trendline.php                   24-May-2024 14:02                2563
function.trader-ht-trendmode.php                   24-May-2024 14:02                2551
function.trader-kama.php                           24-May-2024 14:02                2851
function.trader-linearreg-angle.php                24-May-2024 14:02                2947
function.trader-linearreg-intercept.php            24-May-2024 14:02                3007
function.trader-linearreg-slope.php                24-May-2024 14:02                2959
function.trader-linearreg.php                      24-May-2024 14:02                2864
function.trader-ln.php                             24-May-2024 14:02                2545
function.trader-log10.php                          24-May-2024 14:02                2561
function.trader-ma.php                             24-May-2024 14:02                3215
function.trader-macd.php                           24-May-2024 14:02                3766
function.trader-macdext.php                        24-May-2024 14:02                5275
function.trader-macdfix.php                        24-May-2024 14:02                2904
function.trader-mama.php                           24-May-2024 14:02                3254
function.trader-mavp.php                           24-May-2024 14:02                4155
function.trader-max.php                            24-May-2024 14:02                2818
function.trader-maxindex.php                       24-May-2024 14:02                2878
function.trader-medprice.php                       24-May-2024 14:02                2782
function.trader-mfi.php                            24-May-2024 14:02                3919
function.trader-midpoint.php                       24-May-2024 14:02                2853
function.trader-midprice.php                       24-May-2024 14:02                3187
function.trader-min.php                            24-May-2024 14:02                2830
function.trader-minindex.php                       24-May-2024 14:02                2878
function.trader-minmax.php                         24-May-2024 14:02                2877
function.trader-minmaxindex.php                    24-May-2024 14:02                2933
function.trader-minus-di.php                       24-May-2024 14:02                3625
function.trader-minus-dm.php                       24-May-2024 14:02                3177
function.trader-mom.php                            24-May-2024 14:02                2785
function.trader-mult.php                           24-May-2024 14:02                2897
function.trader-natr.php                           24-May-2024 14:02                3573
function.trader-obv.php                            24-May-2024 14:02                2741
function.trader-plus-di.php                        24-May-2024 14:02                3596
function.trader-plus-dm.php                        24-May-2024 14:02                3164
function.trader-ppo.php                            24-May-2024 14:02                3773
function.trader-roc.php                            24-May-2024 14:02                2816
function.trader-rocp.php                           24-May-2024 14:02                2852
function.trader-rocr.php                           24-May-2024 14:02                2833
function.trader-rocr100.php                        24-May-2024 14:02                2877
function.trader-rsi.php                            24-May-2024 14:02                2793
function.trader-sar.php                            24-May-2024 14:02                3819
function.trader-sarext.php                         24-May-2024 14:02                7313
function.trader-set-compat.php                     24-May-2024 14:02                2729
function.trader-set-unstable-period.php            24-May-2024 14:02                3321
function.trader-sin.php                            24-May-2024 14:02                2563
function.trader-sinh.php                           24-May-2024 14:02                2549
function.trader-sma.php                            24-May-2024 14:02                2788
function.trader-sqrt.php                           24-May-2024 14:02                2547
function.trader-stddev.php                         24-May-2024 14:02                3137
function.trader-stoch.php                          24-May-2024 14:02                5514
function.trader-stochf.php                         24-May-2024 14:02                4602
function.trader-stochrsi.php                       24-May-2024 14:02                4341
function.trader-sub.php                            24-May-2024 14:02                2894
function.trader-sum.php                            24-May-2024 14:02                2772
function.trader-t3.php                             24-May-2024 14:02                3159
function.trader-tan.php                            24-May-2024 14:02                2537
function.trader-tanh.php                           24-May-2024 14:02                2575
function.trader-tema.php                           24-May-2024 14:02                2814
function.trader-trange.php                         24-May-2024 14:02                3081
function.trader-trima.php                          24-May-2024 14:02                2816
function.trader-trix.php                           24-May-2024 14:02                2834
function.trader-tsf.php                            24-May-2024 14:02                2807
function.trader-typprice.php                       24-May-2024 14:02                3100
function.trader-ultosc.php                         24-May-2024 14:02                4450
function.trader-var.php                            24-May-2024 14:02                3104
function.trader-wclprice.php                       24-May-2024 14:02                3110
function.trader-willr.php                          24-May-2024 14:02                3566
function.trader-wma.php                            24-May-2024 14:02                2810
function.trait-exists.php                          24-May-2024 14:02                3092
function.trigger-error.php                         24-May-2024 14:02                6719
function.trim.php                                  24-May-2024 14:02               13724
function.uasort.php                                24-May-2024 14:02                8340
function.ucfirst.php                               24-May-2024 14:02                5476
function.ucwords.php                               24-May-2024 14:02                8211
function.ui-draw-text-font-fontfamilies.php        24-May-2024 14:02                2142
function.ui-quit.php                               24-May-2024 14:02                2083
function.ui-run.php                                24-May-2024 14:02                2463
function.uksort.php                                24-May-2024 14:02                8402
function.umask.php                                 24-May-2024 14:02                5167
function.uniqid.php                                24-May-2024 14:02                7239
function.unixtojd.php                              24-May-2024 14:02                3022
function.unlink.php                                24-May-2024 14:02                5143
function.unpack.php                                24-May-2024 14:02                9388
function.unregister-tick-function.php              24-May-2024 14:02                3289
function.unserialize.php                           24-May-2024 14:02               16694
function.unset.php                                 24-May-2024 14:02               14730
function.untaint.php                               24-May-2024 14:02                2565
function.uopz-add-function.php                     24-May-2024 14:02                7185
function.uopz-allow-exit.php                       24-May-2024 14:02                4669
function.uopz-backup.php                           24-May-2024 14:02                4623
function.uopz-compose.php                          24-May-2024 14:02                6895
function.uopz-copy.php                             24-May-2024 14:02                5210
function.uopz-del-function.php                     24-May-2024 14:02                6622
function.uopz-delete.php                           24-May-2024 14:02                6025
function.uopz-extend.php                           24-May-2024 14:02                5074
function.uopz-flags.php                            24-May-2024 14:02               11007
function.uopz-function.php                         24-May-2024 14:02                7363
function.uopz-get-exit-status.php                  24-May-2024 14:02                4221
function.uopz-get-hook.php                         24-May-2024 14:02                5375
function.uopz-get-mock.php                         24-May-2024 14:02                4996
function.uopz-get-property.php                     24-May-2024 14:02                6238
function.uopz-get-return.php                       24-May-2024 14:02                4483
function.uopz-get-static.php                       24-May-2024 14:02                5196
function.uopz-implement.php                        24-May-2024 14:02                5099
function.uopz-overload.php                         24-May-2024 14:02                3976
function.uopz-redefine.php                         24-May-2024 14:02                5181
function.uopz-rename.php                           24-May-2024 14:02                6816
function.uopz-restore.php                          24-May-2024 14:02                4987
function.uopz-set-hook.php                         24-May-2024 14:02                5703
function.uopz-set-mock.php                         24-May-2024 14:02               10856
function.uopz-set-property.php                     24-May-2024 14:02                7544
function.uopz-set-return.php                       24-May-2024 14:02                9677
function.uopz-set-static.php                       24-May-2024 14:02                5797
function.uopz-undefine.php                         24-May-2024 14:02                4739
function.uopz-unset-hook.php                       24-May-2024 14:02                5594
function.uopz-unset-mock.php                       24-May-2024 14:02                5359
function.uopz-unset-return.php                     24-May-2024 14:02                4959
function.urldecode.php                             24-May-2024 14:02                6410
function.urlencode.php                             24-May-2024 14:02                9968
function.use-soap-error-handler.php                24-May-2024 14:02                4148
function.user-error.php                            24-May-2024 14:02                1747
function.usleep.php                                24-May-2024 14:02                5113
function.usort.php                                 24-May-2024 14:02               21121
function.utf8-decode.php                           24-May-2024 14:02                8696
function.utf8-encode.php                           24-May-2024 14:02                7562
function.var-dump.php                              24-May-2024 14:02                6706
function.var-export.php                            24-May-2024 14:02               14359
function.var-representation.php                    24-May-2024 14:02               13374
function.variant-abs.php                           24-May-2024 14:02                4326
function.variant-add.php                           24-May-2024 14:02                5654
function.variant-and.php                           24-May-2024 14:02                7746
function.variant-cast.php                          24-May-2024 14:02                3570
function.variant-cat.php                           24-May-2024 14:02                4877
function.variant-cmp.php                           24-May-2024 14:02                8155
function.variant-date-from-timestamp.php           24-May-2024 14:02                3700
function.variant-date-to-timestamp.php             24-May-2024 14:02                3839
function.variant-div.php                           24-May-2024 14:02                6565
function.variant-eqv.php                           24-May-2024 14:02                4593
function.variant-fix.php                           24-May-2024 14:02                5672
function.variant-get-type.php                      24-May-2024 14:02                3560
function.variant-idiv.php                          24-May-2024 14:02                5931
function.variant-imp.php                           24-May-2024 14:02                7294
function.variant-int.php                           24-May-2024 14:02                5166
function.variant-mod.php                           24-May-2024 14:02                4934
function.variant-mul.php                           24-May-2024 14:02                6046
function.variant-neg.php                           24-May-2024 14:02                3995
function.variant-not.php                           24-May-2024 14:02                4261
function.variant-or.php                            24-May-2024 14:02                7902
function.variant-pow.php                           24-May-2024 14:02                4785
function.variant-round.php                         24-May-2024 14:02                4660
function.variant-set-type.php                      24-May-2024 14:02                3704
function.variant-set.php                           24-May-2024 14:02                2934
function.variant-sub.php                           24-May-2024 14:02                5616
function.variant-xor.php                           24-May-2024 14:02                6641
function.version-compare.php                       24-May-2024 14:02               11664
function.vfprintf.php                              24-May-2024 14:02                6235
function.virtual.php                               24-May-2024 14:02                5549
function.vprintf.php                               24-May-2024 14:02                4917
function.vsprintf.php                              24-May-2024 14:02                4774
function.wddx-add-vars.php                         24-May-2024 14:02                3815
function.wddx-deserialize.php                      24-May-2024 14:02                3574
function.wddx-packet-end.php                       24-May-2024 14:02                2884
function.wddx-packet-start.php                     24-May-2024 14:02                3063
function.wddx-serialize-value.php                  24-May-2024 14:02                3293
function.wddx-serialize-vars.php                   24-May-2024 14:02                6021
function.win32-continue-service.php                24-May-2024 14:02                6782
function.win32-create-service.php                  24-May-2024 14:02               28871
function.win32-delete-service.php                  24-May-2024 14:02                7241
function.win32-get-last-control-message.php        24-May-2024 14:02                8605
function.win32-pause-service.php                   24-May-2024 14:02                6780
function.win32-query-service-status.php            24-May-2024 14:02                8854
function.win32-send-custom-control.php             24-May-2024 14:02                7444
function.win32-set-service-exit-code.php           24-May-2024 14:02                5930
function.win32-set-service-exit-mode.php           24-May-2024 14:02                6078
function.win32-set-service-status.php              24-May-2024 14:02                9386
function.win32-start-service-ctrl-dispatcher.php   24-May-2024 14:02               11420
function.win32-start-service.php                   24-May-2024 14:02                6784
function.win32-stop-service.php                    24-May-2024 14:02                6715
function.wincache-fcache-fileinfo.php              24-May-2024 14:02                9426
function.wincache-fcache-meminfo.php               24-May-2024 14:02                7353
function.wincache-lock.php                         24-May-2024 14:02                8852
function.wincache-ocache-fileinfo.php              24-May-2024 14:02               10134
function.wincache-ocache-meminfo.php               24-May-2024 14:02                7440
function.wincache-refresh-if-changed.php           24-May-2024 14:02                7962
function.wincache-rplist-fileinfo.php              24-May-2024 14:02                7806
function.wincache-rplist-meminfo.php               24-May-2024 14:02                7361
function.wincache-scache-info.php                  24-May-2024 14:02                9734
function.wincache-scache-meminfo.php               24-May-2024 14:02                6882
function.wincache-ucache-add.php                   24-May-2024 14:02               13763
function.wincache-ucache-cas.php                   24-May-2024 14:02                6698
function.wincache-ucache-clear.php                 24-May-2024 14:02                7770
function.wincache-ucache-dec.php                   24-May-2024 14:02                6546
function.wincache-ucache-delete.php                24-May-2024 14:02               11657
function.wincache-ucache-exists.php                24-May-2024 14:02                6405
function.wincache-ucache-get.php                   24-May-2024 14:02               10949
function.wincache-ucache-inc.php                   24-May-2024 14:02                6520
function.wincache-ucache-info.php                  24-May-2024 14:02               11771
function.wincache-ucache-meminfo.php               24-May-2024 14:02                7124
function.wincache-ucache-set.php                   24-May-2024 14:02               13829
function.wincache-unlock.php                       24-May-2024 14:02                8043
function.wordwrap.php                              24-May-2024 14:02                9402
function.xattr-get.php                             24-May-2024 14:02                6263
function.xattr-list.php                            24-May-2024 14:02                6746
function.xattr-remove.php                          24-May-2024 14:02                6513
function.xattr-set.php                             24-May-2024 14:02                8246
function.xattr-supported.php                       24-May-2024 14:02                5475
function.xdiff-file-bdiff-size.php                 24-May-2024 14:02                5026
function.xdiff-file-bdiff.php                      24-May-2024 14:02                6185
function.xdiff-file-bpatch.php                     24-May-2024 14:02                6721
function.xdiff-file-diff-binary.php                24-May-2024 14:02                6598
function.xdiff-file-diff.php                       24-May-2024 14:02                7588
function.xdiff-file-merge3.php                     24-May-2024 14:02                6935
function.xdiff-file-patch-binary.php               24-May-2024 14:02                6797
function.xdiff-file-patch.php                      24-May-2024 14:02                9092
function.xdiff-file-rabdiff.php                    24-May-2024 14:02                6812
function.xdiff-string-bdiff-size.php               24-May-2024 14:02                5321
function.xdiff-string-bdiff.php                    24-May-2024 14:02                4043
function.xdiff-string-bpatch.php                   24-May-2024 14:02                4102
function.xdiff-string-diff-binary.php              24-May-2024 14:02                4502
function.xdiff-string-diff.php                     24-May-2024 14:02                7818
function.xdiff-string-merge3.php                   24-May-2024 14:02                4999
function.xdiff-string-patch-binary.php             24-May-2024 14:02                4633
function.xdiff-string-patch.php                    24-May-2024 14:02                8515
function.xdiff-string-rabdiff.php                  24-May-2024 14:02                4752
function.xhprof-disable.php                        24-May-2024 14:02                4057
function.xhprof-enable.php                         24-May-2024 14:02                7261
function.xhprof-sample-disable.php                 24-May-2024 14:02                4745
function.xhprof-sample-enable.php                  24-May-2024 14:02                3637
function.xml-error-string.php                      24-May-2024 14:02                3408
function.xml-get-current-byte-index.php            24-May-2024 14:02                4170
function.xml-get-current-column-number.php         24-May-2024 14:02                4661
function.xml-get-current-line-number.php           24-May-2024 14:02                4459
function.xml-get-error-code.php                    24-May-2024 14:02                4087
function.xml-parse-into-struct.php                 24-May-2024 14:02               19058
function.xml-parse.php                             24-May-2024 14:02                5001
function.xml-parser-create-ns.php                  24-May-2024 14:02                4850
function.xml-parser-create.php                     24-May-2024 14:02                4185
function.xml-parser-free.php                       24-May-2024 14:02                2893
function.xml-parser-get-option.php                 24-May-2024 14:02                3849
function.xml-parser-set-option.php                 24-May-2024 14:02                6744
function.xml-set-character-data-handler.php        24-May-2024 14:02                6303
function.xml-set-default-handler.php               24-May-2024 14:02                6125
function.xml-set-element-handler.php               24-May-2024 14:02                8343
function.xml-set-end-namespace-decl-handler.php    24-May-2024 14:02                7487
function.xml-set-external-entity-ref-handler.php   24-May-2024 14:02                7966
function.xml-set-notation-decl-handler.php         24-May-2024 14:02                8268
function.xml-set-object.php                        24-May-2024 14:02               10011
function.xml-set-processing-instruction-handler..> 24-May-2024 14:02                7374
function.xml-set-start-namespace-decl-handler.php  24-May-2024 14:02                7820
function.xml-set-unparsed-entity-decl-handler.php  24-May-2024 14:02                8901
function.xmlrpc-decode-request.php                 24-May-2024 14:02                2881
function.xmlrpc-decode.php                         24-May-2024 14:02                4195
function.xmlrpc-encode-request.php                 24-May-2024 14:02                8666
function.xmlrpc-encode.php                         24-May-2024 14:02                2445
function.xmlrpc-get-type.php                       24-May-2024 14:02                6399
function.xmlrpc-is-fault.php                       24-May-2024 14:02                4017
function.xmlrpc-parse-method-descriptions.php      24-May-2024 14:02                2660
function.xmlrpc-server-add-introspection-data.php  24-May-2024 14:02                2848
function.xmlrpc-server-call-method.php             24-May-2024 14:02                3278
function.xmlrpc-server-create.php                  24-May-2024 14:02                2362
function.xmlrpc-server-destroy.php                 24-May-2024 14:02                2580
function.xmlrpc-server-register-introspection-c..> 24-May-2024 14:02                2932
function.xmlrpc-server-register-method.php         24-May-2024 14:02                3021
function.xmlrpc-set-type.php                       24-May-2024 14:02                5570
function.yaml-emit-file.php                        24-May-2024 14:02                6931
function.yaml-emit.php                             24-May-2024 14:02               12521
function.yaml-parse-file.php                       24-May-2024 14:02                6344
function.yaml-parse-url.php                        24-May-2024 14:02                5947
function.yaml-parse.php                            24-May-2024 14:02               10219
function.yaz-addinfo.php                           24-May-2024 14:02                3518
function.yaz-ccl-conf.php                          24-May-2024 14:02                5903
function.yaz-ccl-parse.php                         24-May-2024 14:02                6949
function.yaz-close.php                             24-May-2024 14:02                3616
function.yaz-connect.php                           24-May-2024 14:02                9545
function.yaz-database.php                          24-May-2024 14:02                3561
function.yaz-element.php                           24-May-2024 14:02                3995
function.yaz-errno.php                             24-May-2024 14:02                3791
function.yaz-error.php                             24-May-2024 14:02                3511
function.yaz-es-result.php                         24-May-2024 14:02                3403
function.yaz-es.php                                24-May-2024 14:02                7381
function.yaz-get-option.php                        24-May-2024 14:02                3480
function.yaz-hits.php                              24-May-2024 14:02                5158
function.yaz-itemorder.php                         24-May-2024 14:02                7210
function.yaz-present.php                           24-May-2024 14:02                3097
function.yaz-range.php                             24-May-2024 14:02                3681
function.yaz-record.php                            24-May-2024 14:02               14772
function.yaz-scan-result.php                       24-May-2024 14:02                4163
function.yaz-scan.php                              24-May-2024 14:02                9562
function.yaz-schema.php                            24-May-2024 14:02                3552
function.yaz-search.php                            24-May-2024 14:02                9111
function.yaz-set-option.php                        24-May-2024 14:02                7274
function.yaz-sort.php                              24-May-2024 14:02                5957
function.yaz-syntax.php                            24-May-2024 14:02                3504
function.yaz-wait.php                              24-May-2024 14:02                4276
function.zend-thread-id.php                        24-May-2024 14:02                3589
function.zend-version.php                          24-May-2024 14:02                3893
function.zip-close.php                             24-May-2024 14:02                3073
function.zip-entry-close.php                       24-May-2024 14:02                3470
function.zip-entry-compressedsize.php              24-May-2024 14:02                3363
function.zip-entry-compressionmethod.php           24-May-2024 14:02                3464
function.zip-entry-filesize.php                    24-May-2024 14:02                3319
function.zip-entry-name.php                        24-May-2024 14:02                3252
function.zip-entry-open.php                        24-May-2024 14:02                5189
function.zip-entry-read.php                        24-May-2024 14:02                4154
function.zip-open.php                              24-May-2024 14:02                3333
function.zip-read.php                              24-May-2024 14:02                3713
function.zlib-decode.php                           24-May-2024 14:02                3528
function.zlib-encode.php                           24-May-2024 14:02                5459
function.zlib-get-coding-type.php                  24-May-2024 14:02                2968
function.zookeeper-dispatch.php                    24-May-2024 14:02                8359
functional.parallel.php                            24-May-2024 14:02                2613
functions.anonymous.php                            24-May-2024 14:02               23650
functions.arguments.php                            24-May-2024 14:02               56568
functions.arrow.php                                24-May-2024 14:02               10407
functions.first_class_callable_syntax.php          24-May-2024 14:02               11168
functions.internal.php                             24-May-2024 14:02                4989
functions.returning-values.php                     24-May-2024 14:02               13476
functions.user-defined.php                         24-May-2024 14:02                9430
functions.variable-functions.php                   24-May-2024 14:02               12288
gearman.configuration.php                          24-May-2024 14:02                1361
gearman.constants.php                              24-May-2024 14:02               24470
gearman.examples-reverse-bg.php                    24-May-2024 14:02               10923
gearman.examples-reverse-task.php                  24-May-2024 14:02               17474
gearman.examples-reverse.php                       24-May-2024 14:02               12784
gearman.examples.php                               24-May-2024 14:02                1626
gearman.installation.php                           24-May-2024 14:02                1710
gearman.requirements.php                           24-May-2024 14:02                1400
gearman.resources.php                              24-May-2024 14:02                1323
gearman.setup.php                                  24-May-2024 14:02                1710
gearmanclient.addoptions.php                       24-May-2024 14:02                2695
gearmanclient.addserver.php                        24-May-2024 14:02                5262
gearmanclient.addservers.php                       24-May-2024 14:02                4752
gearmanclient.addtask.php                          24-May-2024 14:02               14878
gearmanclient.addtaskbackground.php                24-May-2024 14:02               20821
gearmanclient.addtaskhigh.php                      24-May-2024 14:02               11412
gearmanclient.addtaskhighbackground.php            24-May-2024 14:02                6228
gearmanclient.addtasklow.php                       24-May-2024 14:02               11392
gearmanclient.addtasklowbackground.php             24-May-2024 14:02                6236
gearmanclient.addtaskstatus.php                    24-May-2024 14:02                9784
gearmanclient.clearcallbacks.php                   24-May-2024 14:02                4642
gearmanclient.clone.php                            24-May-2024 14:02                2698
gearmanclient.construct.php                        24-May-2024 14:02                2889
gearmanclient.context.php                          24-May-2024 14:02                3005
gearmanclient.data.php                             24-May-2024 14:02                3269
gearmanclient.do.php                               24-May-2024 14:02               22459
gearmanclient.dobackground.php                     24-May-2024 14:02                9654
gearmanclient.dohigh.php                           24-May-2024 14:02                5000
gearmanclient.dohighbackground.php                 24-May-2024 14:02                4899
gearmanclient.dojobhandle.php                      24-May-2024 14:02                3059
gearmanclient.dolow.php                            24-May-2024 14:02                4999
gearmanclient.dolowbackground.php                  24-May-2024 14:02                4882
gearmanclient.donormal.php                         24-May-2024 14:02               22992
gearmanclient.dostatus.php                         24-May-2024 14:02                8267
gearmanclient.echo.php                             24-May-2024 14:02                3032
gearmanclient.error.php                            24-May-2024 14:02                2669
gearmanclient.geterrno.php                         24-May-2024 14:02                2710
gearmanclient.jobstatus.php                        24-May-2024 14:02                8469
gearmanclient.ping.php                             24-May-2024 14:02                3055
gearmanclient.removeoptions.php                    24-May-2024 14:02                2720
gearmanclient.returncode.php                       24-May-2024 14:02                2382
gearmanclient.runtasks.php                         24-May-2024 14:02                3806
gearmanclient.setclientcallback.php                24-May-2024 14:02                5687
gearmanclient.setcompletecallback.php              24-May-2024 14:02                5079
gearmanclient.setcontext.php                       24-May-2024 14:02                3341
gearmanclient.setcreatedcallback.php               24-May-2024 14:02                5072
gearmanclient.setdata.php                          24-May-2024 14:02                3515
gearmanclient.setdatacallback.php                  24-May-2024 14:02                5045
gearmanclient.setexceptioncallback.php             24-May-2024 14:02                4966
gearmanclient.setfailcallback.php                  24-May-2024 14:02                5044
gearmanclient.setoptions.php                       24-May-2024 14:02                2733
gearmanclient.setstatuscallback.php                24-May-2024 14:02                5059
gearmanclient.settimeout.php                       24-May-2024 14:02                2861
gearmanclient.setwarningcallback.php               24-May-2024 14:02                5058
gearmanclient.setworkloadcallback.php              24-May-2024 14:02                5263
gearmanclient.timeout.php                          24-May-2024 14:02                2937
gearmanclient.wait.php                             24-May-2024 14:02                2856
gearmanjob.complete.php                            24-May-2024 14:02                3725
gearmanjob.construct.php                           24-May-2024 14:02                2400
gearmanjob.data.php                                24-May-2024 14:02                3657
gearmanjob.exception.php                           24-May-2024 14:02                3870
gearmanjob.fail.php                                24-May-2024 14:02                3834
gearmanjob.functionname.php                        24-May-2024 14:02                2766
gearmanjob.handle.php                              24-May-2024 14:02                2654
gearmanjob.returncode.php                          24-May-2024 14:02                2722
gearmanjob.sendcomplete.php                        24-May-2024 14:02                3418
gearmanjob.senddata.php                            24-May-2024 14:02                3383
gearmanjob.sendexception.php                       24-May-2024 14:02                3587
gearmanjob.sendfail.php                            24-May-2024 14:02                3518
gearmanjob.sendstatus.php                          24-May-2024 14:02                4172
gearmanjob.sendwarning.php                         24-May-2024 14:02                3614
gearmanjob.setreturn.php                           24-May-2024 14:02                2642
gearmanjob.status.php                              24-May-2024 14:02                4450
gearmanjob.unique.php                              24-May-2024 14:02                2876
gearmanjob.warning.php                             24-May-2024 14:02                3869
gearmanjob.workload.php                            24-May-2024 14:02                2901
gearmanjob.workloadsize.php                        24-May-2024 14:02                2711
gearmantask.construct.php                          24-May-2024 14:02                2412
gearmantask.create.php                             24-May-2024 14:02                2720
gearmantask.data.php                               24-May-2024 14:02                2772
gearmantask.datasize.php                           24-May-2024 14:02                2793
gearmantask.function.php                           24-May-2024 14:02                2730
gearmantask.functionname.php                       24-May-2024 14:02                2416
gearmantask.isknown.php                            24-May-2024 14:02                2526
gearmantask.isrunning.php                          24-May-2024 14:02                2513
gearmantask.jobhandle.php                          24-May-2024 14:02                2811
gearmantask.recvdata.php                           24-May-2024 14:02                3455
gearmantask.returncode.php                         24-May-2024 14:02                2743
gearmantask.senddata.php                           24-May-2024 14:02                3382
gearmantask.sendworkload.php                       24-May-2024 14:02                3417
gearmantask.taskdenominator.php                    24-May-2024 14:02                3016
gearmantask.tasknumerator.php                      24-May-2024 14:02                2980
gearmantask.unique.php                             24-May-2024 14:02                3208
gearmantask.uuid.php                               24-May-2024 14:02                3491
gearmanworker.addfunction.php                      24-May-2024 14:02                8097
gearmanworker.addoptions.php                       24-May-2024 14:02                3475
gearmanworker.addserver.php                        24-May-2024 14:02                4965
gearmanworker.addservers.php                       24-May-2024 14:02                4455
gearmanworker.clone.php                            24-May-2024 14:02                2360
gearmanworker.construct.php                        24-May-2024 14:02                2856
gearmanworker.echo.php                             24-May-2024 14:02                3172
gearmanworker.error.php                            24-May-2024 14:02                2676
gearmanworker.geterrno.php                         24-May-2024 14:02                2719
gearmanworker.options.php                          24-May-2024 14:02                2749
gearmanworker.register.php                         24-May-2024 14:02                3980
gearmanworker.removeoptions.php                    24-May-2024 14:02                3508
gearmanworker.returncode.php                       24-May-2024 14:02                2944
gearmanworker.setid.php                            24-May-2024 14:02                4198
gearmanworker.setoptions.php                       24-May-2024 14:02                3668
gearmanworker.settimeout.php                       24-May-2024 14:02                8104
gearmanworker.timeout.php                          24-May-2024 14:02                2911
gearmanworker.unregister.php                       24-May-2024 14:02                3509
gearmanworker.unregisterall.php                    24-May-2024 14:02                3158
gearmanworker.wait.php                             24-May-2024 14:02                8022
gearmanworker.work.php                             24-May-2024 14:02                5631
gender-gender.connect.php                          24-May-2024 14:02                2660
gender-gender.construct.php                        24-May-2024 14:02                2653
gender-gender.country.php                          24-May-2024 14:02                3779
gender-gender.get.php                              24-May-2024 14:02                2949
gender-gender.isnick.php                           24-May-2024 14:02                3462
gender-gender.similarnames.php                     24-May-2024 14:02                3027
gender.example.admin.php                           24-May-2024 14:02                8184
gender.examples.php                                24-May-2024 14:02                1416
gender.installation.php                            24-May-2024 14:02                2089
gender.setup.php                                   24-May-2024 14:02                1463
generator.current.php                              24-May-2024 14:02                2148
generator.getreturn.php                            24-May-2024 14:02                3877
generator.key.php                                  24-May-2024 14:02                3944
generator.next.php                                 24-May-2024 14:02                2486
generator.rewind.php                               24-May-2024 14:02                2224
generator.send.php                                 24-May-2024 14:02                5513
generator.throw.php                                24-May-2024 14:02                5144
generator.valid.php                                24-May-2024 14:02                2357
generator.wakeup.php                               24-May-2024 14:02                2232
geoip.configuration.php                            24-May-2024 14:02                2604
geoip.constants.php                                24-May-2024 14:02                6346
geoip.installation.php                             24-May-2024 14:02                1840
geoip.requirements.php                             24-May-2024 14:02                1778
geoip.resources.php                                24-May-2024 14:02                1279
geoip.setup.php                                    24-May-2024 14:02                1670
gettext.configuration.php                          24-May-2024 14:02                1361
gettext.constants.php                              24-May-2024 14:02                1223
gettext.installation.php                           24-May-2024 14:02                1508
gettext.requirements.php                           24-May-2024 14:02                1451
gettext.resources.php                              24-May-2024 14:02                1293
gettext.setup.php                                  24-May-2024 14:02                1714
getting-started.php                                24-May-2024 14:02                2050
globiterator.construct.php                         24-May-2024 14:02                6451
globiterator.count.php                             24-May-2024 14:02                4539
gmagick.addimage.php                               24-May-2024 14:02                2952
gmagick.addnoiseimage.php                          24-May-2024 14:02                2959
gmagick.annotateimage.php                          24-May-2024 14:02                4348
gmagick.blurimage.php                              24-May-2024 14:02                3313
gmagick.borderimage.php                            24-May-2024 14:02                3560
gmagick.charcoalimage.php                          24-May-2024 14:02                3217
gmagick.chopimage.php                              24-May-2024 14:02                3876
gmagick.clear.php                                  24-May-2024 14:02                2492
gmagick.commentimage.php                           24-May-2024 14:02                2838
gmagick.compositeimage.php                         24-May-2024 14:02                3953
gmagick.configuration.php                          24-May-2024 14:02                1367
gmagick.constants.php                              24-May-2024 14:02              103529
gmagick.construct.php                              24-May-2024 14:02                2795
gmagick.cropimage.php                              24-May-2024 14:02                4019
gmagick.cropthumbnailimage.php                     24-May-2024 14:02                3273
gmagick.current.php                                24-May-2024 14:02                2599
gmagick.cyclecolormapimage.php                     24-May-2024 14:02                3083
gmagick.deconstructimages.php                      24-May-2024 14:02                2852
gmagick.despeckleimage.php                         24-May-2024 14:02                3721
gmagick.destroy.php                                24-May-2024 14:02                2521
gmagick.drawimage.php                              24-May-2024 14:02                2866
gmagick.edgeimage.php                              24-May-2024 14:02                2926
gmagick.embossimage.php                            24-May-2024 14:02                3454
gmagick.enhanceimage.php                           24-May-2024 14:02                2393
gmagick.equalizeimage.php                          24-May-2024 14:02                2357
gmagick.examples.php                               24-May-2024 14:02                3514
gmagick.flipimage.php                              24-May-2024 14:02                2360
gmagick.flopimage.php                              24-May-2024 14:02                2359
gmagick.frameimage.php                             24-May-2024 14:02                4489
gmagick.gammaimage.php                             24-May-2024 14:02                3173
gmagick.getcopyright.php                           24-May-2024 14:02                2500
gmagick.getfilename.php                            24-May-2024 14:02                2437
gmagick.getimagebackgroundcolor.php                24-May-2024 14:02                2741
gmagick.getimageblueprimary.php                    24-May-2024 14:02                3071
gmagick.getimagebordercolor.php                    24-May-2024 14:02                2695
gmagick.getimagechanneldepth.php                   24-May-2024 14:02                2875
gmagick.getimagecolors.php                         24-May-2024 14:02                2655
gmagick.getimagecolorspace.php                     24-May-2024 14:02                2631
gmagick.getimagecompose.php                        24-May-2024 14:02                2670
gmagick.getimagedelay.php                          24-May-2024 14:02                2588
gmagick.getimagedepth.php                          24-May-2024 14:02                2567
gmagick.getimagedispose.php                        24-May-2024 14:02                2635
gmagick.getimageextrema.php                        24-May-2024 14:02                2805
gmagick.getimagefilename.php                       24-May-2024 14:02                2716
gmagick.getimageformat.php                         24-May-2024 14:02                2690
gmagick.getimagegamma.php                          24-May-2024 14:02                2607
gmagick.getimagegreenprimary.php                   24-May-2024 14:02                2799
gmagick.getimageheight.php                         24-May-2024 14:02                2600
gmagick.getimagehistogram.php                      24-May-2024 14:02                2775
gmagick.getimageindex.php                          24-May-2024 14:02                2651
gmagick.getimageinterlacescheme.php                24-May-2024 14:02                2764
gmagick.getimageiterations.php                     24-May-2024 14:02                2669
gmagick.getimagematte.php                          24-May-2024 14:02                2986
gmagick.getimagemattecolor.php                     24-May-2024 14:02                2724
gmagick.getimageprofile.php                        24-May-2024 14:02                2814
gmagick.getimageredprimary.php                     24-May-2024 14:02                2822
gmagick.getimagerenderingintent.php                24-May-2024 14:02                2766
gmagick.getimageresolution.php                     24-May-2024 14:02                2665
gmagick.getimagescene.php                          24-May-2024 14:02                2578
gmagick.getimagesignature.php                      24-May-2024 14:02                2687
gmagick.getimagetype.php                           24-May-2024 14:02                2575
gmagick.getimageunits.php                          24-May-2024 14:02                2346
gmagick.getimagewhitepoint.php                     24-May-2024 14:02                2786
gmagick.getimagewidth.php                          24-May-2024 14:02                2563
gmagick.getpackagename.php                         24-May-2024 14:02                2641
gmagick.getquantumdepth.php                        24-May-2024 14:02                2682
gmagick.getreleasedate.php                         24-May-2024 14:02                2694
gmagick.getsamplingfactors.php                     24-May-2024 14:02                2702
gmagick.getsize.php                                24-May-2024 14:02                2735
gmagick.getversion.php                             24-May-2024 14:02                2619
gmagick.hasnextimage.php                           24-May-2024 14:02                2742
gmagick.haspreviousimage.php                       24-May-2024 14:02                2774
gmagick.implodeimage.php                           24-May-2024 14:02                2967
gmagick.installation.php                           24-May-2024 14:02                2079
gmagick.labelimage.php                             24-May-2024 14:02                2806
gmagick.levelimage.php                             24-May-2024 14:02                4815
gmagick.magnifyimage.php                           24-May-2024 14:02                2583
gmagick.mapimage.php                               24-May-2024 14:02                3269
gmagick.medianfilterimage.php                      24-May-2024 14:02                3065
gmagick.minifyimage.php                            24-May-2024 14:02                2635
gmagick.modulateimage.php                          24-May-2024 14:02                3934
gmagick.motionblurimage.php                        24-May-2024 14:02                3888
gmagick.newimage.php                               24-May-2024 14:02                3925
gmagick.nextimage.php                              24-May-2024 14:02                2742
gmagick.normalizeimage.php                         24-May-2024 14:02                3014
gmagick.oilpaintimage.php                          24-May-2024 14:02                3098
gmagick.previousimage.php                          24-May-2024 14:02                2797
gmagick.profileimage.php                           24-May-2024 14:02                3398
gmagick.quantizeimage.php                          24-May-2024 14:02                5660
gmagick.quantizeimages.php                         24-May-2024 14:02                5681
gmagick.queryfontmetrics.php                       24-May-2024 14:02                3001
gmagick.queryfonts.php                             24-May-2024 14:02                2760
gmagick.queryformats.php                           24-May-2024 14:02                3026
gmagick.radialblurimage.php                        24-May-2024 14:02                3260
gmagick.raiseimage.php                             24-May-2024 14:02                4418
gmagick.read.php                                   24-May-2024 14:02                2775
gmagick.readimage.php                              24-May-2024 14:02                2826
gmagick.readimageblob.php                          24-May-2024 14:02                3243
gmagick.readimagefile.php                          24-May-2024 14:02                3133
gmagick.reducenoiseimage.php                       24-May-2024 14:02                3213
gmagick.removeimage.php                            24-May-2024 14:02                2576
gmagick.removeimageprofile.php                     24-May-2024 14:02                2983
gmagick.requirements.php                           24-May-2024 14:02                1807
gmagick.resampleimage.php                          24-May-2024 14:02                4036
gmagick.resizeimage.php                            24-May-2024 14:02                4190
gmagick.rollimage.php                              24-May-2024 14:02                3075
gmagick.rotateimage.php                            24-May-2024 14:02                3263
gmagick.scaleimage.php                             24-May-2024 14:02                3471
gmagick.separateimagechannel.php                   24-May-2024 14:02                3180
gmagick.setcompressionquality.php                  24-May-2024 14:02                4203
gmagick.setfilename.php                            24-May-2024 14:02                2961
gmagick.setimagebackgroundcolor.php                24-May-2024 14:02                3011
gmagick.setimageblueprimary.php                    24-May-2024 14:02                3311
gmagick.setimagebordercolor.php                    24-May-2024 14:02                2977
gmagick.setimagechanneldepth.php                   24-May-2024 14:02                3458
gmagick.setimagecolorspace.php                     24-May-2024 14:02                3252
gmagick.setimagecompose.php                        24-May-2024 14:02                2942
gmagick.setimagedelay.php                          24-May-2024 14:02                2880
gmagick.setimagedepth.php                          24-May-2024 14:02                2899
gmagick.setimagedispose.php                        24-May-2024 14:02                2939
gmagick.setimagefilename.php                       24-May-2024 14:02                2996
gmagick.setimageformat.php                         24-May-2024 14:02                2933
gmagick.setimagegamma.php                          24-May-2024 14:02                2882
gmagick.setimagegreenprimary.php                   24-May-2024 14:02                3332
gmagick.setimageindex.php                          24-May-2024 14:02                3012
gmagick.setimageinterlacescheme.php                24-May-2024 14:02                3109
gmagick.setimageiterations.php                     24-May-2024 14:02                2975
gmagick.setimageprofile.php                        24-May-2024 14:02                3440
gmagick.setimageredprimary.php                     24-May-2024 14:02                3292
gmagick.setimagerenderingintent.php                24-May-2024 14:02                3149
gmagick.setimageresolution.php                     24-May-2024 14:02                3284
gmagick.setimagescene.php                          24-May-2024 14:02                2877
gmagick.setimagetype.php                           24-May-2024 14:02                3042
gmagick.setimageunits.php                          24-May-2024 14:02                3008
gmagick.setimagewhitepoint.php                     24-May-2024 14:02                3244
gmagick.setsamplingfactors.php                     24-May-2024 14:02                3043
gmagick.setsize.php                                24-May-2024 14:02                3188
gmagick.setup.php                                  24-May-2024 14:02                1634
gmagick.shearimage.php                             24-May-2024 14:02                4008
gmagick.solarizeimage.php                          24-May-2024 14:02                3143
gmagick.spreadimage.php                            24-May-2024 14:02                2976
gmagick.stripimage.php                             24-May-2024 14:02                2560
gmagick.swirlimage.php                             24-May-2024 14:02                3056
gmagick.thumbnailimage.php                         24-May-2024 14:02                3874
gmagick.trimimage.php                              24-May-2024 14:02                3171
gmagick.write.php                                  24-May-2024 14:02                1753
gmagick.writeimage.php                             24-May-2024 14:02                3193
gmagickdraw.annotate.php                           24-May-2024 14:02                3192
gmagickdraw.arc.php                                24-May-2024 14:02                4369
gmagickdraw.bezier.php                             24-May-2024 14:02                2622
gmagickdraw.ellipse.php                            24-May-2024 14:02                4255
gmagickdraw.getfillcolor.php                       24-May-2024 14:02                2500
gmagickdraw.getfillopacity.php                     24-May-2024 14:02                2477
gmagickdraw.getfont.php                            24-May-2024 14:02                2480
gmagickdraw.getfontsize.php                        24-May-2024 14:02                2420
gmagickdraw.getfontstyle.php                       24-May-2024 14:02                2461
gmagickdraw.getfontweight.php                      24-May-2024 14:02                2432
gmagickdraw.getstrokecolor.php                     24-May-2024 14:02                2551
gmagickdraw.getstrokeopacity.php                   24-May-2024 14:02                2478
gmagickdraw.getstrokewidth.php                     24-May-2024 14:02                2495
gmagickdraw.gettextdecoration.php                  24-May-2024 14:02                2481
gmagickdraw.gettextencoding.php                    24-May-2024 14:02                2639
gmagickdraw.line.php                               24-May-2024 14:02                3659
gmagickdraw.point.php                              24-May-2024 14:02                2921
gmagickdraw.polygon.php                            24-May-2024 14:02                2703
gmagickdraw.polyline.php                           24-May-2024 14:02                2735
gmagickdraw.rectangle.php                          24-May-2024 14:02                3697
gmagickdraw.rotate.php                             24-May-2024 14:02                2663
gmagickdraw.roundrectangle.php                     24-May-2024 14:02                4502
gmagickdraw.scale.php                              24-May-2024 14:02                2963
gmagickdraw.setfillcolor.php                       24-May-2024 14:02                3039
gmagickdraw.setfillopacity.php                     24-May-2024 14:02                2809
gmagickdraw.setfont.php                            24-May-2024 14:02                2696
gmagickdraw.setfontsize.php                        24-May-2024 14:02                2730
gmagickdraw.setfontstyle.php                       24-May-2024 14:02                2853
gmagickdraw.setfontweight.php                      24-May-2024 14:02                2712
gmagickdraw.setstrokecolor.php                     24-May-2024 14:02                3059
gmagickdraw.setstrokeopacity.php                   24-May-2024 14:02                2810
gmagickdraw.setstrokewidth.php                     24-May-2024 14:02                2779
gmagickdraw.settextdecoration.php                  24-May-2024 14:02                2843
gmagickdraw.settextencoding.php                    24-May-2024 14:02                3156
gmagickpixel.construct.php                         24-May-2024 14:02                2727
gmagickpixel.getcolor.php                          24-May-2024 14:02                4187
gmagickpixel.getcolorcount.php                     24-May-2024 14:02                2517
gmagickpixel.getcolorvalue.php                     24-May-2024 14:02                2911
gmagickpixel.setcolor.php                          24-May-2024 14:02                2833
gmagickpixel.setcolorvalue.php                     24-May-2024 14:02                3231
gmp.configuration.php                              24-May-2024 14:02                1333
gmp.constants.php                                  24-May-2024 14:02                2658
gmp.examples.php                                   24-May-2024 14:02                3096
gmp.installation.php                               24-May-2024 14:02                1428
gmp.requirements.php                               24-May-2024 14:02                1740
gmp.resources.php                                  24-May-2024 14:02                1483
gmp.setup.php                                      24-May-2024 14:02                1667
gnupg.configuration.php                            24-May-2024 14:02                1345
gnupg.constants.php                                24-May-2024 14:02                9635
gnupg.examples-clearsign.php                       24-May-2024 14:02                6550
gnupg.examples.php                                 24-May-2024 14:02                1440
gnupg.installation.php                             24-May-2024 14:02                1691
gnupg.requirements.php                             24-May-2024 14:02                1492
gnupg.resources.php                                24-May-2024 14:02                1279
gnupg.setup.php                                    24-May-2024 14:02                1688
hash.configuration.php                             24-May-2024 14:02                1340
hash.constants.php                                 24-May-2024 14:02                1865
hash.installation.php                              24-May-2024 14:02                1635
hash.requirements.php                              24-May-2024 14:02                1295
hash.resources.php                                 24-May-2024 14:02                1388
hash.setup.php                                     24-May-2024 14:02                1674
history.php                                        24-May-2024 14:02                2341
history.php.books.php                              24-May-2024 14:02                2697
history.php.php                                    24-May-2024 14:02               11764
history.php.publications.php                       24-May-2024 14:02                1866
history.php.related.php                            24-May-2024 14:02                6349
hrtime-performancecounter.getfrequency.php         24-May-2024 14:02                2829
hrtime-performancecounter.getticks.php             24-May-2024 14:02                2647
hrtime-performancecounter.gettickssince.php        24-May-2024 14:02                2955
hrtime-stopwatch.getelapsedticks.php               24-May-2024 14:02                2549
hrtime-stopwatch.getelapsedtime.php                24-May-2024 14:02                3050
hrtime-stopwatch.getlastelapsedticks.php           24-May-2024 14:02                2617
hrtime-stopwatch.getlastelapsedtime.php            24-May-2024 14:02                3064
hrtime-stopwatch.isrunning.php                     24-May-2024 14:02                2510
hrtime-stopwatch.start.php                         24-May-2024 14:02                2411
hrtime-stopwatch.stop.php                          24-May-2024 14:02                2290
hrtime.example.basic.php                           24-May-2024 14:02                5538
hrtime.examples.php                                24-May-2024 14:02                1420
hrtime.installation.php                            24-May-2024 14:02                2064
hrtime.setup.php                                   24-May-2024 14:02                1464
ibase.configuration.php                            24-May-2024 14:02                8104
ibase.constants.php                                24-May-2024 14:02               21391
ibase.installation.php                             24-May-2024 14:02                3503
ibase.requirements.php                             24-May-2024 14:02                1275
ibase.resources.php                                24-May-2024 14:02                1279
ibase.setup.php                                    24-May-2024 14:02                1706
ibm-db2.configuration.php                          24-May-2024 14:02                9759
ibm-db2.constants.php                              24-May-2024 14:02                9475
ibm-db2.installation.php                           24-May-2024 14:02                3718
ibm-db2.requirements.php                           24-May-2024 14:02                3281
ibm-db2.resources.php                              24-May-2024 14:02                1358
ibm-db2.setup.php                                  24-May-2024 14:02                1722
iconv.configuration.php                            24-May-2024 14:02                5013
iconv.constants.php                                24-May-2024 14:02                3902
iconv.installation.php                             24-May-2024 14:02                2202
iconv.requirements.php                             24-May-2024 14:02                1600
iconv.resources.php                                24-May-2024 14:02                1279
iconv.setup.php                                    24-May-2024 14:02                1696
igbinary.configuration.php                         24-May-2024 14:02                3597
igbinary.installation.php                          24-May-2024 14:02                2112
igbinary.requirements.php                          24-May-2024 14:02                1296
igbinary.setup.php                                 24-May-2024 14:02                1641
image.configuration.php                            24-May-2024 14:02                3582
image.constants.php                                24-May-2024 14:02               51701
image.examples-png.php                             24-May-2024 14:02                4856
image.examples-watermark.php                       24-May-2024 14:02                5979
image.examples.merged-watermark.php                24-May-2024 14:02                9037
image.examples.php                                 24-May-2024 14:02                1687
image.installation.php                             24-May-2024 14:02                5358
image.requirements.php                             24-May-2024 14:02                5595
image.resources.php                                24-May-2024 14:02                2704
image.setup.php                                    24-May-2024 14:02                1701
imagick.adaptiveblurimage.php                      24-May-2024 14:02                7170
imagick.adaptiveresizeimage.php                    24-May-2024 14:02                9437
imagick.adaptivesharpenimage.php                   24-May-2024 14:02                6575
imagick.adaptivethresholdimage.php                 24-May-2024 14:02                6242
imagick.addimage.php                               24-May-2024 14:02                3001
imagick.addnoiseimage.php                          24-May-2024 14:02                5652
imagick.affinetransformimage.php                   24-May-2024 14:02                6661
imagick.animateimages.php                          24-May-2024 14:02                3233
imagick.annotateimage.php                          24-May-2024 14:02                8800
imagick.appendimages.php                           24-May-2024 14:02                6813
imagick.autolevelimage.php                         24-May-2024 14:02                4497
imagick.averageimages.php                          24-May-2024 14:02                2320
imagick.blackthresholdimage.php                    24-May-2024 14:02                5400
imagick.blueshiftimage.php                         24-May-2024 14:02                4542
imagick.blurimage.php                              24-May-2024 14:02                5957
imagick.borderimage.php                            24-May-2024 14:02                6114
imagick.brightnesscontrastimage.php                24-May-2024 14:02                5702
imagick.charcoalimage.php                          24-May-2024 14:02                5030
imagick.chopimage.php                              24-May-2024 14:02                7113
imagick.clampimage.php                             24-May-2024 14:02                2718
imagick.clear.php                                  24-May-2024 14:02                2106
imagick.clipimage.php                              24-May-2024 14:02                2358
imagick.clipimagepath.php                          24-May-2024 14:02                3204
imagick.clippathimage.php                          24-May-2024 14:02                3663
imagick.clone.php                                  24-May-2024 14:02                3999
imagick.clutimage.php                              24-May-2024 14:02                6186
imagick.coalesceimages.php                         24-May-2024 14:02                2677
imagick.colorfloodfillimage.php                    24-May-2024 14:02                5584
imagick.colorizeimage.php                          24-May-2024 14:02                6979
imagick.colormatriximage.php                       24-May-2024 14:02                7665
imagick.combineimages.php                          24-May-2024 14:02                3431
imagick.commentimage.php                           24-May-2024 14:02                5040
imagick.compareimagechannels.php                   24-May-2024 14:02                4037
imagick.compareimagelayers.php                     24-May-2024 14:02                5634
imagick.compareimages.php                          24-May-2024 14:02                5730
imagick.compositeimage.php                         24-May-2024 14:02                8140
imagick.configuration.php                          24-May-2024 14:02                4659
imagick.constants.php                              24-May-2024 14:02              127642
imagick.construct.php                              24-May-2024 14:02                2825
imagick.contrastimage.php                          24-May-2024 14:02                5103
imagick.contraststretchimage.php                   24-May-2024 14:02                4069
imagick.convolveimage.php                          24-May-2024 14:02                6029
imagick.count.php                                  24-May-2024 14:02                2747
imagick.cropimage.php                              24-May-2024 14:02                6209
imagick.cropthumbnailimage.php                     24-May-2024 14:02                3580
imagick.current.php                                24-May-2024 14:02                2311
imagick.cyclecolormapimage.php                     24-May-2024 14:02                3084
imagick.decipherimage.php                          24-May-2024 14:02                3322
imagick.deconstructimages.php                      24-May-2024 14:02                2472
imagick.deleteimageartifact.php                    24-May-2024 14:02                3765
imagick.deleteimageproperty.php                    24-May-2024 14:02                2689
imagick.deskewimage.php                            24-May-2024 14:02               11110
imagick.despeckleimage.php                         24-May-2024 14:02                4074
imagick.destroy.php                                24-May-2024 14:02                2229
imagick.displayimage.php                           24-May-2024 14:02                2852
imagick.displayimages.php                          24-May-2024 14:02                2916
imagick.distortimage.php                           24-May-2024 14:02               12133
imagick.drawimage.php                              24-May-2024 14:02                2684
imagick.edgeimage.php                              24-May-2024 14:02                4714
imagick.embossimage.php                            24-May-2024 14:02                5445
imagick.encipherimage.php                          24-May-2024 14:02                3321
imagick.enhanceimage.php                           24-May-2024 14:02                4046
imagick.equalizeimage.php                          24-May-2024 14:02                4017
imagick.evaluateimage.php                          24-May-2024 14:02                6003
imagick.examples-1.php                             24-May-2024 14:02               30513
imagick.examples.php                               24-May-2024 14:02                1430
imagick.exportimagepixels.php                      24-May-2024 14:02                8072
imagick.extentimage.php                            24-May-2024 14:02                5471
imagick.filter.php                                 24-May-2024 14:02                7677
imagick.flattenimages.php                          24-May-2024 14:02                2390
imagick.flipimage.php                              24-May-2024 14:02                4019
imagick.floodfillpaintimage.php                    24-May-2024 14:02               11834
imagick.flopimage.php                              24-May-2024 14:02                4053
imagick.forwardfouriertransformimage.php           24-May-2024 14:02               12129
imagick.frameimage.php                             24-May-2024 14:02                8400
imagick.functionimage.php                          24-May-2024 14:02               13801
imagick.fximage.php                                24-May-2024 14:02                6135
imagick.gammaimage.php                             24-May-2024 14:02                5825
imagick.gaussianblurimage.php                      24-May-2024 14:02                6351
imagick.getcolorspace.php                          24-May-2024 14:02                2286
imagick.getcompression.php                         24-May-2024 14:02                2109
imagick.getcompressionquality.php                  24-May-2024 14:02                2194
imagick.getcopyright.php                           24-May-2024 14:02                2198
imagick.getfilename.php                            24-May-2024 14:02                2286
imagick.getfont.php                                24-May-2024 14:02                2989
imagick.getformat.php                              24-May-2024 14:02                2225
imagick.getgravity.php                             24-May-2024 14:02                2271
imagick.gethomeurl.php                             24-May-2024 14:02                2064
imagick.getimage.php                               24-May-2024 14:02                2288
imagick.getimagealphachannel.php                   24-May-2024 14:02                2767
imagick.getimageartifact.php                       24-May-2024 14:02                3673
imagick.getimageattribute.php                      24-May-2024 14:02                2848
imagick.getimagebackgroundcolor.php                24-May-2024 14:02                2437
imagick.getimageblob.php                           24-May-2024 14:02                2568
imagick.getimageblueprimary.php                    24-May-2024 14:02                2967
imagick.getimagebordercolor.php                    24-May-2024 14:02                2457
imagick.getimagechanneldepth.php                   24-May-2024 14:02                3321
imagick.getimagechanneldistortion.php              24-May-2024 14:02                4196
imagick.getimagechanneldistortions.php             24-May-2024 14:02                4552
imagick.getimagechannelextrema.php                 24-May-2024 14:02                3761
imagick.getimagechannelkurtosis.php                24-May-2024 14:02                3804
imagick.getimagechannelmean.php                    24-May-2024 14:02                3339
imagick.getimagechannelrange.php                   24-May-2024 14:02                3579
imagick.getimagechannelstatistics.php              24-May-2024 14:02                2496
imagick.getimageclipmask.php                       24-May-2024 14:02                2588
imagick.getimagecolormapcolor.php                  24-May-2024 14:02                3041
imagick.getimagecolors.php                         24-May-2024 14:02                2213
imagick.getimagecolorspace.php                     24-May-2024 14:02                2244
imagick.getimagecompose.php                        24-May-2024 14:02                2232
imagick.getimagecompression.php                    24-May-2024 14:02                2182
imagick.getimagecompressionquality.php             24-May-2024 14:02                2302
imagick.getimagedelay.php                          24-May-2024 14:02                2282
imagick.getimagedepth.php                          24-May-2024 14:02                2063
imagick.getimagedispose.php                        24-May-2024 14:02                2339
imagick.getimagedistortion.php                     24-May-2024 14:02                3350
imagick.getimageextrema.php                        24-May-2024 14:02                2452
imagick.getimagefilename.php                       24-May-2024 14:02                2408
imagick.getimageformat.php                         24-May-2024 14:02                2382
imagick.getimagegamma.php                          24-May-2024 14:02                2296
imagick.getimagegeometry.php                       24-May-2024 14:02                3844
imagick.getimagegravity.php                        24-May-2024 14:02                2596
imagick.getimagegreenprimary.php                   24-May-2024 14:02                2538
imagick.getimageheight.php                         24-May-2024 14:02                2293
imagick.getimagehistogram.php                      24-May-2024 14:02               17075
imagick.getimageindex.php                          24-May-2024 14:02                2555
imagick.getimageinterlacescheme.php                24-May-2024 14:02                2368
imagick.getimageinterpolatemethod.php              24-May-2024 14:02                2564
imagick.getimageiterations.php                     24-May-2024 14:02                2373
imagick.getimagelength.php                         24-May-2024 14:02                3236
imagick.getimagematte.php                          24-May-2024 14:02                2509
imagick.getimagemattecolor.php                     24-May-2024 14:02                2354
imagick.getimagemimetype.php                       24-May-2024 14:02                2310
imagick.getimageorientation.php                    24-May-2024 14:02                2477
imagick.getimagepage.php                           24-May-2024 14:02                2533
imagick.getimagepixelcolor.php                     24-May-2024 14:02                3200
imagick.getimageprofile.php                        24-May-2024 14:02                2877
imagick.getimageprofiles.php                       24-May-2024 14:02                3547
imagick.getimageproperties.php                     24-May-2024 14:02                5831
imagick.getimageproperty.php                       24-May-2024 14:02                5015
imagick.getimageredprimary.php                     24-May-2024 14:02                2609
imagick.getimageregion.php                         24-May-2024 14:02                4032
imagick.getimagerenderingintent.php                24-May-2024 14:02                2518
imagick.getimageresolution.php                     24-May-2024 14:02                2356
imagick.getimagesblob.php                          24-May-2024 14:02                2408
imagick.getimagescene.php                          24-May-2024 14:02                2261
imagick.getimagesignature.php                      24-May-2024 14:02                2383
imagick.getimagesize.php                           24-May-2024 14:02                2247
imagick.getimagetickspersecond.php                 24-May-2024 14:02                2405
imagick.getimagetotalinkdensity.php                24-May-2024 14:02                2324
imagick.getimagetype.php                           24-May-2024 14:02                4705
imagick.getimageunits.php                          24-May-2024 14:02                2335
imagick.getimagevirtualpixelmethod.php             24-May-2024 14:02                2457
imagick.getimagewhitepoint.php                     24-May-2024 14:02                2511
imagick.getimagewidth.php                          24-May-2024 14:02                2272
imagick.getinterlacescheme.php                     24-May-2024 14:02                2454
imagick.getiteratorindex.php                       24-May-2024 14:02                5967
imagick.getnumberimages.php                        24-May-2024 14:02                2355
imagick.getoption.php                              24-May-2024 14:02                2839
imagick.getpackagename.php                         24-May-2024 14:02                2311
imagick.getpage.php                                24-May-2024 14:02                2391
imagick.getpixeliterator.php                       24-May-2024 14:02                5848
imagick.getpixelregioniterator.php                 24-May-2024 14:02                6813
imagick.getpointsize.php                           24-May-2024 14:02                2678
imagick.getquantum.php                             24-May-2024 14:02                2338
imagick.getquantumdepth.php                        24-May-2024 14:02                2347
imagick.getquantumrange.php                        24-May-2024 14:02                2682
imagick.getregistry.php                            24-May-2024 14:02                2556
imagick.getreleasedate.php                         24-May-2024 14:02                2350
imagick.getresource.php                            24-May-2024 14:02                2914
imagick.getresourcelimit.php                       24-May-2024 14:02                2940
imagick.getsamplingfactors.php                     24-May-2024 14:02                2405
imagick.getsize.php                                24-May-2024 14:02                2254
imagick.getsizeoffset.php                          24-May-2024 14:02                2408
imagick.getversion.php                             24-May-2024 14:02                2326
imagick.haldclutimage.php                          24-May-2024 14:02                6212
imagick.hasnextimage.php                           24-May-2024 14:02                2500
imagick.haspreviousimage.php                       24-May-2024 14:02                2522
imagick.identifyformat.php                         24-May-2024 14:02                4502
imagick.identifyimage.php                          24-May-2024 14:02                3881
imagick.implodeimage.php                           24-May-2024 14:02                4726
imagick.importimagepixels.php                      24-May-2024 14:02               11633
imagick.installation.php                           24-May-2024 14:02                2259
imagick.inversefouriertransformimage.php           24-May-2024 14:02                3562
imagick.labelimage.php                             24-May-2024 14:02                2655
imagick.levelimage.php                             24-May-2024 14:02                7939
imagick.linearstretchimage.php                     24-May-2024 14:02                5745
imagick.liquidrescaleimage.php                     24-May-2024 14:02                4653
imagick.listregistry.php                           24-May-2024 14:02                2401
imagick.magnifyimage.php                           24-May-2024 14:02                4054
imagick.mapimage.php                               24-May-2024 14:02                3299
imagick.mattefloodfillimage.php                    24-May-2024 14:02                5909
imagick.medianfilterimage.php                      24-May-2024 14:02                5211
imagick.mergeimagelayers.php                       24-May-2024 14:02                6569
imagick.minifyimage.php                            24-May-2024 14:02                2227
imagick.modulateimage.php                          24-May-2024 14:02                5732
imagick.montageimage.php                           24-May-2024 14:02                4621
imagick.morphimages.php                            24-May-2024 14:02                2887
imagick.morphology.php                             24-May-2024 14:02               66597
imagick.mosaicimages.php                           24-May-2024 14:02                2311
imagick.motionblurimage.php                        24-May-2024 14:02                6925
imagick.negateimage.php                            24-May-2024 14:02                5696
imagick.newimage.php                               24-May-2024 14:02                6391
imagick.newpseudoimage.php                         24-May-2024 14:02                5885
imagick.nextimage.php                              24-May-2024 14:02                2152
imagick.normalizeimage.php                         24-May-2024 14:02                6490
imagick.oilpaintimage.php                          24-May-2024 14:02                4664
imagick.opaquepaintimage.php                       24-May-2024 14:02                5142
imagick.optimizeimagelayers.php                    24-May-2024 14:02                5252
imagick.orderedposterizeimage.php                  24-May-2024 14:02                6912
imagick.paintfloodfillimage.php                    24-May-2024 14:02                5909
imagick.paintopaqueimage.php                       24-May-2024 14:02                5536
imagick.painttransparentimage.php                  24-May-2024 14:02                4778
imagick.pingimage.php                              24-May-2024 14:02                2791
imagick.pingimageblob.php                          24-May-2024 14:02                6135
imagick.pingimagefile.php                          24-May-2024 14:02                5980
imagick.polaroidimage.php                          24-May-2024 14:02                4824
imagick.posterizeimage.php                         24-May-2024 14:02                5689
imagick.previewimages.php                          24-May-2024 14:02                3264
imagick.previousimage.php                          24-May-2024 14:02                2187
imagick.profileimage.php                           24-May-2024 14:02                3310
imagick.quantizeimage.php                          24-May-2024 14:02                6749
imagick.quantizeimages.php                         24-May-2024 14:02                4087
imagick.queryfontmetrics.php                       24-May-2024 14:02                5704
imagick.queryfonts.php                             24-May-2024 14:02                4711
imagick.queryformats.php                           24-May-2024 14:02                7090
imagick.radialblurimage.php                        24-May-2024 14:02                5611
imagick.raiseimage.php                             24-May-2024 14:02                6562
imagick.randomthresholdimage.php                   24-May-2024 14:02                6533
imagick.readimage.php                              24-May-2024 14:02                2629
imagick.readimageblob.php                          24-May-2024 14:02                5490
imagick.readimagefile.php                          24-May-2024 14:02                3281
imagick.readimages.php                             24-May-2024 14:02                2644
imagick.recolorimage.php                           24-May-2024 14:02                6136
imagick.reducenoiseimage.php                       24-May-2024 14:02                5289
imagick.remapimage.php                             24-May-2024 14:02                3575
imagick.removeimage.php                            24-May-2024 14:02                2345
imagick.removeimageprofile.php                     24-May-2024 14:02                2855
imagick.render.php                                 24-May-2024 14:02                2127
imagick.requirements.php                           24-May-2024 14:02                2039
imagick.resampleimage.php                          24-May-2024 14:02                5688
imagick.resetimagepage.php                         24-May-2024 14:02                2908
imagick.resizeimage.php                            24-May-2024 14:02               11393
imagick.resources.php                              24-May-2024 14:02                1293
imagick.rollimage.php                              24-May-2024 14:02                4856
imagick.rotateimage.php                            24-May-2024 14:02                5789
imagick.rotationalblurimage.php                    24-May-2024 14:02                5828
imagick.roundcorners.php                           24-May-2024 14:02                6446
imagick.sampleimage.php                            24-May-2024 14:02                3047
imagick.scaleimage.php                             24-May-2024 14:02                7041
imagick.segmentimage.php                           24-May-2024 14:02                6759
imagick.selectiveblurimage.php                     24-May-2024 14:02                6629
imagick.separateimagechannel.php                   24-May-2024 14:02                5461
imagick.sepiatoneimage.php                         24-May-2024 14:02                4972
imagick.setbackgroundcolor.php                     24-May-2024 14:02                3343
imagick.setcolorspace.php                          24-May-2024 14:02                3088
imagick.setcompression.php                         24-May-2024 14:02                2679
imagick.setcompressionquality.php                  24-May-2024 14:02                6826
imagick.setfilename.php                            24-May-2024 14:02                2728
imagick.setfirstiterator.php                       24-May-2024 14:02                2195
imagick.setfont.php                                24-May-2024 14:02                5741
imagick.setformat.php                              24-May-2024 14:02                2590
imagick.setgravity.php                             24-May-2024 14:02                2797
imagick.setimage.php                               24-May-2024 14:02                4772
imagick.setimagealphachannel.php                   24-May-2024 14:02                3760
imagick.setimageartifact.php                       24-May-2024 14:02                7388
imagick.setimageattribute.php                      24-May-2024 14:02                2981
imagick.setimagebackgroundcolor.php                24-May-2024 14:02                3587
imagick.setimagebias.php                           24-May-2024 14:02                6822
imagick.setimagebiasquantum.php                    24-May-2024 14:02                2923
imagick.setimageblueprimary.php                    24-May-2024 14:02                3244
imagick.setimagebordercolor.php                    24-May-2024 14:02                3573
imagick.setimagechanneldepth.php                   24-May-2024 14:02                3259
imagick.setimageclipmask.php                       24-May-2024 14:02                8800
imagick.setimagecolormapcolor.php                  24-May-2024 14:02                3280
imagick.setimagecolorspace.php                     24-May-2024 14:02                3327
imagick.setimagecompose.php                        24-May-2024 14:02                3030
imagick.setimagecompression.php                    24-May-2024 14:02                2974
imagick.setimagecompressionquality.php             24-May-2024 14:02                4964
imagick.setimagedelay.php                          24-May-2024 14:02                6291
imagick.setimagedepth.php                          24-May-2024 14:02                2842
imagick.setimagedispose.php                        24-May-2024 14:02                2890
imagick.setimageextent.php                         24-May-2024 14:02                3154
imagick.setimagefilename.php                       24-May-2024 14:02                2943
imagick.setimageformat.php                         24-May-2024 14:02                2832
imagick.setimagegamma.php                          24-May-2024 14:02                2844
imagick.setimagegravity.php                        24-May-2024 14:02                2987
imagick.setimagegreenprimary.php                   24-May-2024 14:02                3237
imagick.setimageindex.php                          24-May-2024 14:02                3447
imagick.setimageinterlacescheme.php                24-May-2024 14:02                2992
imagick.setimageinterpolatemethod.php              24-May-2024 14:02                2910
imagick.setimageiterations.php                     24-May-2024 14:02                5092
imagick.setimagematte.php                          24-May-2024 14:02                2838
imagick.setimagemattecolor.php                     24-May-2024 14:02                3776
imagick.setimageopacity.php                        24-May-2024 14:02                5140
imagick.setimageorientation.php                    24-May-2024 14:02                4782
imagick.setimagepage.php                           24-May-2024 14:02                3794
imagick.setimageprofile.php                        24-May-2024 14:02                3331
imagick.setimageproperty.php                       24-May-2024 14:02                5230
imagick.setimageredprimary.php                     24-May-2024 14:02                3235
imagick.setimagerenderingintent.php                24-May-2024 14:02                3022
imagick.setimageresolution.php                     24-May-2024 14:02                5064
imagick.setimagescene.php                          24-May-2024 14:02                2854
imagick.setimagetickspersecond.php                 24-May-2024 14:02                7806
imagick.setimagetype.php                           24-May-2024 14:02                2635
imagick.setimageunits.php                          24-May-2024 14:02                2687
imagick.setimagevirtualpixelmethod.php             24-May-2024 14:02                2807
imagick.setimagewhitepoint.php                     24-May-2024 14:02                3225
imagick.setinterlacescheme.php                     24-May-2024 14:02                2725
imagick.setiteratorindex.php                       24-May-2024 14:02                6373
imagick.setlastiterator.php                        24-May-2024 14:02                2212
imagick.setoption.php                              24-May-2024 14:02               11559
imagick.setpage.php                                24-May-2024 14:02                3526
imagick.setpointsize.php                           24-May-2024 14:02                5351
imagick.setprogressmonitor.php                     24-May-2024 14:02               10314
imagick.setregistry.php                            24-May-2024 14:02                3088
imagick.setresolution.php                          24-May-2024 14:02                3853
imagick.setresourcelimit.php                       24-May-2024 14:02                3232
imagick.setsamplingfactors.php                     24-May-2024 14:02                6831
imagick.setsize.php                                24-May-2024 14:02                2952
imagick.setsizeoffset.php                          24-May-2024 14:02                3489
imagick.settype.php                                24-May-2024 14:02                2579
imagick.setup.php                                  24-May-2024 14:02                1720
imagick.shadeimage.php                             24-May-2024 14:02                5780
imagick.shadowimage.php                            24-May-2024 14:02                5472
imagick.sharpenimage.php                           24-May-2024 14:02                5680
imagick.shaveimage.php                             24-May-2024 14:02                4811
imagick.shearimage.php                             24-May-2024 14:02                6590
imagick.sigmoidalcontrastimage.php                 24-May-2024 14:02                8036
imagick.sketchimage.php                            24-May-2024 14:02                5942
imagick.smushimages.php                            24-May-2024 14:02                5799
imagick.solarizeimage.php                          24-May-2024 14:02                4927
imagick.sparsecolorimage.php                       24-May-2024 14:02               26713
imagick.spliceimage.php                            24-May-2024 14:02                5843
imagick.spreadimage.php                            24-May-2024 14:02                4735
imagick.statisticimage.php                         24-May-2024 14:02                6713
imagick.steganoimage.php                           24-May-2024 14:02                3140
imagick.stereoimage.php                            24-May-2024 14:02                2895
imagick.stripimage.php                             24-May-2024 14:02                2353
imagick.subimagematch.php                          24-May-2024 14:02                7632
imagick.swirlimage.php                             24-May-2024 14:02                4788
imagick.textureimage.php                           24-May-2024 14:02                6204
imagick.thresholdimage.php                         24-May-2024 14:02                5325
imagick.thumbnailimage.php                         24-May-2024 14:02                7645
imagick.tintimage.php                              24-May-2024 14:02                7890
imagick.tostring.php                               24-May-2024 14:02                3050
imagick.transformimage.php                         24-May-2024 14:02                6178
imagick.transformimagecolorspace.php               24-May-2024 14:02                8124
imagick.transparentpaintimage.php                  24-May-2024 14:02                7325
imagick.transposeimage.php                         24-May-2024 14:02                4411
imagick.transverseimage.php                        24-May-2024 14:02                4399
imagick.trimimage.php                              24-May-2024 14:02                5915
imagick.uniqueimagecolors.php                      24-May-2024 14:02                5370
imagick.unsharpmaskimage.php                       24-May-2024 14:02                6774
imagick.valid.php                                  24-May-2024 14:02                2098
imagick.vignetteimage.php                          24-May-2024 14:02                6628
imagick.waveimage.php                              24-May-2024 14:02                6396
imagick.whitethresholdimage.php                    24-May-2024 14:02                5314
imagick.writeimage.php                             24-May-2024 14:02                3169
imagick.writeimagefile.php                         24-May-2024 14:02                3130
imagick.writeimages.php                            24-May-2024 14:02                2938
imagick.writeimagesfile.php                        24-May-2024 14:02                3193
imagickdraw.affine.php                             24-May-2024 14:02               17003
imagickdraw.annotation.php                         24-May-2024 14:02                3366
imagickdraw.arc.php                                24-May-2024 14:02                9739
imagickdraw.bezier.php                             24-May-2024 14:02               16899
imagickdraw.circle.php                             24-May-2024 14:02                9128
imagickdraw.clear.php                              24-May-2024 14:02                2434
imagickdraw.clone.php                              24-May-2024 14:02                2367
imagickdraw.color.php                              24-May-2024 14:02                3421
imagickdraw.comment.php                            24-May-2024 14:02                2774
imagickdraw.composite.php                          24-May-2024 14:02               11746
imagickdraw.construct.php                          24-May-2024 14:02                2286
imagickdraw.destroy.php                            24-May-2024 14:02                2394
imagickdraw.ellipse.php                            24-May-2024 14:02               12290
imagickdraw.getclippath.php                        24-May-2024 14:02                2389
imagickdraw.getcliprule.php                        24-May-2024 14:02                2527
imagickdraw.getclipunits.php                       24-May-2024 14:02                2484
imagickdraw.getfillcolor.php                       24-May-2024 14:02                2473
imagickdraw.getfillopacity.php                     24-May-2024 14:02                2409
imagickdraw.getfillrule.php                        24-May-2024 14:02                2482
imagickdraw.getfont.php                            24-May-2024 14:02                2337
imagickdraw.getfontfamily.php                      24-May-2024 14:02                2420
imagickdraw.getfontsize.php                        24-May-2024 14:02                2520
imagickdraw.getfontstretch.php                     24-May-2024 14:02                2384
imagickdraw.getfontstyle.php                       24-May-2024 14:02                2424
imagickdraw.getfontweight.php                      24-May-2024 14:02                2495
imagickdraw.getgravity.php                         24-May-2024 14:02                2413
imagickdraw.getstrokeantialias.php                 24-May-2024 14:02                2879
imagickdraw.getstrokecolor.php                     24-May-2024 14:02                2868
imagickdraw.getstrokedasharray.php                 24-May-2024 14:02                2549
imagickdraw.getstrokedashoffset.php                24-May-2024 14:02                2539
imagickdraw.getstrokelinecap.php                   24-May-2024 14:02                2566
imagickdraw.getstrokelinejoin.php                  24-May-2024 14:02                2592
imagickdraw.getstrokemiterlimit.php                24-May-2024 14:02                2844
imagickdraw.getstrokeopacity.php                   24-May-2024 14:02                2413
imagickdraw.getstrokewidth.php                     24-May-2024 14:02                2436
imagickdraw.gettextalignment.php                   24-May-2024 14:02                2425
imagickdraw.gettextantialias.php                   24-May-2024 14:02                2720
imagickdraw.gettextdecoration.php                  24-May-2024 14:02                2444
imagickdraw.gettextencoding.php                    24-May-2024 14:02                2522
imagickdraw.gettextinterlinespacing.php            24-May-2024 14:02                2435
imagickdraw.gettextinterwordspacing.php            24-May-2024 14:02                2460
imagickdraw.gettextkerning.php                     24-May-2024 14:02                2377
imagickdraw.gettextundercolor.php                  24-May-2024 14:02                2570
imagickdraw.getvectorgraphics.php                  24-May-2024 14:02                2645
imagickdraw.line.php                               24-May-2024 14:02                8432
imagickdraw.matte.php                              24-May-2024 14:02                8252
imagickdraw.pathclose.php                          24-May-2024 14:02                2505
imagickdraw.pathcurvetoabsolute.php                24-May-2024 14:02                4960
imagickdraw.pathcurvetoquadraticbezierabsolute.php 24-May-2024 14:02               11236
imagickdraw.pathcurvetoquadraticbezierrelative.php 24-May-2024 14:02                4332
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 24-May-2024 14:02               10350
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 24-May-2024 14:02               10511
imagickdraw.pathcurvetorelative.php                24-May-2024 14:02                4970
imagickdraw.pathcurvetosmoothabsolute.php          24-May-2024 14:02                4681
imagickdraw.pathcurvetosmoothrelative.php          24-May-2024 14:02                4689
imagickdraw.pathellipticarcabsolute.php            24-May-2024 14:02                5807
imagickdraw.pathellipticarcrelative.php            24-May-2024 14:02                5777
imagickdraw.pathfinish.php                         24-May-2024 14:02                2303
imagickdraw.pathlinetoabsolute.php                 24-May-2024 14:02                3277
imagickdraw.pathlinetohorizontalabsolute.php       24-May-2024 14:02                3119
imagickdraw.pathlinetohorizontalrelative.php       24-May-2024 14:02                3109
imagickdraw.pathlinetorelative.php                 24-May-2024 14:02                3325
imagickdraw.pathlinetoverticalabsolute.php         24-May-2024 14:02                3077
imagickdraw.pathlinetoverticalrelative.php         24-May-2024 14:02                3088
imagickdraw.pathmovetoabsolute.php                 24-May-2024 14:02                3311
imagickdraw.pathmovetorelative.php                 24-May-2024 14:02                3263
imagickdraw.pathstart.php                          24-May-2024 14:02               11880
imagickdraw.point.php                              24-May-2024 14:02                6939
imagickdraw.polygon.php                            24-May-2024 14:02                9052
imagickdraw.polyline.php                           24-May-2024 14:02                9059
imagickdraw.pop.php                                24-May-2024 14:02                2799
imagickdraw.popclippath.php                        24-May-2024 14:02                2296
imagickdraw.popdefs.php                            24-May-2024 14:02                7797
imagickdraw.poppattern.php                         24-May-2024 14:02                2455
imagickdraw.push.php                               24-May-2024 14:02                8525
imagickdraw.pushclippath.php                       24-May-2024 14:02                3064
imagickdraw.pushdefs.php                           24-May-2024 14:02                2644
imagickdraw.pushpattern.php                        24-May-2024 14:02               14779
imagickdraw.rectangle.php                          24-May-2024 14:02                8667
imagickdraw.render.php                             24-May-2024 14:02                2508
imagickdraw.resetvectorgraphics.php                24-May-2024 14:02                2451
imagickdraw.rotate.php                             24-May-2024 14:02                7805
imagickdraw.roundrectangle.php                     24-May-2024 14:02                9540
imagickdraw.scale.php                              24-May-2024 14:02                8149
imagickdraw.setclippath.php                        24-May-2024 14:02                8504
imagickdraw.setcliprule.php                        24-May-2024 14:02                9340
imagickdraw.setclipunits.php                       24-May-2024 14:02                8930
imagickdraw.setfillalpha.php                       24-May-2024 14:02                7895
imagickdraw.setfillcolor.php                       24-May-2024 14:02                7839
imagickdraw.setfillopacity.php                     24-May-2024 14:02                7910
imagickdraw.setfillpatternurl.php                  24-May-2024 14:02                3345
imagickdraw.setfillrule.php                        24-May-2024 14:02               12877
imagickdraw.setfont.php                            24-May-2024 14:02                9374
imagickdraw.setfontfamily.php                      24-May-2024 14:02                9976
imagickdraw.setfontsize.php                        24-May-2024 14:02                8379
imagickdraw.setfontstretch.php                     24-May-2024 14:02                9620
imagickdraw.setfontstyle.php                       24-May-2024 14:02                8905
imagickdraw.setfontweight.php                      24-May-2024 14:02                9206
imagickdraw.setgravity.php                         24-May-2024 14:02               10461
imagickdraw.setresolution.php                      24-May-2024 14:02                2928
imagickdraw.setstrokealpha.php                     24-May-2024 14:02                8520
imagickdraw.setstrokeantialias.php                 24-May-2024 14:02                9089
imagickdraw.setstrokecolor.php                     24-May-2024 14:02                8580
imagickdraw.setstrokedasharray.php                 24-May-2024 14:02               13571
imagickdraw.setstrokedashoffset.php                24-May-2024 14:02                9986
imagickdraw.setstrokelinecap.php                   24-May-2024 14:02                8484
imagickdraw.setstrokelinejoin.php                  24-May-2024 14:02               11368
imagickdraw.setstrokemiterlimit.php                24-May-2024 14:02               11399
imagickdraw.setstrokeopacity.php                   24-May-2024 14:02               10329
imagickdraw.setstrokepatternurl.php                24-May-2024 14:02                3064
imagickdraw.setstrokewidth.php                     24-May-2024 14:02                8548
imagickdraw.settextalignment.php                   24-May-2024 14:02                9330
imagickdraw.settextantialias.php                   24-May-2024 14:02                8914
imagickdraw.settextdecoration.php                  24-May-2024 14:02                7341
imagickdraw.settextencoding.php                    24-May-2024 14:02                3326
imagickdraw.settextinterlinespacing.php            24-May-2024 14:02                2985
imagickdraw.settextinterwordspacing.php            24-May-2024 14:02                2797
imagickdraw.settextkerning.php                     24-May-2024 14:02                2919
imagickdraw.settextundercolor.php                  24-May-2024 14:02                7861
imagickdraw.setvectorgraphics.php                  24-May-2024 14:02                9060
imagickdraw.setviewbox.php                         24-May-2024 14:02               10494
imagickdraw.skewx.php                              24-May-2024 14:02                8223
imagickdraw.skewy.php                              24-May-2024 14:02                8212
imagickdraw.translate.php                          24-May-2024 14:02                8559
imagickkernel.addkernel.php                        24-May-2024 14:02                7040
imagickkernel.addunitykernel.php                   24-May-2024 14:02               13680
imagickkernel.frombuiltin.php                      24-May-2024 14:02               26248
imagickkernel.frommatrix.php                       24-May-2024 14:02               23272
imagickkernel.getmatrix.php                        24-May-2024 14:02                7111
imagickkernel.scale.php                            24-May-2024 14:02               12913
imagickkernel.separate.php                         24-May-2024 14:02                9701
imagickpixel.clear.php                             24-May-2024 14:02                2423
imagickpixel.construct.php                         24-May-2024 14:02               11863
imagickpixel.destroy.php                           24-May-2024 14:02                2527
imagickpixel.getcolor.php                          24-May-2024 14:02                6206
imagickpixel.getcolorasstring.php                  24-May-2024 14:02                4841
imagickpixel.getcolorcount.php                     24-May-2024 14:02                4756
imagickpixel.getcolorquantum.php                   24-May-2024 14:02                2921
imagickpixel.getcolorvalue.php                     24-May-2024 14:02                8740
imagickpixel.getcolorvaluequantum.php              24-May-2024 14:02                5849
imagickpixel.gethsl.php                            24-May-2024 14:02                4192
imagickpixel.getindex.php                          24-May-2024 14:02                2298
imagickpixel.ispixelsimilar.php                    24-May-2024 14:02                3647
imagickpixel.ispixelsimilarquantum.php             24-May-2024 14:02                3216
imagickpixel.issimilar.php                         24-May-2024 14:02               16575
imagickpixel.setcolor.php                          24-May-2024 14:02                7524
imagickpixel.setcolorcount.php                     24-May-2024 14:02                2677
imagickpixel.setcolorvalue.php                     24-May-2024 14:02                5191
imagickpixel.setcolorvaluequantum.php              24-May-2024 14:02                8273
imagickpixel.sethsl.php                            24-May-2024 14:02                7597
imagickpixel.setindex.php                          24-May-2024 14:02                2631
imagickpixeliterator.clear.php                     24-May-2024 14:02                6344
imagickpixeliterator.construct.php                 24-May-2024 14:02                6003
imagickpixeliterator.destroy.php                   24-May-2024 14:02                2557
imagickpixeliterator.getcurrentiteratorrow.php     24-May-2024 14:02                2657
imagickpixeliterator.getiteratorrow.php            24-May-2024 14:02                2619
imagickpixeliterator.getnextiteratorrow.php        24-May-2024 14:02                6827
imagickpixeliterator.getpreviousiteratorrow.php    24-May-2024 14:02                2761
imagickpixeliterator.newpixeliterator.php          24-May-2024 14:02                2825
imagickpixeliterator.newpixelregioniterator.php    24-May-2024 14:02                4350
imagickpixeliterator.resetiterator.php             24-May-2024 14:02                8739
imagickpixeliterator.setiteratorfirstrow.php       24-May-2024 14:02                2665
imagickpixeliterator.setiteratorlastrow.php        24-May-2024 14:02                2660
imagickpixeliterator.setiteratorrow.php            24-May-2024 14:02                7171
imagickpixeliterator.synciterator.php              24-May-2024 14:02                2500
imap.configuration.php                             24-May-2024 14:02                3377
imap.constants.php                                 24-May-2024 14:02               24873
imap.installation.php                              24-May-2024 14:02                2739
imap.requirements.php                              24-May-2024 14:02                3094
imap.resources.php                                 24-May-2024 14:02                1466
imap.setup.php                                     24-May-2024 14:02                1682
index.php                                          24-May-2024 14:02               15290
indexes.examples.php                               24-May-2024 14:02              714974
indexes.functions.php                              24-May-2024 14:02             1212621
indexes.php                                        24-May-2024 14:02                1524
infiniteiterator.construct.php                     24-May-2024 14:02                5092
infiniteiterator.next.php                          24-May-2024 14:02                3346
info.configuration.php                             24-May-2024 14:02               13259
info.constants.php                                 24-May-2024 14:02               23614
info.installation.php                              24-May-2024 14:02                1312
info.requirements.php                              24-May-2024 14:02                1268
info.resources.php                                 24-May-2024 14:02                1272
info.setup.php                                     24-May-2024 14:02                1674
ini.core.php                                       24-May-2024 14:02               72539
ini.list.php                                       24-May-2024 14:02              104301
ini.php                                            24-May-2024 14:02                1642
ini.sections.php                                   24-May-2024 14:02                4066
inotify.configuration.php                          24-May-2024 14:02                1377
inotify.constants.php                              24-May-2024 14:02               10791
inotify.install.php                                24-May-2024 14:02                1884
inotify.requirements.php                           24-May-2024 14:02                1320
inotify.resources.php                              24-May-2024 14:02                1403
inotify.setup.php                                  24-May-2024 14:02                1724
install.cloud.azure.php                            24-May-2024 14:02                1358
install.cloud.ec2.php                              24-May-2024 14:02                1468
install.cloud.php                                  24-May-2024 14:02                1713
install.fpm.configuration.php                      24-May-2024 14:02               33617
install.fpm.install.php                            24-May-2024 14:02                2326
install.fpm.php                                    24-May-2024 14:02                3601
install.general.php                                24-May-2024 14:02                5064
install.macosx.bundled.php                         24-May-2024 14:02               10725
install.macosx.compile.php                         24-May-2024 14:02                1351
install.macosx.packages.php                        24-May-2024 14:02                2778
install.macosx.php                                 24-May-2024 14:02                1944
install.pecl.downloads.php                         24-May-2024 14:02                3513
install.pecl.intro.php                             24-May-2024 14:02                3157
install.pecl.pear.php                              24-May-2024 14:02                3053
install.pecl.php                                   24-May-2024 14:02                2108
install.pecl.php-config.php                        24-May-2024 14:02                3999
install.pecl.phpize.php                            24-May-2024 14:02                3189
install.pecl.static.php                            24-May-2024 14:02                3299
install.pecl.windows.php                           24-May-2024 14:02                9590
install.php                                        24-May-2024 14:02                5940
install.problems.bugs.php                          24-May-2024 14:02                2102
install.problems.faq.php                           24-May-2024 14:02                1415
install.problems.php                               24-May-2024 14:02                1700
install.problems.support.php                       24-May-2024 14:02                2486
install.unix.apache2.php                           24-May-2024 14:02               13912
install.unix.commandline.php                       24-May-2024 14:02                3892
install.unix.debian.php                            24-May-2024 14:02                7106
install.unix.lighttpd-14.php                       24-May-2024 14:02                6287
install.unix.litespeed.php                         24-May-2024 14:02                9629
install.unix.nginx.php                             24-May-2024 14:02                8807
install.unix.openbsd.php                           24-May-2024 14:02                6751
install.unix.php                                   24-May-2024 14:02                7312
install.unix.solaris.php                           24-May-2024 14:02                4138
install.windows.apache2.php                        24-May-2024 14:02                8126
install.windows.building.php                       24-May-2024 14:02                1824
install.windows.commandline.php                    24-May-2024 14:02                8887
install.windows.manual.php                         24-May-2024 14:02                5631
install.windows.pecl.php                           24-May-2024 14:02                1704
install.windows.php                                24-May-2024 14:02                3170
install.windows.recommended.php                    24-May-2024 14:02                4968
install.windows.requirements.php                   24-May-2024 14:02                2314
install.windows.tools.php                          24-May-2024 14:02                2148
install.windows.troubleshooting.php                24-May-2024 14:02                1834
internaliterator.construct.php                     24-May-2024 14:02                2002
internaliterator.current.php                       24-May-2024 14:02                2311
internaliterator.key.php                           24-May-2024 14:02                2300
internaliterator.next.php                          24-May-2024 14:02                2289
internaliterator.rewind.php                        24-May-2024 14:02                2324
internaliterator.valid.php                         24-May-2024 14:02                2300
intl.configuration.php                             24-May-2024 14:02                5641
intl.constants.php                                 24-May-2024 14:02                9447
intl.examples.basic.php                            24-May-2024 14:02                4501
intl.examples.php                                  24-May-2024 14:02                1458
intl.installation.php                              24-May-2024 14:02                2623
intl.requirements.php                              24-May-2024 14:02                1610
intl.resources.php                                 24-May-2024 14:02                1272
intl.setup.php                                     24-May-2024 14:02                1690
intlbreakiterator.construct.php                    24-May-2024 14:02                2487
intlbreakiterator.createcharacterinstance.php      24-May-2024 14:02                3062
intlbreakiterator.createcodepointinstance.php      24-May-2024 14:02                2755
intlbreakiterator.createlineinstance.php           24-May-2024 14:02                3016
intlbreakiterator.createsentenceinstance.php       24-May-2024 14:02                3013
intlbreakiterator.createtitleinstance.php          24-May-2024 14:02                2996
intlbreakiterator.createwordinstance.php           24-May-2024 14:02                2948
intlbreakiterator.current.php                      24-May-2024 14:02                2484
intlbreakiterator.first.php                        24-May-2024 14:02                2459
intlbreakiterator.following.php                    24-May-2024 14:02                2788
intlbreakiterator.geterrorcode.php                 24-May-2024 14:02                2976
intlbreakiterator.geterrormessage.php              24-May-2024 14:02                3011
intlbreakiterator.getlocale.php                    24-May-2024 14:02                2787
intlbreakiterator.getpartsiterator.php             24-May-2024 14:02                2885
intlbreakiterator.gettext.php                      24-May-2024 14:02                2492
intlbreakiterator.isboundary.php                   24-May-2024 14:02                2758
intlbreakiterator.last.php                         24-May-2024 14:02                2468
intlbreakiterator.next.php                         24-May-2024 14:02                2732
intlbreakiterator.preceding.php                    24-May-2024 14:02                2777
intlbreakiterator.previous.php                     24-May-2024 14:02                2520
intlbreakiterator.settext.php                      24-May-2024 14:02                2722
intlcalendar.add.php                               24-May-2024 14:02                8806
intlcalendar.after.php                             24-May-2024 14:02                6814
intlcalendar.before.php                            24-May-2024 14:02                4191
intlcalendar.clear.php                             24-May-2024 14:02               18453
intlcalendar.construct.php                         24-May-2024 14:02                2584
intlcalendar.createinstance.php                    24-May-2024 14:02               12332
intlcalendar.equals.php                            24-May-2024 14:02               10931
intlcalendar.fielddifference.php                   24-May-2024 14:02               11109
intlcalendar.fromdatetime.php                      24-May-2024 14:02                6930
intlcalendar.get.php                               24-May-2024 14:02                8527
intlcalendar.getactualmaximum.php                  24-May-2024 14:02                8502
intlcalendar.getactualminimum.php                  24-May-2024 14:02                5669
intlcalendar.getavailablelocales.php               24-May-2024 14:02                4535
intlcalendar.getdayofweektype.php                  24-May-2024 14:02               10277
intlcalendar.geterrorcode.php                      24-May-2024 14:02                9001
intlcalendar.geterrormessage.php                   24-May-2024 14:02                5948
intlcalendar.getfirstdayofweek.php                 24-May-2024 14:02                8535
intlcalendar.getgreatestminimum.php                24-May-2024 14:02                4569
intlcalendar.getkeywordvaluesforlocale.php         24-May-2024 14:02                7488
intlcalendar.getleastmaximum.php                   24-May-2024 14:02                8179
intlcalendar.getlocale.php                         24-May-2024 14:02                6175
intlcalendar.getmaximum.php                        24-May-2024 14:02                5261
intlcalendar.getminimaldaysinfirstweek.php         24-May-2024 14:02                8879
intlcalendar.getminimum.php                        24-May-2024 14:02                4507
intlcalendar.getnow.php                            24-May-2024 14:02                5462
intlcalendar.getrepeatedwalltimeoption.php         24-May-2024 14:02               10404
intlcalendar.getskippedwalltimeoption.php          24-May-2024 14:02               12774
intlcalendar.gettime.php                           24-May-2024 14:02                6238
intlcalendar.gettimezone.php                       24-May-2024 14:02                7115
intlcalendar.gettype.php                           24-May-2024 14:02                5755
intlcalendar.getweekendtransition.php              24-May-2024 14:02                5239
intlcalendar.indaylighttime.php                    24-May-2024 14:02                8862
intlcalendar.isequivalentto.php                    24-May-2024 14:02                8568
intlcalendar.islenient.php                         24-May-2024 14:02                8397
intlcalendar.isset.php                             24-May-2024 14:02                4942
intlcalendar.isweekend.php                         24-May-2024 14:02                8746
intlcalendar.roll.php                              24-May-2024 14:02                9377
intlcalendar.set.php                               24-May-2024 14:02               15663
intlcalendar.setdate.php                           24-May-2024 14:02                4894
intlcalendar.setdatetime.php                       24-May-2024 14:02                6817
intlcalendar.setfirstdayofweek.php                 24-May-2024 14:02                8416
intlcalendar.setlenient.php                        24-May-2024 14:02                4459
intlcalendar.setminimaldaysinfirstweek.php         24-May-2024 14:02                4476
intlcalendar.setrepeatedwalltimeoption.php         24-May-2024 14:02                6120
intlcalendar.setskippedwalltimeoption.php          24-May-2024 14:02                6997
intlcalendar.settime.php                           24-May-2024 14:02                8781
intlcalendar.settimezone.php                       24-May-2024 14:02               10765
intlcalendar.todatetime.php                        24-May-2024 14:02                6921
intlchar.charage.php                               24-May-2024 14:02                5718
intlchar.chardigitvalue.php                        24-May-2024 14:02                5355
intlchar.chardirection.php                         24-May-2024 14:02               10516
intlchar.charfromname.php                          24-May-2024 14:02                7502
intlchar.charmirror.php                            24-May-2024 14:02                6362
intlchar.charname.php                              24-May-2024 14:02                7591
intlchar.chartype.php                              24-May-2024 14:02               11046
intlchar.chr.php                                   24-May-2024 14:02                5301
intlchar.digit.php                                 24-May-2024 14:02                8261
intlchar.enumcharnames.php                         24-May-2024 14:02                8332
intlchar.enumchartypes.php                         24-May-2024 14:02                6050
intlchar.foldcase.php                              24-May-2024 14:02                3884
intlchar.fordigit.php                              24-May-2024 14:02                7309
intlchar.getbidipairedbracket.php                  24-May-2024 14:02                6001
intlchar.getblockcode.php                          24-May-2024 14:02                5390
intlchar.getcombiningclass.php                     24-May-2024 14:02                4720
intlchar.getfc-nfkc-closure.php                    24-May-2024 14:02                4544
intlchar.getintpropertymaxvalue.php                24-May-2024 14:02                6537
intlchar.getintpropertyminvalue.php                24-May-2024 14:02                6530
intlchar.getintpropertyvalue.php                   24-May-2024 14:02                7991
intlchar.getnumericvalue.php                       24-May-2024 14:02                5240
intlchar.getpropertyenum.php                       24-May-2024 14:02                6931
intlchar.getpropertyname.php                       24-May-2024 14:02                9285
intlchar.getpropertyvalueenum.php                  24-May-2024 14:02                8134
intlchar.getpropertyvaluename.php                  24-May-2024 14:02               10989
intlchar.getunicodeversion.php                     24-May-2024 14:02                4059
intlchar.hasbinaryproperty.php                     24-May-2024 14:02                9034
intlchar.isalnum.php                               24-May-2024 14:02                5634
intlchar.isalpha.php                               24-May-2024 14:02                5536
intlchar.isbase.php                                24-May-2024 14:02                6015
intlchar.isblank.php                               24-May-2024 14:02                6714
intlchar.iscntrl.php                               24-May-2024 14:02                6581
intlchar.isdefined.php                             24-May-2024 14:02                6820
intlchar.isdigit.php                               24-May-2024 14:02                5871
intlchar.isgraph.php                               24-May-2024 14:02                5532
intlchar.isidignorable.php                         24-May-2024 14:02                6249
intlchar.isidpart.php                              24-May-2024 14:02                6839
intlchar.isidstart.php                             24-May-2024 14:02                6276
intlchar.isisocontrol.php                          24-May-2024 14:02                5476
intlchar.isjavaidpart.php                          24-May-2024 14:02                6865
intlchar.isjavaidstart.php                         24-May-2024 14:02                6539
intlchar.isjavaspacechar.php                       24-May-2024 14:02                6770
intlchar.islower.php                               24-May-2024 14:02                7054
intlchar.ismirrored.php                            24-May-2024 14:02                5592
intlchar.isprint.php                               24-May-2024 14:02                5891
intlchar.ispunct.php                               24-May-2024 14:02                5274
intlchar.isspace.php                               24-May-2024 14:02                6366
intlchar.istitle.php                               24-May-2024 14:02                6458
intlchar.isualphabetic.php                         24-May-2024 14:02                5828
intlchar.isulowercase.php                          24-May-2024 14:02                6861
intlchar.isupper.php                               24-May-2024 14:02                7046
intlchar.isuuppercase.php                          24-May-2024 14:02                6906
intlchar.isuwhitespace.php                         24-May-2024 14:02                7389
intlchar.iswhitespace.php                          24-May-2024 14:02                7237
intlchar.isxdigit.php                              24-May-2024 14:02                6890
intlchar.ord.php                                   24-May-2024 14:02                5314
intlchar.tolower.php                               24-May-2024 14:02                7443
intlchar.totitle.php                               24-May-2024 14:02                7490
intlchar.toupper.php                               24-May-2024 14:02                7439
intlcodepointbreakiterator.getlastcodepoint.php    24-May-2024 14:02                2730
intldateformatter.create.php                       24-May-2024 14:02               25996
intldateformatter.format.php                       24-May-2024 14:02               25446
intldateformatter.formatobject.php                 24-May-2024 14:02               13172
intldateformatter.getcalendar.php                  24-May-2024 14:02                9089
intldateformatter.getcalendarobject.php            24-May-2024 14:02                6952
intldateformatter.getdatetype.php                  24-May-2024 14:02               11411
intldateformatter.geterrorcode.php                 24-May-2024 14:02                8856
intldateformatter.geterrormessage.php              24-May-2024 14:02                8768
intldateformatter.getlocale.php                    24-May-2024 14:02               12068
intldateformatter.getpattern.php                   24-May-2024 14:02               10162
intldateformatter.gettimetype.php                  24-May-2024 14:02               11419
intldateformatter.gettimezone.php                  24-May-2024 14:02                8343
intldateformatter.gettimezoneid.php                24-May-2024 14:02                8466
intldateformatter.islenient.php                    24-May-2024 14:02               14958
intldateformatter.localtime.php                    24-May-2024 14:02               11336
intldateformatter.parse.php                        24-May-2024 14:02               12341
intldateformatter.setcalendar.php                  24-May-2024 14:02               14160
intldateformatter.setlenient.php                   24-May-2024 14:02               14565
intldateformatter.setpattern.php                   24-May-2024 14:02               11128
intldateformatter.settimezone.php                  24-May-2024 14:02               11078
intliterator.current.php                           24-May-2024 14:02                2347
intliterator.key.php                               24-May-2024 14:02                2317
intliterator.next.php                              24-May-2024 14:02                2336
intliterator.rewind.php                            24-May-2024 14:02                2356
intliterator.valid.php                             24-May-2024 14:02                2357
intlpartsiterator.getbreakiterator.php             24-May-2024 14:02                2555
intlrulebasedbreakiterator.construct.php           24-May-2024 14:02                3218
intlrulebasedbreakiterator.getbinaryrules.php      24-May-2024 14:02                2717
intlrulebasedbreakiterator.getrules.php            24-May-2024 14:02                2687
intlrulebasedbreakiterator.getrulestatus.php       24-May-2024 14:02                2775
intlrulebasedbreakiterator.getrulestatusvec.php    24-May-2024 14:02                2783
intltimezone.construct.php                         24-May-2024 14:02                2001
intltimezone.countequivalentids.php                24-May-2024 14:02                2892
intltimezone.createdefault.php                     24-May-2024 14:02                2634
intltimezone.createenumeration.php                 24-May-2024 14:02                2968
intltimezone.createtimezone.php                    24-May-2024 14:02                2877
intltimezone.createtimezoneidenumeration.php       24-May-2024 14:02                5902
intltimezone.fromdatetimezone.php                  24-May-2024 14:02                2988
intltimezone.getcanonicalid.php                    24-May-2024 14:02                3268
intltimezone.getdisplayname.php                    24-May-2024 14:02                3509
intltimezone.getdstsavings.php                     24-May-2024 14:02                2608
intltimezone.getequivalentid.php                   24-May-2024 14:02                3140
intltimezone.geterrorcode.php                      24-May-2024 14:02                2997
intltimezone.geterrormessage.php                   24-May-2024 14:02                3006
intltimezone.getgmt.php                            24-May-2024 14:02                2496
intltimezone.getid.php                             24-May-2024 14:02                2446
intltimezone.getidforwindowsid.php                 24-May-2024 14:02                5915
intltimezone.getoffset.php                         24-May-2024 14:02                3769
intltimezone.getrawoffset.php                      24-May-2024 14:02                2558
intltimezone.getregion.php                         24-May-2024 14:02                3743
intltimezone.gettzdataversion.php                  24-May-2024 14:02                2629
intltimezone.getunknown.php                        24-May-2024 14:02                3186
intltimezone.getwindowsid.php                      24-May-2024 14:02                4484
intltimezone.hassamerules.php                      24-May-2024 14:02                2822
intltimezone.todatetimezone.php                    24-May-2024 14:02                2640
intltimezone.usedaylighttime.php                   24-May-2024 14:02                2565
intro-whatcando.php                                24-May-2024 14:02                8300
intro-whatis.php                                   24-May-2024 14:02                4151
intro.apache.php                                   24-May-2024 14:02                1234
intro.apcu.php                                     24-May-2024 14:02                1617
intro.array.php                                    24-May-2024 14:02                2019
intro.bc.php                                       24-May-2024 14:02                1302
intro.bzip2.php                                    24-May-2024 14:02                1258
intro.calendar.php                                 24-May-2024 14:02                2163
intro.classobj.php                                 24-May-2024 14:02                1817
intro.cmark.php                                    24-May-2024 14:02                7456
intro.com.php                                      24-May-2024 14:02                3127
intro.componere.php                                24-May-2024 14:02                6826
intro.ctype.php                                    24-May-2024 14:02                3681
intro.cubrid.php                                   24-May-2024 14:02                1546
intro.curl.php                                     24-May-2024 14:02                1656
intro.datetime.php                                 24-May-2024 14:02                2519
intro.dba.php                                      24-May-2024 14:02                1594
intro.dbase.php                                    24-May-2024 14:02                6824
intro.dio.php                                      24-May-2024 14:02                2108
intro.dom.php                                      24-May-2024 14:02                1743
intro.ds.php                                       24-May-2024 14:02                1495
intro.eio.php                                      24-May-2024 14:02               15046
intro.enchant.php                                  24-May-2024 14:02                2746
intro.errorfunc.php                                24-May-2024 14:02                2046
intro.ev.php                                       24-May-2024 14:02                2396
intro.event.php                                    24-May-2024 14:02                2106
intro.exec.php                                     24-May-2024 14:02                1853
intro.exif.php                                     24-May-2024 14:02                1568
intro.expect.php                                   24-May-2024 14:02                1499
intro.fann.php                                     24-May-2024 14:02                1530
intro.fdf.php                                      24-May-2024 14:02                3864
intro.ffi.php                                      24-May-2024 14:02                2895
intro.fileinfo.php                                 24-May-2024 14:02                1495
intro.filesystem.php                               24-May-2024 14:02                1527
intro.filter.php                                   24-May-2024 14:02                2995
intro.fpm.php                                      24-May-2024 14:02                1357
intro.ftp.php                                      24-May-2024 14:02                1934
intro.funchand.php                                 24-May-2024 14:02                1278
intro.gearman.php                                  24-May-2024 14:02                1768
intro.gender.php                                   24-May-2024 14:02                1388
intro.geoip.php                                    24-May-2024 14:02                1611
intro.gettext.php                                  24-May-2024 14:02                1690
intro.gmagick.php                                  24-May-2024 14:02                1780
intro.gmp.php                                      24-May-2024 14:02                3379
intro.gnupg.php                                    24-May-2024 14:02                1253
intro.hash.php                                     24-May-2024 14:02                1288
intro.hrtime.php                                   24-May-2024 14:02                1463
intro.ibase.php                                    24-May-2024 14:02                3268
intro.ibm-db2.php                                  24-May-2024 14:02                1308
intro.iconv.php                                    24-May-2024 14:02                2119
intro.igbinary.php                                 24-May-2024 14:02                1711
intro.image.php                                    24-May-2024 14:02                6691
intro.imagick.php                                  24-May-2024 14:02                1827
intro.imap.php                                     24-May-2024 14:02                1729
intro.info.php                                     24-May-2024 14:02                1578
intro.inotify.php                                  24-May-2024 14:02                2406
intro.intl.php                                     24-May-2024 14:02                5562
intro.json.php                                     24-May-2024 14:02                1719
intro.ldap.php                                     24-May-2024 14:02                4504
intro.libxml.php                                   24-May-2024 14:02                1827
intro.lua.php                                      24-May-2024 14:02                1339
intro.luasandbox.php                               24-May-2024 14:02                2401
intro.lzf.php                                      24-May-2024 14:02                1489
intro.mail.php                                     24-May-2024 14:02                1251
intro.mailparse.php                                24-May-2024 14:02                2032
intro.math.php                                     24-May-2024 14:02                1837
intro.mbstring.php                                 24-May-2024 14:02                3094
intro.mcrypt.php                                   24-May-2024 14:02                2286
intro.memcache.php                                 24-May-2024 14:02                1784
intro.memcached.php                                24-May-2024 14:02                2012
intro.mhash.php                                    24-May-2024 14:02                2874
intro.misc.php                                     24-May-2024 14:02                1247
intro.mqseries.php                                 24-May-2024 14:02                1780
intro.mysql-xdevapi.php                            24-May-2024 14:02                1916
intro.mysql.php                                    24-May-2024 14:02                2032
intro.mysqli.php                                   24-May-2024 14:02                2301
intro.mysqlnd.php                                  24-May-2024 14:02                2181
intro.network.php                                  24-May-2024 14:02                1190
intro.oauth.php                                    24-May-2024 14:02                1374
intro.oci8.php                                     24-May-2024 14:02                1683
intro.opcache.php                                  24-May-2024 14:02                1624
intro.openal.php                                   24-May-2024 14:02                1310
intro.openssl.php                                  24-May-2024 14:02                1511
intro.outcontrol.php                               24-May-2024 14:02                2491
intro.parallel.php                                 24-May-2024 14:02                6914
intro.parle.php                                    24-May-2024 14:02                3475
intro.password.php                                 24-May-2024 14:02                1725
intro.pcntl.php                                    24-May-2024 14:02                2807
intro.pcre.php                                     24-May-2024 14:02                2907
intro.pdo.php                                      24-May-2024 14:02                2546
intro.pgsql.php                                    24-May-2024 14:02                1740
intro.phar.php                                     24-May-2024 14:02               10742
intro.phpdbg.php                                   24-May-2024 14:02                6077
intro.posix.php                                    24-May-2024 14:02                1781
intro.ps.php                                       24-May-2024 14:02                1904
intro.pspell.php                                   24-May-2024 14:02                1248
intro.pthreads.php                                 24-May-2024 14:02                9202
intro.quickhash.php                                24-May-2024 14:02                1303
intro.radius.php                                   24-May-2024 14:02                2267
intro.random.php                                   24-May-2024 14:02                1145
intro.rar.php                                      24-May-2024 14:02                1583
intro.readline.php                                 24-May-2024 14:02                2117
intro.recode.php                                   24-May-2024 14:02                2304
intro.reflection.php                               24-May-2024 14:02                1945
intro.rnp.php                                      24-May-2024 14:02                1316
intro.rpminfo.php                                  24-May-2024 14:02                1433
intro.rrd.php                                      24-May-2024 14:02                1543
intro.runkit.php                                   24-May-2024 14:02                1859
intro.scoutapm.php                                 24-May-2024 14:02                1507
intro.seaslog.php                                  24-May-2024 14:02                3969
intro.sem.php                                      24-May-2024 14:02                3269
intro.session.php                                  24-May-2024 14:02                5731
intro.shmop.php                                    24-May-2024 14:02                1315
intro.simdjson.php                                 24-May-2024 14:02                1265
intro.simplexml.php                                24-May-2024 14:02                1390
intro.snmp.php                                     24-May-2024 14:02                1758
intro.soap.php                                     24-May-2024 14:02                1517
intro.sockets.php                                  24-May-2024 14:02                2794
intro.sodium.php                                   24-May-2024 14:02                1366
intro.solr.php                                     24-May-2024 14:02                1938
intro.spl.php                                      24-May-2024 14:02                1696
intro.sqlite3.php                                  24-May-2024 14:02                1203
intro.sqlsrv.php                                   24-May-2024 14:02                2265
intro.ssdeep.php                                   24-May-2024 14:02                1795
intro.ssh2.php                                     24-May-2024 14:02                1418
intro.stats.php                                    24-May-2024 14:02                1547
intro.stomp.php                                    24-May-2024 14:02                1427
intro.stream.php                                   24-May-2024 14:02                4202
intro.strings.php                                  24-May-2024 14:02                1726
intro.svm.php                                      24-May-2024 14:02                1322
intro.svn.php                                      24-May-2024 14:02                1881
intro.swoole.php                                   24-May-2024 14:02                1680
intro.sync.php                                     24-May-2024 14:02                2388
intro.taint.php                                    24-May-2024 14:02                4408
intro.tcpwrap.php                                  24-May-2024 14:02                1324
intro.tidy.php                                     24-May-2024 14:02                1337
intro.tokenizer.php                                24-May-2024 14:02                1631
intro.trader.php                                   24-May-2024 14:02                2571
intro.ui.php                                       24-May-2024 14:02                1237
intro.uodbc.php                                    24-May-2024 14:02                2915
intro.uopz.php                                     24-May-2024 14:02                2322
intro.url.php                                      24-May-2024 14:02                1192
intro.v8js.php                                     24-May-2024 14:02                1264
intro.var.php                                      24-May-2024 14:02                1393
intro.var_representation.php                       24-May-2024 14:02                1465
intro.varnish.php                                  24-May-2024 14:02                1385
intro.wddx.php                                     24-May-2024 14:02                2191
intro.win32service.php                             24-May-2024 14:02                1437
intro.wincache.php                                 24-May-2024 14:02                5583
intro.wkhtmltox.php                                24-May-2024 14:02                1331
intro.xattr.php                                    24-May-2024 14:02                1238
intro.xdiff.php                                    24-May-2024 14:02                2772
intro.xhprof.php                                   24-May-2024 14:02                3102
intro.xlswriter.php                                24-May-2024 14:02                1243
intro.xml.php                                      24-May-2024 14:02                2405
intro.xmldiff.php                                  24-May-2024 14:02                1503
intro.xmlreader.php                                24-May-2024 14:02                1677
intro.xmlrpc.php                                   24-May-2024 14:02                1969
intro.xmlwriter.php                                24-May-2024 14:02                1624
intro.xsl.php                                      24-May-2024 14:02                1378
intro.yac.php                                      24-May-2024 14:02                1269
intro.yaconf.php                                   24-May-2024 14:02                2678
intro.yaf.php                                      24-May-2024 14:02                1758
intro.yaml.php                                     24-May-2024 14:02                1464
intro.yar.php                                      24-May-2024 14:02                1335
intro.yaz.php                                      24-May-2024 14:02                2678
intro.zip.php                                      24-May-2024 14:02                1244
intro.zlib.php                                     24-May-2024 14:02                1810
intro.zmq.php                                      24-May-2024 14:02                1471
intro.zookeeper.php                                24-May-2024 14:02                1526
introduction.php                                   24-May-2024 14:02                1553
iterator.current.php                               24-May-2024 14:02                2180
iterator.key.php                                   24-May-2024 14:02                2578
iterator.next.php                                  24-May-2024 14:02                2421
iterator.rewind.php                                24-May-2024 14:02                2608
iterator.valid.php                                 24-May-2024 14:02                2804
iteratoraggregate.getiterator.php                  24-May-2024 14:02                2871
iteratoriterator.construct.php                     24-May-2024 14:02                3476
iteratoriterator.current.php                       24-May-2024 14:02                2743
iteratoriterator.getinneriterator.php              24-May-2024 14:02                3374
iteratoriterator.key.php                           24-May-2024 14:02                2695
iteratoriterator.next.php                          24-May-2024 14:02                2860
iteratoriterator.rewind.php                        24-May-2024 14:02                2878
iteratoriterator.valid.php                         24-May-2024 14:02                3058
json.configuration.php                             24-May-2024 14:02                1340
json.constants.php                                 24-May-2024 14:02               12673
json.installation.php                              24-May-2024 14:02                1799
json.requirements.php                              24-May-2024 14:02                1295
json.resources.php                                 24-May-2024 14:02                1272
json.setup.php                                     24-May-2024 14:02                1653
jsonserializable.jsonserialize.php                 24-May-2024 14:02               12251
langref.php                                        24-May-2024 14:02               21054
language.attributes.classes.php                    24-May-2024 14:02                6541
language.attributes.overview.php                   24-May-2024 14:02               10212
language.attributes.php                            24-May-2024 14:02                1775
language.attributes.reflection.php                 24-May-2024 14:02                8132
language.attributes.syntax.php                     24-May-2024 14:02                6091
language.basic-syntax.comments.php                 24-May-2024 14:02                4331
language.basic-syntax.instruction-separation.php   24-May-2024 14:02                3271
language.basic-syntax.php                          24-May-2024 14:02                1725
language.basic-syntax.phpmode.php                  24-May-2024 14:02                9683
language.basic-syntax.phptags.php                  24-May-2024 14:02                4046
language.constants.magic.php                       24-May-2024 14:02                5489
language.constants.php                             24-May-2024 14:02                6092
language.constants.predefined.php                  24-May-2024 14:02                1556
language.constants.syntax.php                      24-May-2024 14:02               10215
language.control-structures.php                    24-May-2024 14:02                2845
language.enumerations.backed.php                   24-May-2024 14:02                9882
language.enumerations.basics.php                   24-May-2024 14:02                8057
language.enumerations.constants.php                24-May-2024 14:02                2386
language.enumerations.examples.php                 24-May-2024 14:02                7310
language.enumerations.expressions.php              24-May-2024 14:02                6590
language.enumerations.listing.php                  24-May-2024 14:02                2222
language.enumerations.methods.php                  24-May-2024 14:02               13501
language.enumerations.object-differences.inheri..> 24-May-2024 14:02                6027
language.enumerations.object-differences.php       24-May-2024 14:02                4764
language.enumerations.overview.php                 24-May-2024 14:02                2339
language.enumerations.php                          24-May-2024 14:02                2532
language.enumerations.serialization.php            24-May-2024 14:02                4891
language.enumerations.static-methods.php           24-May-2024 14:02                3239
language.enumerations.traits.php                   24-May-2024 14:02                4339
language.errors.basics.php                         24-May-2024 14:02                5179
language.errors.php                                24-May-2024 14:02                1974
language.errors.php7.php                           24-May-2024 14:02                5353
language.exceptions.extending.php                  24-May-2024 14:02               22819
language.exceptions.php                            24-May-2024 14:02               14522
language.expressions.php                           24-May-2024 14:02               16213
language.fibers.php                                24-May-2024 14:02                6166
language.functions.php                             24-May-2024 14:02                2003
language.generators.comparison.php                 24-May-2024 14:02                8752
language.generators.overview.php                   24-May-2024 14:02                9321
language.generators.php                            24-May-2024 14:02                1690
language.generators.syntax.php                     24-May-2024 14:02               25799
language.namespaces.basics.php                     24-May-2024 14:02               11515
language.namespaces.definition.php                 24-May-2024 14:02                4223
language.namespaces.definitionmultiple.php         24-May-2024 14:02                9277
language.namespaces.dynamic.php                    24-May-2024 14:02                8638
language.namespaces.fallback.php                   24-May-2024 14:02                6148
language.namespaces.faq.php                        24-May-2024 14:02               33897
language.namespaces.global.php                     24-May-2024 14:02                2898
language.namespaces.importing.php                  24-May-2024 14:02               15816
language.namespaces.nested.php                     24-May-2024 14:02                2921
language.namespaces.nsconstants.php                24-May-2024 14:02                9042
language.namespaces.php                            24-May-2024 14:02                2701
language.namespaces.rationale.php                  24-May-2024 14:02                6918
language.namespaces.rules.php                      24-May-2024 14:02               12722
language.oop5.abstract.php                         24-May-2024 14:02               11723
language.oop5.anonymous.php                        24-May-2024 14:02               10542
language.oop5.autoload.php                         24-May-2024 14:02               11676
language.oop5.basic.php                            24-May-2024 14:02               45082
language.oop5.changelog.php                        24-May-2024 14:02                8154
language.oop5.cloning.php                          24-May-2024 14:02                9044
language.oop5.constants.php                        24-May-2024 14:02               11091
language.oop5.decon.php                            24-May-2024 14:02               23346
language.oop5.final.php                            24-May-2024 14:02                6077
language.oop5.inheritance.php                      24-May-2024 14:02               12919
language.oop5.interfaces.php                       24-May-2024 14:02               14176
language.oop5.iterations.php                       24-May-2024 14:02               17849
language.oop5.late-static-bindings.php             24-May-2024 14:02               14770
language.oop5.magic.php                            24-May-2024 14:02               38325
language.oop5.object-comparison.php                24-May-2024 14:02                8908
language.oop5.overloading.php                      24-May-2024 14:02               24841
language.oop5.paamayim-nekudotayim.php             24-May-2024 14:02                8666
language.oop5.php                                  24-May-2024 14:02                3511
language.oop5.properties.php                       24-May-2024 14:02               27377
language.oop5.references.php                       24-May-2024 14:02                5803
language.oop5.serialization.php                    24-May-2024 14:02                7659
language.oop5.static.php                           24-May-2024 14:02                9916
language.oop5.traits.php                           24-May-2024 14:02               30269
language.oop5.variance.php                         24-May-2024 14:02               15851
language.oop5.visibility.php                       24-May-2024 14:02               25070
language.operators.arithmetic.php                  24-May-2024 14:02                5573
language.operators.array.php                       24-May-2024 14:02                8968
language.operators.assignment.php                  24-May-2024 14:02                8733
language.operators.bitwise.php                     24-May-2024 14:02               44792
language.operators.comparison.php                  24-May-2024 14:02               36723
language.operators.errorcontrol.php                24-May-2024 14:02                5463
language.operators.execution.php                   24-May-2024 14:02                3358
language.operators.increment.php                   24-May-2024 14:02               10825
language.operators.logical.php                     24-May-2024 14:02                7810
language.operators.php                             24-May-2024 14:02                4089
language.operators.precedence.php                  24-May-2024 14:02               16112
language.operators.string.php                      24-May-2024 14:02                3194
language.operators.type.php                        24-May-2024 14:02               15931
language.references.arent.php                      24-May-2024 14:02                3266
language.references.pass.php                       24-May-2024 14:02                7297
language.references.php                            24-May-2024 14:02                2073
language.references.return.php                     24-May-2024 14:02                7293
language.references.spot.php                       24-May-2024 14:02                2818
language.references.unset.php                      24-May-2024 14:02                2324
language.references.whatare.php                    24-May-2024 14:02                2220
language.references.whatdo.php                     24-May-2024 14:02               19050
language.types.array.php                           24-May-2024 14:02               86350
language.types.boolean.php                         24-May-2024 14:02                9432
language.types.callable.php                        24-May-2024 14:02               12356
language.types.declarations.php                    24-May-2024 14:02               52851
language.types.enumerations.php                    24-May-2024 14:02                3654
language.types.float.php                           24-May-2024 14:02                9571
language.types.integer.php                         24-May-2024 14:02               18481
language.types.intro.php                           24-May-2024 14:02                7557
language.types.iterable.php                        24-May-2024 14:02                8896
language.types.mixed.php                           24-May-2024 14:02                1739
language.types.never.php                           24-May-2024 14:02                1936
language.types.null.php                            24-May-2024 14:02                3967
language.types.numeric-strings.php                 24-May-2024 14:02               10962
language.types.object.php                          24-May-2024 14:02                5614
language.types.php                                 24-May-2024 14:02                2915
language.types.relative-class-types.php            24-May-2024 14:02                2377
language.types.resource.php                        24-May-2024 14:02                3233
language.types.string.php                          24-May-2024 14:02               79389
language.types.type-juggling.php                   24-May-2024 14:02               14848
language.types.type-system.php                     24-May-2024 14:02                8419
language.types.value.php                           24-May-2024 14:02                2169
language.types.void.php                            24-May-2024 14:02                1963
language.variables.basics.php                      24-May-2024 14:02               13626
language.variables.external.php                    24-May-2024 14:02               17246
language.variables.php                             24-May-2024 14:02                1814
language.variables.predefined.php                  24-May-2024 14:02                3454
language.variables.scope.php                       24-May-2024 14:02               24460
language.variables.superglobals.php                24-May-2024 14:02                4353
language.variables.variable.php                    24-May-2024 14:02               11020
ldap.configuration.php                             24-May-2024 14:02                2572
ldap.constants.php                                 24-May-2024 14:02               19494
ldap.controls.php                                  24-May-2024 14:02                8787
ldap.examples-basic.php                            24-May-2024 14:02                8353
ldap.examples.php                                  24-May-2024 14:02                1398
ldap.installation.php                              24-May-2024 14:02                3093
ldap.requirements.php                              24-May-2024 14:02                1591
ldap.resources.php                                 24-May-2024 14:02                1500
ldap.setup.php                                     24-May-2024 14:02                1689
ldap.using.php                                     24-May-2024 14:02                2387
libxml.configuration.php                           24-May-2024 14:02                1354
libxml.constants.php                               24-May-2024 14:02               12834
libxml.installation.php                            24-May-2024 14:02                2666
libxml.requirements.php                            24-May-2024 14:02                1334
libxml.resources.php                               24-May-2024 14:02                1286
libxml.setup.php                                   24-May-2024 14:02                1695
limititerator.construct.php                        24-May-2024 14:02                6431
limititerator.current.php                          24-May-2024 14:02                3646
limititerator.getposition.php                      24-May-2024 14:02                5755
limititerator.key.php                              24-May-2024 14:02                3713
limititerator.next.php                             24-May-2024 14:02                3389
limititerator.rewind.php                           24-May-2024 14:02                3546
limititerator.seek.php                             24-May-2024 14:02                4277
limititerator.valid.php                            24-May-2024 14:02                3595
locale.acceptfromhttp.php                          24-May-2024 14:02                5819
locale.canonicalize.php                            24-May-2024 14:02                2825
locale.composelocale.php                           24-May-2024 14:02                9054
locale.filtermatches.php                           24-May-2024 14:02                8647
locale.getallvariants.php                          24-May-2024 14:02                6429
locale.getdefault.php                              24-May-2024 14:02                6080
locale.getdisplaylanguage.php                      24-May-2024 14:02                8966
locale.getdisplayname.php                          24-May-2024 14:02                8924
locale.getdisplayregion.php                        24-May-2024 14:02                8921
locale.getdisplayscript.php                        24-May-2024 14:02                8943
locale.getdisplayvariant.php                       24-May-2024 14:02                8970
locale.getkeywords.php                             24-May-2024 14:02                6850
locale.getprimarylanguage.php                      24-May-2024 14:02                5902
locale.getregion.php                               24-May-2024 14:02                5753
locale.getscript.php                               24-May-2024 14:02                5746
locale.lookup.php                                  24-May-2024 14:02                8866
locale.parselocale.php                             24-May-2024 14:02                7138
locale.setdefault.php                              24-May-2024 14:02                5691
lua.assign.php                                     24-May-2024 14:02                4680
lua.call.php                                       24-May-2024 14:02                7230
lua.configuration.php                              24-May-2024 14:02                1333
lua.construct.php                                  24-May-2024 14:02                2457
lua.eval.php                                       24-May-2024 14:02                3880
lua.getversion.php                                 24-May-2024 14:02                2325
lua.include.php                                    24-May-2024 14:02                2821
lua.installation.php                               24-May-2024 14:02                2139
lua.registercallback.php                           24-May-2024 14:02                4685
lua.requirements.php                               24-May-2024 14:02                1373
lua.resources.php                                  24-May-2024 14:02                1267
lua.setup.php                                      24-May-2024 14:02                1640
luaclosure.invoke.php                              24-May-2024 14:02                4168
luasandbox.callfunction.php                        24-May-2024 14:02                5080
luasandbox.configuration.php                       24-May-2024 14:02                1382
luasandbox.disableprofiler.php                     24-May-2024 14:02                2897
luasandbox.enableprofiler.php                      24-May-2024 14:02                3534
luasandbox.examples-basic.php                      24-May-2024 14:02                6650
luasandbox.examples.php                            24-May-2024 14:02                1506
luasandbox.getcpuusage.php                         24-May-2024 14:02                3645
luasandbox.getmemoryusage.php                      24-May-2024 14:02                3225
luasandbox.getpeakmemoryusage.php                  24-May-2024 14:02                3275
luasandbox.getprofilerfunctionreport.php           24-May-2024 14:02                6029
luasandbox.getversioninfo.php                      24-May-2024 14:02                3136
luasandbox.installation.php                        24-May-2024 14:02                2230
luasandbox.loadbinary.php                          24-May-2024 14:02                3663
luasandbox.loadstring.php                          24-May-2024 14:02                5652
luasandbox.pauseusagetimer.php                     24-May-2024 14:02                9446
luasandbox.registerlibrary.php                     24-May-2024 14:02                6664
luasandbox.requirements.php                        24-May-2024 14:02                1829
luasandbox.resources.php                           24-May-2024 14:02                1332
luasandbox.setcpulimit.php                         24-May-2024 14:02                6168
luasandbox.setmemorylimit.php                      24-May-2024 14:02                5573
luasandbox.setup.php                               24-May-2024 14:02                1731
luasandbox.unpauseusagetimer.php                   24-May-2024 14:02                3193
luasandbox.wrapphpfunction.php                     24-May-2024 14:02                4401
luasandboxfunction.call.php                        24-May-2024 14:02                8057
luasandboxfunction.construct.php                   24-May-2024 14:02                2713
luasandboxfunction.dump.php                        24-May-2024 14:02                2477
lzf.configuration.php                              24-May-2024 14:02                1333
lzf.constants.php                                  24-May-2024 14:02                1184
lzf.installation.php                               24-May-2024 14:02                2625
lzf.requirements.php                               24-May-2024 14:02                1261
lzf.resources.php                                  24-May-2024 14:02                1265
lzf.setup.php                                      24-May-2024 14:02                1662
mail.configuration.php                             24-May-2024 14:02                8583
mail.constants.php                                 24-May-2024 14:02                1196
mail.installation.php                              24-May-2024 14:02                1312
mail.requirements.php                              24-May-2024 14:02                1930
mail.resources.php                                 24-May-2024 14:02                1272
mail.setup.php                                     24-May-2024 14:02                1676
mailparse.configuration.php                        24-May-2024 14:02                2680
mailparse.constants.php                            24-May-2024 14:02                2417
mailparse.installation.php                         24-May-2024 14:02                2651
mailparse.requirements.php                         24-May-2024 14:02                1303
mailparse.resources.php                            24-May-2024 14:02                1611
mailparse.setup.php                                24-May-2024 14:02                1739
manual.php                                         24-May-2024 14:02                1295
math.configuration.php                             24-May-2024 14:02                1340
math.constants.php                                 24-May-2024 14:02                7375
math.installation.php                              24-May-2024 14:02                1312
math.requirements.php                              24-May-2024 14:02                1268
math.resources.php                                 24-May-2024 14:02                1272
math.setup.php                                     24-May-2024 14:02                1669
mbstring.configuration.php                         24-May-2024 14:02               17347
mbstring.constants.php                             24-May-2024 14:02                7180
mbstring.encodings.php                             24-May-2024 14:02               16055
mbstring.http.php                                  24-May-2024 14:02                6287
mbstring.installation.php                          24-May-2024 14:02                5362
mbstring.ja-basic.php                              24-May-2024 14:02                4156
mbstring.overload.php                              24-May-2024 14:02                8337
mbstring.php4.req.php                              24-May-2024 14:02                4357
mbstring.requirements.php                          24-May-2024 14:02                1296
mbstring.resources.php                             24-May-2024 14:02                1300
mbstring.setup.php                                 24-May-2024 14:02                1764
mbstring.supported-encodings.php                   24-May-2024 14:02                8508
mcrypt.ciphers.php                                 24-May-2024 14:02                6267
mcrypt.configuration.php                           24-May-2024 14:02                3802
mcrypt.constants.php                               24-May-2024 14:02                6491
mcrypt.installation.php                            24-May-2024 14:02                1901
mcrypt.requirements.php                            24-May-2024 14:02                2190
mcrypt.resources.php                               24-May-2024 14:02                1382
mcrypt.setup.php                                   24-May-2024 14:02                1706
memcache.add.php                                   24-May-2024 14:02                7227
memcache.addserver.php                             24-May-2024 14:02               14308
memcache.close.php                                 24-May-2024 14:02                5046
memcache.connect.php                               24-May-2024 14:02                7591
memcache.constants.php                             24-May-2024 14:02                4712
memcache.decrement.php                             24-May-2024 14:02                7192
memcache.delete.php                                24-May-2024 14:02                6646
memcache.examples-overview.php                     24-May-2024 14:02                6516
memcache.examples.php                              24-May-2024 14:02                1450
memcache.flush.php                                 24-May-2024 14:02                4493
memcache.get.php                                   24-May-2024 14:02                9023
memcache.getextendedstats.php                      24-May-2024 14:02                8442
memcache.getserverstatus.php                       24-May-2024 14:02                6318
memcache.getstats.php                              24-May-2024 14:02                4934
memcache.getversion.php                            24-May-2024 14:02                4860
memcache.increment.php                             24-May-2024 14:02                6958
memcache.ini.php                                   24-May-2024 14:02               10682
memcache.installation.php                          24-May-2024 14:02                2271
memcache.pconnect.php                              24-May-2024 14:02                6441
memcache.replace.php                               24-May-2024 14:02                7400
memcache.requirements.php                          24-May-2024 14:02                1533
memcache.resources.php                             24-May-2024 14:02                1360
memcache.set.php                                   24-May-2024 14:02                9714
memcache.setcompressthreshold.php                  24-May-2024 14:02                6088
memcache.setserverparams.php                       24-May-2024 14:02               11404
memcache.setup.php                                 24-May-2024 14:02                1725
memcached.add.php                                  24-May-2024 14:02                4775
memcached.addbykey.php                             24-May-2024 14:02                5811
memcached.addserver.php                            24-May-2024 14:02                8113
memcached.addservers.php                           24-May-2024 14:02                5699
memcached.append.php                               24-May-2024 14:02                7255
memcached.appendbykey.php                          24-May-2024 14:02                4986
memcached.callbacks.php                            24-May-2024 14:02                1613
memcached.callbacks.read-through.php               24-May-2024 14:02                4503
memcached.callbacks.result.php                     24-May-2024 14:02                4947
memcached.cas.php                                  24-May-2024 14:02                9511
memcached.casbykey.php                             24-May-2024 14:02                5891
memcached.configuration.php                        24-May-2024 14:02               11714
memcached.constants.php                            24-May-2024 14:02               24858
memcached.construct.php                            24-May-2024 14:02                4520
memcached.decrement.php                            24-May-2024 14:02                9206
memcached.decrementbykey.php                       24-May-2024 14:02                6092
memcached.delete.php                               24-May-2024 14:02                6297
memcached.deletebykey.php                          24-May-2024 14:02                5239
memcached.deletemulti.php                          24-May-2024 14:02                5346
memcached.deletemultibykey.php                     24-May-2024 14:02                5300
memcached.expiration.php                           24-May-2024 14:02                2084
memcached.fetch.php                                24-May-2024 14:02                6728
memcached.fetchall.php                             24-May-2024 14:02                6503
memcached.flush.php                                24-May-2024 14:02                4868
memcached.get.php                                  24-May-2024 14:02                9082
memcached.getallkeys.php                           24-May-2024 14:02                2851
memcached.getbykey.php                             24-May-2024 14:02                5650
memcached.getdelayed.php                           24-May-2024 14:02                8721
memcached.getdelayedbykey.php                      24-May-2024 14:02                5694
memcached.getmulti.php                             24-May-2024 14:02               13202
memcached.getmultibykey.php                        24-May-2024 14:02                5526
memcached.getoption.php                            24-May-2024 14:02                5274
memcached.getresultcode.php                        24-May-2024 14:02                4334
memcached.getresultmessage.php                     24-May-2024 14:02                4762
memcached.getserverbykey.php                       24-May-2024 14:02                7421
memcached.getserverlist.php                        24-May-2024 14:02                4693
memcached.getstats.php                             24-May-2024 14:02                5109
memcached.getversion.php                           24-May-2024 14:02                4003
memcached.increment.php                            24-May-2024 14:02                8527
memcached.incrementbykey.php                       24-May-2024 14:02                5983
memcached.installation.php                         24-May-2024 14:02                2881
memcached.ispersistent.php                         24-May-2024 14:02                2941
memcached.ispristine.php                           24-May-2024 14:02                2872
memcached.prepend.php                              24-May-2024 14:02                7284
memcached.prependbykey.php                         24-May-2024 14:02                5015
memcached.quit.php                                 24-May-2024 14:02                2508
memcached.replace.php                              24-May-2024 14:02                4857
memcached.replacebykey.php                         24-May-2024 14:02                5889
memcached.requirements.php                         24-May-2024 14:02                1633
memcached.resetserverlist.php                      24-May-2024 14:02                3297
memcached.resources.php                            24-May-2024 14:02                1307
memcached.sessions.php                             24-May-2024 14:02                2656
memcached.set.php                                  24-May-2024 14:02                9387
memcached.setbykey.php                             24-May-2024 14:02                7199
memcached.setmulti.php                             24-May-2024 14:02                6381
memcached.setmultibykey.php                        24-May-2024 14:02                5123
memcached.setoption.php                            24-May-2024 14:02                7115
memcached.setoptions.php                           24-May-2024 14:02                7085
memcached.setsaslauthdata.php                      24-May-2024 14:02                3437
memcached.setup.php                                24-May-2024 14:02                1748
memcached.touch.php                                24-May-2024 14:02                3856
memcached.touchbykey.php                           24-May-2024 14:02                4820
messageformatter.create.php                        24-May-2024 14:02               10668
messageformatter.format.php                        24-May-2024 14:02                9678
messageformatter.formatmessage.php                 24-May-2024 14:02               10414
messageformatter.geterrorcode.php                  24-May-2024 14:02                7756
messageformatter.geterrormessage.php               24-May-2024 14:02                7762
messageformatter.getlocale.php                     24-May-2024 14:02                5616
messageformatter.getpattern.php                    24-May-2024 14:02                9877
messageformatter.parse.php                         24-May-2024 14:02                9726
messageformatter.parsemessage.php                  24-May-2024 14:02               10010
messageformatter.setpattern.php                    24-May-2024 14:02               10863
mhash.configuration.php                            24-May-2024 14:02                1347
mhash.constants.php                                24-May-2024 14:02                7240
mhash.examples.php                                 24-May-2024 14:02                3332
mhash.installation.php                             24-May-2024 14:02                1681
mhash.requirements.php                             24-May-2024 14:02                1400
mhash.resources.php                                24-May-2024 14:02                1279
mhash.setup.php                                    24-May-2024 14:02                1687
migration56.changed-functions.php                  24-May-2024 14:02                6931
migration56.constants.php                          24-May-2024 14:02                6112
migration56.deprecated.php                         24-May-2024 14:02                6284
migration56.extensions.php                         24-May-2024 14:02                4377
migration56.incompatible.php                       24-May-2024 14:02                8622
migration56.new-features.php                       24-May-2024 14:02               28933
migration56.new-functions.php                      24-May-2024 14:02                7559
migration56.openssl.php                            24-May-2024 14:02               25973
migration56.php                                    24-May-2024 14:02                2556
migration70.changed-functions.php                  24-May-2024 14:02                5253
migration70.classes.php                            24-May-2024 14:02                3939
migration70.constants.php                          24-May-2024 14:02                9333
migration70.deprecated.php                         24-May-2024 14:02                5709
migration70.incompatible.php                       24-May-2024 14:02               62234
migration70.new-features.php                       24-May-2024 14:02               41026
migration70.new-functions.php                      24-May-2024 14:02                7397
migration70.other-changes.php                      24-May-2024 14:02                3466
migration70.php                                    24-May-2024 14:02                2960
migration70.removed-exts-sapis.php                 24-May-2024 14:02                3193
migration70.sapi-changes.php                       24-May-2024 14:02                2038
migration71.changed-functions.php                  24-May-2024 14:02                7110
migration71.constants.php                          24-May-2024 14:02                8720
migration71.deprecated.php                         24-May-2024 14:02                2347
migration71.incompatible.php                       24-May-2024 14:02               30947
migration71.new-features.php                       24-May-2024 14:02               27751
migration71.new-functions.php                      24-May-2024 14:02                5150
migration71.other-changes.php                      24-May-2024 14:02                8907
migration71.php                                    24-May-2024 14:02                2662
migration71.windows-support.php                    24-May-2024 14:02                1760
migration72.constants.php                          24-May-2024 14:02               31932
migration72.deprecated.php                         24-May-2024 14:02               10831
migration72.incompatible.php                       24-May-2024 14:02               19993
migration72.new-features.php                       24-May-2024 14:02               19017
migration72.new-functions.php                      24-May-2024 14:02               24453
migration72.other-changes.php                      24-May-2024 14:02                6027
migration72.php                                    24-May-2024 14:02                2523
migration73.constants.php                          24-May-2024 14:02               24020
migration73.deprecated.php                         24-May-2024 14:02                8822
migration73.incompatible.php                       24-May-2024 14:02               18746
migration73.new-features.php                       24-May-2024 14:02               17437
migration73.new-functions.php                      24-May-2024 14:02                7514
migration73.other-changes.php                      24-May-2024 14:02               16373
migration73.php                                    24-May-2024 14:02                2687
migration73.windows-support.php                    24-May-2024 14:02                1977
migration74.constants.php                          24-May-2024 14:02                7792
migration74.deprecated.php                         24-May-2024 14:02               15194
migration74.incompatible.php                       24-May-2024 14:02               18084
migration74.new-classes.php                        24-May-2024 14:02                1565
migration74.new-features.php                       24-May-2024 14:02               21915
migration74.new-functions.php                      24-May-2024 14:02                3447
migration74.other-changes.php                      24-May-2024 14:02               21297
migration74.php                                    24-May-2024 14:02                2918
migration74.removed-extensions.php                 24-May-2024 14:02                1991
migration74.windows-support.php                    24-May-2024 14:02                4019
migration80.deprecated.php                         24-May-2024 14:02               18454
migration80.incompatible.php                       24-May-2024 14:02               95431
migration80.new-features.php                       24-May-2024 14:02               31601
migration80.other-changes.php                      24-May-2024 14:02               14607
migration80.php                                    24-May-2024 14:02                2534
migration81.constants.php                          24-May-2024 14:02                7669
migration81.deprecated.php                         24-May-2024 14:02               19510
migration81.incompatible.php                       24-May-2024 14:02               18935
migration81.new-classes.php                        24-May-2024 14:02                2104
migration81.new-features.php                       24-May-2024 14:02               23727
migration81.new-functions.php                      24-May-2024 14:02                8521
migration81.other-changes.php                      24-May-2024 14:02                9819
migration81.php                                    24-May-2024 14:02                2716
migration82.constants.php                          24-May-2024 14:02               21152
migration82.deprecated.php                         24-May-2024 14:02                5998
migration82.incompatible.php                       24-May-2024 14:02                9683
migration82.new-features.php                       24-May-2024 14:02                7114
migration82.new-functions.php                      24-May-2024 14:02                4334
migration82.other-changes.php                      24-May-2024 14:02               25750
migration82.php                                    24-May-2024 14:02                2683
migration82.windows-support.php                    24-May-2024 14:02                2355
migration83.constants.php                          24-May-2024 14:02               13085
migration83.deprecated.php                         24-May-2024 14:02                7752
migration83.incompatible.php                       24-May-2024 14:02               14704
migration83.new-classes.php                        24-May-2024 14:02                3151
migration83.new-features.php                       24-May-2024 14:02                7289
migration83.new-functions.php                      24-May-2024 14:02                7229
migration83.other-changes.php                      24-May-2024 14:02               32017
migration83.php                                    24-May-2024 14:02                2800
migration83.windows-support.php                    24-May-2024 14:02                1427
misc.configuration.php                             24-May-2024 14:02                6476
misc.constants.php                                 24-May-2024 14:02                2632
misc.installation.php                              24-May-2024 14:02                1312
misc.requirements.php                              24-May-2024 14:02                1268
misc.resources.php                                 24-May-2024 14:02                1272
misc.setup.php                                     24-May-2024 14:02                1662
mongodb-bson-binary.construct.php                  24-May-2024 14:02                8004
mongodb-bson-binary.getdata.php                    24-May-2024 14:02                4469
mongodb-bson-binary.gettype.php                    24-May-2024 14:02                4451
mongodb-bson-binary.jsonserialize.php              24-May-2024 14:02                5466
mongodb-bson-binary.serialize.php                  24-May-2024 14:02                3563
mongodb-bson-binary.tostring.php                   24-May-2024 14:02                4237
mongodb-bson-binary.unserialize.php                24-May-2024 14:02                4385
mongodb-bson-binaryinterface.getdata.php           24-May-2024 14:02                2878
mongodb-bson-binaryinterface.gettype.php           24-May-2024 14:02                2888
mongodb-bson-binaryinterface.tostring.php          24-May-2024 14:02                3342
mongodb-bson-dbpointer.construct.php               24-May-2024 14:02                2701
mongodb-bson-dbpointer.jsonserialize.php           24-May-2024 14:02                5535
mongodb-bson-dbpointer.serialize.php               24-May-2024 14:02                3638
mongodb-bson-dbpointer.tostring.php                24-May-2024 14:02                2720
mongodb-bson-dbpointer.unserialize.php             24-May-2024 14:02                3884
mongodb-bson-decimal128.construct.php              24-May-2024 14:02                5811
mongodb-bson-decimal128.jsonserialize.php          24-May-2024 14:02                5556
mongodb-bson-decimal128.serialize.php              24-May-2024 14:02                3663
mongodb-bson-decimal128.tostring.php               24-May-2024 14:02                4585
mongodb-bson-decimal128.unserialize.php            24-May-2024 14:02                4477
mongodb-bson-decimal128interface.tostring.php      24-May-2024 14:02                3041
mongodb-bson-int64.construct.php                   24-May-2024 14:02                4826
mongodb-bson-int64.jsonserialize.php               24-May-2024 14:02                5212
mongodb-bson-int64.serialize.php                   24-May-2024 14:02                3540
mongodb-bson-int64.tostring.php                    24-May-2024 14:02                3903
mongodb-bson-int64.unserialize.php                 24-May-2024 14:02                4356
mongodb-bson-javascript.construct.php              24-May-2024 14:02                7315
mongodb-bson-javascript.getcode.php                24-May-2024 14:02                4441
mongodb-bson-javascript.getscope.php               24-May-2024 14:02                5417
mongodb-bson-javascript.jsonserialize.php          24-May-2024 14:02                5552
mongodb-bson-javascript.serialize.php              24-May-2024 14:02                3663
mongodb-bson-javascript.tostring.php               24-May-2024 14:02                4231
mongodb-bson-javascript.unserialize.php            24-May-2024 14:02                4469
mongodb-bson-javascriptinterface.getcode.php       24-May-2024 14:02                2972
mongodb-bson-javascriptinterface.getscope.php      24-May-2024 14:02                3137
mongodb-bson-javascriptinterface.tostring.php      24-May-2024 14:02                3440
mongodb-bson-maxkey.construct.php                  24-May-2024 14:02                3694
mongodb-bson-maxkey.jsonserialize.php              24-May-2024 14:02                5472
mongodb-bson-maxkey.serialize.php                  24-May-2024 14:02                3567
mongodb-bson-maxkey.unserialize.php                24-May-2024 14:02                3817
mongodb-bson-minkey.construct.php                  24-May-2024 14:02                3694
mongodb-bson-minkey.jsonserialize.php              24-May-2024 14:02                5472
mongodb-bson-minkey.serialize.php                  24-May-2024 14:02                3567
mongodb-bson-minkey.unserialize.php                24-May-2024 14:02                3821
mongodb-bson-objectid.construct.php                24-May-2024 14:02                5322
mongodb-bson-objectid.gettimestamp.php             24-May-2024 14:02                5567
mongodb-bson-objectid.jsonserialize.php            24-May-2024 14:02                5518
mongodb-bson-objectid.serialize.php                24-May-2024 14:02                3615
mongodb-bson-objectid.tostring.php                 24-May-2024 14:02                4231
mongodb-bson-objectid.unserialize.php              24-May-2024 14:02                4423
mongodb-bson-objectidinterface.gettimestamp.php    24-May-2024 14:02                3041
mongodb-bson-objectidinterface.tostring.php        24-May-2024 14:02                3025
mongodb-bson-regex.construct.php                   24-May-2024 14:02                7076
mongodb-bson-regex.getflags.php                    24-May-2024 14:02                4557
mongodb-bson-regex.getpattern.php                  24-May-2024 14:02                4419
mongodb-bson-regex.jsonserialize.php               24-May-2024 14:02                5451
mongodb-bson-regex.serialize.php                   24-May-2024 14:02                3538
mongodb-bson-regex.tostring.php                    24-May-2024 14:02                3933
mongodb-bson-regex.unserialize.php                 24-May-2024 14:02                4360
mongodb-bson-regexinterface.getflags.php           24-May-2024 14:02                2877
mongodb-bson-regexinterface.getpattern.php         24-May-2024 14:02                2920
mongodb-bson-regexinterface.tostring.php           24-May-2024 14:02                2951
mongodb-bson-serializable.bsonserialize.php        24-May-2024 14:02               16255
mongodb-bson-symbol.construct.php                  24-May-2024 14:02                2641
mongodb-bson-symbol.jsonserialize.php              24-May-2024 14:02                5472
mongodb-bson-symbol.serialize.php                  24-May-2024 14:02                3563
mongodb-bson-symbol.tostring.php                   24-May-2024 14:02                2698
mongodb-bson-symbol.unserialize.php                24-May-2024 14:02                3823
mongodb-bson-timestamp.construct.php               24-May-2024 14:02                4875
mongodb-bson-timestamp.getincrement.php            24-May-2024 14:02                4387
mongodb-bson-timestamp.gettimestamp.php            24-May-2024 14:02                4372
mongodb-bson-timestamp.jsonserialize.php           24-May-2024 14:02                5539
mongodb-bson-timestamp.serialize.php               24-May-2024 14:02                3638
mongodb-bson-timestamp.tostring.php                24-May-2024 14:02                4073
mongodb-bson-timestamp.unserialize.php             24-May-2024 14:02                4456
mongodb-bson-timestampinterface.getincrement.php   24-May-2024 14:02                3409
mongodb-bson-timestampinterface.gettimestamp.php   24-May-2024 14:02                3424
mongodb-bson-timestampinterface.tostring.php       24-May-2024 14:02                3043
mongodb-bson-undefined.construct.php               24-May-2024 14:02                2701
mongodb-bson-undefined.jsonserialize.php           24-May-2024 14:02                5535
mongodb-bson-undefined.serialize.php               24-May-2024 14:02                3638
mongodb-bson-undefined.tostring.php                24-May-2024 14:02                2720
mongodb-bson-undefined.unserialize.php             24-May-2024 14:02                3885
mongodb-bson-unserializable.bsonunserialize.php    24-May-2024 14:02                7115
mongodb-bson-utcdatetime.construct.php             24-May-2024 14:02                8224
mongodb-bson-utcdatetime.jsonserialize.php         24-May-2024 14:02                5577
mongodb-bson-utcdatetime.serialize.php             24-May-2024 14:02                3690
mongodb-bson-utcdatetime.todatetime.php            24-May-2024 14:02                5888
mongodb-bson-utcdatetime.tostring.php              24-May-2024 14:02                4031
mongodb-bson-utcdatetime.unserialize.php           24-May-2024 14:02                4488
mongodb-bson-utcdatetimeinterface.todatetime.php   24-May-2024 14:02                3320
mongodb-bson-utcdatetimeinterface.tostring.php     24-May-2024 14:02                3059
mongodb-driver-bulkwrite.construct.php             24-May-2024 14:02               18718
mongodb-driver-bulkwrite.count.php                 24-May-2024 14:02                6998
mongodb-driver-bulkwrite.delete.php                24-May-2024 14:02               11808
mongodb-driver-bulkwrite.insert.php                24-May-2024 14:02                9673
mongodb-driver-bulkwrite.update.php                24-May-2024 14:02               15418
mongodb-driver-clientencryption.addkeyaltname.php  24-May-2024 14:02                5629
mongodb-driver-clientencryption.construct.php      24-May-2024 14:02               11365
mongodb-driver-clientencryption.createdatakey.php  24-May-2024 14:02               11070
mongodb-driver-clientencryption.decrypt.php        24-May-2024 14:02                4255
mongodb-driver-clientencryption.deletekey.php      24-May-2024 14:02                4371
mongodb-driver-clientencryption.encrypt.php        24-May-2024 14:02               12882
mongodb-driver-clientencryption.encryptexpressi..> 24-May-2024 14:02               14580
mongodb-driver-clientencryption.getkey.php         24-May-2024 14:02                4504
mongodb-driver-clientencryption.getkeybyaltname..> 24-May-2024 14:02                5099
mongodb-driver-clientencryption.getkeys.php        24-May-2024 14:02                3934
mongodb-driver-clientencryption.removekeyaltnam..> 24-May-2024 14:02                5694
mongodb-driver-clientencryption.rewrapmanydatak..> 24-May-2024 14:02               12075
mongodb-driver-command.construct.php               24-May-2024 14:02               14293
mongodb-driver-commandexception.getresultdocume..> 24-May-2024 14:02                3293
mongodb-driver-cursor.construct.php                24-May-2024 14:02                3375
mongodb-driver-cursor.current.php                  24-May-2024 14:02                3140
mongodb-driver-cursor.getid.php                    24-May-2024 14:02                7659
mongodb-driver-cursor.getserver.php                24-May-2024 14:02                7552
mongodb-driver-cursor.isdead.php                   24-May-2024 14:02               10678
mongodb-driver-cursor.key.php                      24-May-2024 14:02                2694
mongodb-driver-cursor.next.php                     24-May-2024 14:02                3574
mongodb-driver-cursor.rewind.php                   24-May-2024 14:02                4029
mongodb-driver-cursor.settypemap.php               24-May-2024 14:02                8017
mongodb-driver-cursor.toarray.php                  24-May-2024 14:02                7745
mongodb-driver-cursor.valid.php                    24-May-2024 14:02                2902
mongodb-driver-cursorid.construct.php              24-May-2024 14:02                2863
mongodb-driver-cursorid.serialize.php              24-May-2024 14:02                3661
mongodb-driver-cursorid.tostring.php               24-May-2024 14:02                7027
mongodb-driver-cursorid.unserialize.php            24-May-2024 14:02                4495
mongodb-driver-cursorinterface.getid.php           24-May-2024 14:02                4069
mongodb-driver-cursorinterface.getserver.php       24-May-2024 14:02                4170
mongodb-driver-cursorinterface.isdead.php          24-May-2024 14:02                4133
mongodb-driver-cursorinterface.settypemap.php      24-May-2024 14:02                4161
mongodb-driver-cursorinterface.toarray.php         24-May-2024 14:02                4032
mongodb-driver-manager.addsubscriber.php           24-May-2024 14:02                5549
mongodb-driver-manager.construct.php               24-May-2024 14:02               80206
mongodb-driver-manager.createclientencryption.php  24-May-2024 14:02               12699
mongodb-driver-manager.executebulkwrite.php        24-May-2024 14:02               23163
mongodb-driver-manager.executecommand.php          24-May-2024 14:02               24677
mongodb-driver-manager.executequery.php            24-May-2024 14:02               16448
mongodb-driver-manager.executereadcommand.php      24-May-2024 14:02                9938
mongodb-driver-manager.executereadwritecommand.php 24-May-2024 14:02               11017
mongodb-driver-manager.executewritecommand.php     24-May-2024 14:02               11191
mongodb-driver-manager.getencryptedfieldsmap.php   24-May-2024 14:02                3967
mongodb-driver-manager.getreadconcern.php          24-May-2024 14:02                5956
mongodb-driver-manager.getreadpreference.php       24-May-2024 14:02                6551
mongodb-driver-manager.getservers.php              24-May-2024 14:02                7992
mongodb-driver-manager.getwriteconcern.php         24-May-2024 14:02                6009
mongodb-driver-manager.removesubscriber.php        24-May-2024 14:02                4988
mongodb-driver-manager.selectserver.php            24-May-2024 14:02                7283
mongodb-driver-manager.startsession.php            24-May-2024 14:02               12439
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                3767
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                3694
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                3866
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                3695
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                4893
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                4092
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                4322
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                4248
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                4089
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 14:02                3873
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 14:02                4099
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 14:02                3803
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 14:02                3705
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 14:02                5202
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 14:02                4783
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 14:02                4539
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 14:02                4109
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 14:02                3893
mongodb-driver-monitoring-commandsubscriber.com..> 24-May-2024 14:02                4970
mongodb-driver-monitoring-commandsubscriber.com..> 24-May-2024 14:02                5020
mongodb-driver-monitoring-commandsubscriber.com..> 24-May-2024 14:02                5035
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 14:02                3824
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 14:02                3751
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 14:02                3935
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 14:02                4980
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 14:02                4149
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 14:02                4385
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 14:02                4753
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 14:02                4149
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 14:02                3919
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 14:02                4853
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 14:02                4823
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 14:02                5390
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 14:02                5435
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 14:02                5466
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 14:02                4853
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-May-2024 14:02                4928
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-May-2024 14:02                4865
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-May-2024 14:02                4848
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 14:02                3238
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 14:02                3554
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 14:02                3306
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 14:02                3631
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 14:02                3354
mongodb-driver-monitoring-serverclosedevent.get..> 24-May-2024 14:02                3200
mongodb-driver-monitoring-serverclosedevent.get..> 24-May-2024 14:02                3250
mongodb-driver-monitoring-serverclosedevent.get..> 24-May-2024 14:02                3310
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 14:02                3686
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 14:02                3538
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 14:02                3375
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 14:02                3404
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 14:02                3760
mongodb-driver-monitoring-serverheartbeatstarte..> 24-May-2024 14:02                3380
mongodb-driver-monitoring-serverheartbeatstarte..> 24-May-2024 14:02                3422
mongodb-driver-monitoring-serverheartbeatstarte..> 24-May-2024 14:02                3780
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 14:02                3738
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 14:02                3447
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 14:02                3456
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 14:02                4286
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 14:02                3796
mongodb-driver-monitoring-serveropeningevent.ge..> 24-May-2024 14:02                3218
mongodb-driver-monitoring-serveropeningevent.ge..> 24-May-2024 14:02                3268
mongodb-driver-monitoring-serveropeningevent.ge..> 24-May-2024 14:02                3342
mongodb-driver-monitoring-topologychangedevent...> 24-May-2024 14:02                3623
mongodb-driver-monitoring-topologychangedevent...> 24-May-2024 14:02                3701
mongodb-driver-monitoring-topologychangedevent...> 24-May-2024 14:02                3362
mongodb-driver-monitoring-topologyclosedevent.g..> 24-May-2024 14:02                3307
mongodb-driver-monitoring-topologyopeningevent...> 24-May-2024 14:02                3317
mongodb-driver-query.construct.php                 24-May-2024 14:02               32614
mongodb-driver-readconcern.bsonserialize.php       24-May-2024 14:02                6830
mongodb-driver-readconcern.construct.php           24-May-2024 14:02                5775
mongodb-driver-readconcern.getlevel.php            24-May-2024 14:02                5846
mongodb-driver-readconcern.isdefault.php           24-May-2024 14:02                8120
mongodb-driver-readconcern.serialize.php           24-May-2024 14:02                3738
mongodb-driver-readconcern.unserialize.php         24-May-2024 14:02                4546
mongodb-driver-readpreference.bsonserialize.php    24-May-2024 14:02               10465
mongodb-driver-readpreference.construct.php        24-May-2024 14:02               18501
mongodb-driver-readpreference.gethedge.php         24-May-2024 14:02                3479
mongodb-driver-readpreference.getmaxstalenessse..> 24-May-2024 14:02                8218
mongodb-driver-readpreference.getmode.php          24-May-2024 14:02                7542
mongodb-driver-readpreference.getmodestring.php    24-May-2024 14:02                7748
mongodb-driver-readpreference.gettagsets.php       24-May-2024 14:02                8103
mongodb-driver-readpreference.serialize.php        24-May-2024 14:02                3815
mongodb-driver-readpreference.unserialize.php      24-May-2024 14:02                4625
mongodb-driver-runtimeexception.haserrorlabel.php  24-May-2024 14:02                4316
mongodb-driver-server.construct.php                24-May-2024 14:02                3407
mongodb-driver-server.executebulkwrite.php         24-May-2024 14:02               11454
mongodb-driver-server.executecommand.php           24-May-2024 14:02               13054
mongodb-driver-server.executequery.php             24-May-2024 14:02                8887
mongodb-driver-server.executereadcommand.php       24-May-2024 14:02               10560
mongodb-driver-server.executereadwritecommand.php  24-May-2024 14:02               11530
mongodb-driver-server.executewritecommand.php      24-May-2024 14:02               11670
mongodb-driver-server.gethost.php                  24-May-2024 14:02                5509
mongodb-driver-server.getinfo.php                  24-May-2024 14:02               10669
mongodb-driver-server.getlatency.php               24-May-2024 14:02                7184
mongodb-driver-server.getport.php                  24-May-2024 14:02                5551
mongodb-driver-server.getserverdescription.php     24-May-2024 14:02                3478
mongodb-driver-server.gettags.php                  24-May-2024 14:02                3840
mongodb-driver-server.gettype.php                  24-May-2024 14:02                3876
mongodb-driver-server.isarbiter.php                24-May-2024 14:02                3693
mongodb-driver-server.ishidden.php                 24-May-2024 14:02                3687
mongodb-driver-server.ispassive.php                24-May-2024 14:02                3755
mongodb-driver-server.isprimary.php                24-May-2024 14:02                3700
mongodb-driver-server.issecondary.php              24-May-2024 14:02                3735
mongodb-driver-serverapi.bsonserialize.php         24-May-2024 14:02                3362
mongodb-driver-serverapi.construct.php             24-May-2024 14:02                5250
mongodb-driver-serverapi.serialize.php             24-May-2024 14:02                3691
mongodb-driver-serverapi.unserialize.php           24-May-2024 14:02                4513
mongodb-driver-serverdescription.gethellorespon..> 24-May-2024 14:02                5251
mongodb-driver-serverdescription.gethost.php       24-May-2024 14:02                3502
mongodb-driver-serverdescription.getlastupdatet..> 24-May-2024 14:02                3653
mongodb-driver-serverdescription.getport.php       24-May-2024 14:02                3557
mongodb-driver-serverdescription.getroundtripti..> 24-May-2024 14:02                3956
mongodb-driver-serverdescription.gettype.php       24-May-2024 14:02                3892
mongodb-driver-session.aborttransaction.php        24-May-2024 14:02                4259
mongodb-driver-session.advanceclustertime.php      24-May-2024 14:02                4937
mongodb-driver-session.advanceoperationtime.php    24-May-2024 14:02                4877
mongodb-driver-session.committransaction.php       24-May-2024 14:02                5615
mongodb-driver-session.construct.php               24-May-2024 14:02                2930
mongodb-driver-session.endsession.php              24-May-2024 14:02                4391
mongodb-driver-session.getclustertime.php          24-May-2024 14:02                4030
mongodb-driver-session.getlogicalsessionid.php     24-May-2024 14:02                3188
mongodb-driver-session.getoperationtime.php        24-May-2024 14:02                4110
mongodb-driver-session.getserver.php               24-May-2024 14:02                4003
mongodb-driver-session.gettransactionoptions.php   24-May-2024 14:02                3885
mongodb-driver-session.gettransactionstate.php     24-May-2024 14:02                3789
mongodb-driver-session.isdirty.php                 24-May-2024 14:02                3073
mongodb-driver-session.isintransaction.php         24-May-2024 14:02                3851
mongodb-driver-session.starttransaction.php        24-May-2024 14:02                8923
mongodb-driver-topologydescription.getservers.php  24-May-2024 14:02                3515
mongodb-driver-topologydescription.gettype.php     24-May-2024 14:02                3563
mongodb-driver-topologydescription.hasreadables..> 24-May-2024 14:02                4002
mongodb-driver-topologydescription.haswritables..> 24-May-2024 14:02                3283
mongodb-driver-writeconcern.bsonserialize.php      24-May-2024 14:02                7275
mongodb-driver-writeconcern.construct.php          24-May-2024 14:02               10584
mongodb-driver-writeconcern.getjournal.php         24-May-2024 14:02                6032
mongodb-driver-writeconcern.getw.php               24-May-2024 14:02                5322
mongodb-driver-writeconcern.getwtimeout.php        24-May-2024 14:02                5956
mongodb-driver-writeconcern.isdefault.php          24-May-2024 14:02                7907
mongodb-driver-writeconcern.serialize.php          24-May-2024 14:02                3763
mongodb-driver-writeconcern.unserialize.php        24-May-2024 14:02                4585
mongodb-driver-writeconcernerror.getcode.php       24-May-2024 14:02                6366
mongodb-driver-writeconcernerror.getinfo.php       24-May-2024 14:02                6692
mongodb-driver-writeconcernerror.getmessage.php    24-May-2024 14:02                6457
mongodb-driver-writeerror.getcode.php              24-May-2024 14:02                5709
mongodb-driver-writeerror.getindex.php             24-May-2024 14:02                6237
mongodb-driver-writeerror.getinfo.php              24-May-2024 14:02                3185
mongodb-driver-writeerror.getmessage.php           24-May-2024 14:02                5845
mongodb-driver-writeexception.getwriteresult.php   24-May-2024 14:02                7952
mongodb-driver-writeresult.getdeletedcount.php     24-May-2024 14:02                8201
mongodb-driver-writeresult.getinsertedcount.php    24-May-2024 14:02                8283
mongodb-driver-writeresult.getmatchedcount.php     24-May-2024 14:02                8846
mongodb-driver-writeresult.getmodifiedcount.php    24-May-2024 14:02                9144
mongodb-driver-writeresult.getserver.php           24-May-2024 14:02                6576
mongodb-driver-writeresult.getupsertedcount.php    24-May-2024 14:02                8372
mongodb-driver-writeresult.getupsertedids.php      24-May-2024 14:02                8854
mongodb-driver-writeresult.getwriteconcernerror..> 24-May-2024 14:02                7244
mongodb-driver-writeresult.getwriteerrors.php      24-May-2024 14:02               13058
mongodb-driver-writeresult.isacknowledged.php      24-May-2024 14:02                8222
mongodb.architecture.php                           24-May-2024 14:02                2064
mongodb.configuration.php                          24-May-2024 14:02                5686
mongodb.connection-handling.php                    24-May-2024 14:02                9681
mongodb.constants.php                              24-May-2024 14:02                2227
mongodb.exceptions.php                             24-May-2024 14:02                5219
mongodb.exceptions.tree.php                        24-May-2024 14:02                5640
mongodb.installation.hhvm.php                      24-May-2024 14:02                3942
mongodb.installation.homebrew.php                  24-May-2024 14:02                2173
mongodb.installation.manual.php                    24-May-2024 14:02                3434
mongodb.installation.pecl.php                      24-May-2024 14:02                3684
mongodb.installation.php                           24-May-2024 14:02                2090
mongodb.installation.windows.php                   24-May-2024 14:02                3101
mongodb.monitoring.php                             24-May-2024 14:02               19049
mongodb.overview.php                               24-May-2024 14:02                7977
mongodb.persistence.deserialization.php            24-May-2024 14:02               19984
mongodb.persistence.php                            24-May-2024 14:02                1954
mongodb.persistence.serialization.php              24-May-2024 14:02               20081
mongodb.requirements.php                           24-May-2024 14:02                3224
mongodb.security.php                               24-May-2024 14:02                1552
mongodb.security.request_injection.php             24-May-2024 14:02                3044
mongodb.security.script_injection.php              24-May-2024 14:02                9238
mongodb.setup.php                                  24-May-2024 14:02                2331
mongodb.tutorial.apm.php                           24-May-2024 14:02               18824
mongodb.tutorial.library.php                       24-May-2024 14:02               11494
mongodb.tutorial.php                               24-May-2024 14:02                1786
mqseries.configure.php                             24-May-2024 14:02                2918
mqseries.constants.php                             24-May-2024 14:02                2718
mqseries.ini.php                                   24-May-2024 14:02                1421
mqseries.requirements.php                          24-May-2024 14:02                1684
mqseries.resources.php                             24-May-2024 14:02                1742
mqseries.setup.php                                 24-May-2024 14:02                1724
multipleiterator.attachiterator.php                24-May-2024 14:02                4400
multipleiterator.construct.php                     24-May-2024 14:02                8880
multipleiterator.containsiterator.php              24-May-2024 14:02                3565
multipleiterator.countiterators.php                24-May-2024 14:02                3228
multipleiterator.current.php                       24-May-2024 14:02                3966
multipleiterator.detachiterator.php                24-May-2024 14:02                3310
multipleiterator.getflags.php                      24-May-2024 14:02                3364
multipleiterator.key.php                           24-May-2024 14:02                3808
multipleiterator.next.php                          24-May-2024 14:02                2977
multipleiterator.rewind.php                        24-May-2024 14:02                2990
multipleiterator.setflags.php                      24-May-2024 14:02                3641
multipleiterator.valid.php                         24-May-2024 14:02                3179
mysql-xdevapi-baseresult.getwarnings.php           24-May-2024 14:02                7024
mysql-xdevapi-baseresult.getwarningscount.php      24-May-2024 14:02                6741
mysql-xdevapi-client.close.php                     24-May-2024 14:02                2490
mysql-xdevapi-client.construct.php                 24-May-2024 14:02                3462
mysql-xdevapi-client.getsession.php                24-May-2024 14:02                2446
mysql-xdevapi-collection.add.php                   24-May-2024 14:02                9484
mysql-xdevapi-collection.addorreplaceone.php       24-May-2024 14:02                8447
mysql-xdevapi-collection.construct.php             24-May-2024 14:02                6501
mysql-xdevapi-collection.count.php                 24-May-2024 14:02                6550
mysql-xdevapi-collection.createindex.php           24-May-2024 14:02                9387
mysql-xdevapi-collection.dropindex.php             24-May-2024 14:02                6988
mysql-xdevapi-collection.existsindatabase.php      24-May-2024 14:02                6144
mysql-xdevapi-collection.find.php                  24-May-2024 14:02                9727
mysql-xdevapi-collection.getname.php               24-May-2024 14:02                5212
mysql-xdevapi-collection.getone.php                24-May-2024 14:02                7251
mysql-xdevapi-collection.getschema.php             24-May-2024 14:02                5375
mysql-xdevapi-collection.getsession.php            24-May-2024 14:02                5590
mysql-xdevapi-collection.modify.php                24-May-2024 14:02                8287
mysql-xdevapi-collection.remove.php                24-May-2024 14:02                8631
mysql-xdevapi-collection.removeone.php             24-May-2024 14:02                7761
mysql-xdevapi-collection.replaceone.php            24-May-2024 14:02                8167
mysql-xdevapi-collectionadd.construct.php          24-May-2024 14:02                7874
mysql-xdevapi-collectionadd.execute.php            24-May-2024 14:02                7860
mysql-xdevapi-collectionfind.bind.php              24-May-2024 14:02                8107
mysql-xdevapi-collectionfind.construct.php         24-May-2024 14:02                7052
mysql-xdevapi-collectionfind.execute.php           24-May-2024 14:02                7362
mysql-xdevapi-collectionfind.fields.php            24-May-2024 14:02                7679
mysql-xdevapi-collectionfind.groupby.php           24-May-2024 14:02                4474
mysql-xdevapi-collectionfind.having.php            24-May-2024 14:02                4540
mysql-xdevapi-collectionfind.limit.php             24-May-2024 14:02                8314
mysql-xdevapi-collectionfind.lockexclusive.php     24-May-2024 14:02                6880
mysql-xdevapi-collectionfind.lockshared.php        24-May-2024 14:02                6655
mysql-xdevapi-collectionfind.offset.php            24-May-2024 14:02                8116
mysql-xdevapi-collectionfind.sort.php              24-May-2024 14:02                8238
mysql-xdevapi-collectionmodify.arrayappend.php     24-May-2024 14:02                8218
mysql-xdevapi-collectionmodify.arrayinsert.php     24-May-2024 14:02                8908
mysql-xdevapi-collectionmodify.bind.php            24-May-2024 14:02                8289
mysql-xdevapi-collectionmodify.construct.php       24-May-2024 14:02                6951
mysql-xdevapi-collectionmodify.execute.php         24-May-2024 14:02                3323
mysql-xdevapi-collectionmodify.limit.php           24-May-2024 14:02                8745
mysql-xdevapi-collectionmodify.patch.php           24-May-2024 14:02                4080
mysql-xdevapi-collectionmodify.replace.php         24-May-2024 14:02                8020
mysql-xdevapi-collectionmodify.set.php             24-May-2024 14:02                7962
mysql-xdevapi-collectionmodify.skip.php            24-May-2024 14:02                4756
mysql-xdevapi-collectionmodify.sort.php            24-May-2024 14:02                4766
mysql-xdevapi-collectionmodify.unset.php           24-May-2024 14:02                4375
mysql-xdevapi-collectionremove.bind.php            24-May-2024 14:02                5213
mysql-xdevapi-collectionremove.construct.php       24-May-2024 14:02                7357
mysql-xdevapi-collectionremove.execute.php         24-May-2024 14:02                4110
mysql-xdevapi-collectionremove.limit.php           24-May-2024 14:02                4568
mysql-xdevapi-collectionremove.sort.php            24-May-2024 14:02                4683
mysql-xdevapi-columnresult.construct.php           24-May-2024 14:02                9612
mysql-xdevapi-columnresult.getcharactersetname.php 24-May-2024 14:02                3375
mysql-xdevapi-columnresult.getcollationname.php    24-May-2024 14:02                3354
mysql-xdevapi-columnresult.getcolumnlabel.php      24-May-2024 14:02                3331
mysql-xdevapi-columnresult.getcolumnname.php       24-May-2024 14:02                3315
mysql-xdevapi-columnresult.getfractionaldigits.php 24-May-2024 14:02                3424
mysql-xdevapi-columnresult.getlength.php           24-May-2024 14:02                3268
mysql-xdevapi-columnresult.getschemaname.php       24-May-2024 14:02                3344
mysql-xdevapi-columnresult.gettablelabel.php       24-May-2024 14:02                3299
mysql-xdevapi-columnresult.gettablename.php        24-May-2024 14:02                3309
mysql-xdevapi-columnresult.gettype.php             24-May-2024 14:02                3224
mysql-xdevapi-columnresult.isnumbersigned.php      24-May-2024 14:02                3584
mysql-xdevapi-columnresult.ispadded.php            24-May-2024 14:02                3362
mysql-xdevapi-crudoperationbindable.bind.php       24-May-2024 14:02                5818
mysql-xdevapi-crudoperationlimitable.limit.php     24-May-2024 14:02                5929
mysql-xdevapi-crudoperationskippable.skip.php      24-May-2024 14:02                4665
mysql-xdevapi-crudoperationsortable.sort.php       24-May-2024 14:02                4693
mysql-xdevapi-databaseobject.existsindatabase.php  24-May-2024 14:02                3702
mysql-xdevapi-databaseobject.getname.php           24-May-2024 14:02                3546
mysql-xdevapi-databaseobject.getsession.php        24-May-2024 14:02                3589
mysql-xdevapi-docresult.construct.php              24-May-2024 14:02                7542
mysql-xdevapi-docresult.fetchall.php               24-May-2024 14:02                8063