Index of /pub/php/manual/tr/


../
feeds/                                             29-May-2024 00:07                   -
images/                                            29-May-2024 00:07                   -
styles/                                            29-May-2024 00:07                   -
toc/                                               29-May-2024 00:07                   -
about.formats.php                                  29-May-2024 00:07                4172
about.generate.php                                 29-May-2024 00:07                2717
about.howtohelp.php                                29-May-2024 00:07                3434
about.more.php                                     29-May-2024 00:07                1854
about.notes.php                                    29-May-2024 00:07                2444
about.php                                          29-May-2024 00:07                1894
about.phpversions.php                              29-May-2024 00:07                3331
about.prototypes.php                               29-May-2024 00:07                7505
about.translations.php                             29-May-2024 00:07                3178
aliases.php                                        29-May-2024 00:07               29020
allowdynamicproperties.construct.php               29-May-2024 00:07                2297
apache.configuration.php                           29-May-2024 00:07                5450
apache.constants.php                               29-May-2024 00:07                1216
apache.installation.php                            29-May-2024 00:07                1311
apache.requirements.php                            29-May-2024 00:07                1224
apache.resources.php                               29-May-2024 00:07                1268
apache.setup.php                                   29-May-2024 00:07                1646
apcu.configuration.php                             29-May-2024 00:07               15984
apcu.constants.php                                 29-May-2024 00:07                7455
apcu.installation.php                              29-May-2024 00:07                3239
apcu.requirements.php                              29-May-2024 00:07                1210
apcu.resources.php                                 29-May-2024 00:07                1254
apcu.setup.php                                     29-May-2024 00:07                1602
apcuiterator.construct.php                         29-May-2024 00:07                7151
apcuiterator.current.php                           29-May-2024 00:07                3048
apcuiterator.gettotalcount.php                     29-May-2024 00:07                3215
apcuiterator.gettotalhits.php                      29-May-2024 00:07                3351
apcuiterator.gettotalsize.php                      29-May-2024 00:07                3092
apcuiterator.key.php                               29-May-2024 00:07                2850
apcuiterator.next.php                              29-May-2024 00:07                3109
apcuiterator.rewind.php                            29-May-2024 00:07                2755
apcuiterator.valid.php                             29-May-2024 00:07                2978
appendices.php                                     29-May-2024 00:07               12522
appenditerator.append.php                          29-May-2024 00:07                5468
appenditerator.construct.php                       29-May-2024 00:07               10147
appenditerator.current.php                         29-May-2024 00:07                3509
appenditerator.getarrayiterator.php                29-May-2024 00:07                3122
appenditerator.getiteratorindex.php                29-May-2024 00:07                6652
appenditerator.key.php                             29-May-2024 00:07                7922
appenditerator.next.php                            29-May-2024 00:07                3394
appenditerator.rewind.php                          29-May-2024 00:07                3386
appenditerator.valid.php                           29-May-2024 00:07                3383
array.configuration.php                            29-May-2024 00:07                1310
array.constants.php                                29-May-2024 00:07               12251
array.installation.php                             29-May-2024 00:07                1273
array.requirements.php                             29-May-2024 00:07                1217
array.resources.php                                29-May-2024 00:07                1261
array.setup.php                                    29-May-2024 00:07                1610
array.sorting.php                                  29-May-2024 00:07                7192
arrayaccess.offsetexists.php                       29-May-2024 00:07                9371
arrayaccess.offsetget.php                          29-May-2024 00:07                4940
arrayaccess.offsetset.php                          29-May-2024 00:07                5204
arrayaccess.offsetunset.php                        29-May-2024 00:07                2865
arrayiterator.append.php                           29-May-2024 00:07                3559
arrayiterator.asort.php                            29-May-2024 00:07                7450
arrayiterator.construct.php                        29-May-2024 00:07                3812
arrayiterator.count.php                            29-May-2024 00:07                3280
arrayiterator.current.php                          29-May-2024 00:07                5227
arrayiterator.getarraycopy.php                     29-May-2024 00:07                3127
arrayiterator.getflags.php                         29-May-2024 00:07                3118
arrayiterator.key.php                              29-May-2024 00:07                4037
arrayiterator.ksort.php                            29-May-2024 00:07                7414
arrayiterator.natcasesort.php                      29-May-2024 00:07                4788
arrayiterator.natsort.php                          29-May-2024 00:07                4679
arrayiterator.next.php                             29-May-2024 00:07                4659
arrayiterator.offsetexists.php                     29-May-2024 00:07                3362
arrayiterator.offsetget.php                        29-May-2024 00:07                3390
arrayiterator.offsetset.php                        29-May-2024 00:07                3655
arrayiterator.offsetunset.php                      29-May-2024 00:07                3793
arrayiterator.rewind.php                           29-May-2024 00:07                4647
arrayiterator.seek.php                             29-May-2024 00:07                2643
arrayiterator.serialize.php                        29-May-2024 00:07                2922
arrayiterator.setflags.php                         29-May-2024 00:07                4158
arrayiterator.uasort.php                           29-May-2024 00:07                6513
arrayiterator.uksort.php                           29-May-2024 00:07                6405
arrayiterator.unserialize.php                      29-May-2024 00:07                3158
arrayiterator.valid.php                            29-May-2024 00:07                4717
arrayobject.append.php                             29-May-2024 00:07                5509
arrayobject.asort.php                              29-May-2024 00:07               10339
arrayobject.construct.php                          29-May-2024 00:07                6289
arrayobject.count.php                              29-May-2024 00:07                5428
arrayobject.exchangearray.php                      29-May-2024 00:07                6518
arrayobject.getarraycopy.php                       29-May-2024 00:07                5317
arrayobject.getflags.php                           29-May-2024 00:07                6149
arrayobject.getiterator.php                        29-May-2024 00:07                5311
arrayobject.getiteratorclass.php                   29-May-2024 00:07                6610
arrayobject.ksort.php                              29-May-2024 00:07               10009
arrayobject.natcasesort.php                        29-May-2024 00:07                8267
arrayobject.natsort.php                            29-May-2024 00:07                7961
arrayobject.offsetexists.php                       29-May-2024 00:07                4984
arrayobject.offsetget.php                          29-May-2024 00:07                5189
arrayobject.offsetset.php                          29-May-2024 00:07                6794
arrayobject.offsetunset.php                        29-May-2024 00:07                4287
arrayobject.serialize.php                          29-May-2024 00:07                5141
arrayobject.setflags.php                           29-May-2024 00:07                6728
arrayobject.setiteratorclass.php                   29-May-2024 00:07                5873
arrayobject.uasort.php                             29-May-2024 00:07               11015
arrayobject.uksort.php                             29-May-2024 00:07               10420
arrayobject.unserialize.php                        29-May-2024 00:07                3584
attribute.construct.php                            29-May-2024 00:07                2386
backedenum.from.php                                29-May-2024 00:07                6283
backedenum.tryfrom.php                             29-May-2024 00:07                6728
bc.configuration.php                               29-May-2024 00:07                2612
bc.constants.php                                   29-May-2024 00:07                1185
bc.installation.php                                29-May-2024 00:07                1473
bc.requirements.php                                29-May-2024 00:07                1196
bc.resources.php                                   29-May-2024 00:07                1240
bc.setup.php                                       29-May-2024 00:07                1599
book.apache.php                                    29-May-2024 00:07                3395
book.apcu.php                                      29-May-2024 00:07                4419
book.array.php                                     29-May-2024 00:07               13474
book.bc.php                                        29-May-2024 00:07                3168
book.bson.php                                      29-May-2024 00:07               25679
book.bzip2.php                                     29-May-2024 00:07                3088
book.calendar.php                                  29-May-2024 00:07                4491
book.classobj.php                                  29-May-2024 00:07                4781
book.cmark.php                                     29-May-2024 00:07                8771
book.com.php                                       29-May-2024 00:07                8528
book.componere.php                                 29-May-2024 00:07                6171
book.ctype.php                                     29-May-2024 00:07                3404
book.cubrid.php                                    29-May-2024 00:07               13894
book.curl.php                                      29-May-2024 00:07                7623
book.datetime.php                                  29-May-2024 00:07               18092
book.dba.php                                       29-May-2024 00:07                3445
book.dbase.php                                     29-May-2024 00:07                3253
book.dio.php                                       29-May-2024 00:07                3158
book.dir.php                                       29-May-2024 00:07                3256
book.dom.php                                       29-May-2024 00:07               23178
book.ds.php                                        29-May-2024 00:07               25129
book.eio.php                                       29-May-2024 00:07                7979
book.enchant.php                                   29-May-2024 00:07                5377
book.errorfunc.php                                 29-May-2024 00:07                3574
book.ev.php                                        29-May-2024 00:07               13404
book.event.php                                     29-May-2024 00:07               23171
book.exec.php                                      29-May-2024 00:07                3592
book.exif.php                                      29-May-2024 00:07                2740
book.expect.php                                    29-May-2024 00:07                2519
book.fann.php                                      29-May-2024 00:07               23124
book.fdf.php                                       29-May-2024 00:07                5671
book.ffi.php                                       29-May-2024 00:07                5676
book.fileinfo.php                                  29-May-2024 00:07                3259
book.filesystem.php                                29-May-2024 00:07               11130
book.filter.php                                    29-May-2024 00:07                3459
book.fpm.php                                       29-May-2024 00:07                1973
book.ftp.php                                       29-May-2024 00:07                6458
book.funchand.php                                  29-May-2024 00:07                4039
book.gearman.php                                   29-May-2024 00:07               14829
book.gender.php                                    29-May-2024 00:07                2576
book.geoip.php                                     29-May-2024 00:07                4380
book.gettext.php                                   29-May-2024 00:07                3139
book.gmagick.php                                   29-May-2024 00:07               22600
book.gmp.php                                       29-May-2024 00:07                6565
book.gnupg.php                                     29-May-2024 00:07                4909
book.hash.php                                      29-May-2024 00:07                4433
book.hrtime.php                                    29-May-2024 00:07                3515
book.ibase.php                                     29-May-2024 00:07               12206
book.ibm-db2.php                                   29-May-2024 00:07                8669
book.iconv.php                                     29-May-2024 00:07                3464
book.igbinary.php                                  29-May-2024 00:07                2144
book.image.php                                     29-May-2024 00:07               18544
book.imagick.php                                   29-May-2024 00:07               75613
book.imap.php                                      29-May-2024 00:07               11596
book.info.php                                      29-May-2024 00:07                9532
book.inotify.php                                   29-May-2024 00:07                2578
book.intl.php                                      29-May-2024 00:07               46930
book.json.php                                      29-May-2024 00:07                3003
book.ldap.php                                      29-May-2024 00:07                9168
book.libxml.php                                    29-May-2024 00:07                3394
book.lua.php                                       29-May-2024 00:07                2664
book.luasandbox.php                                29-May-2024 00:07                5586
book.lzf.php                                       29-May-2024 00:07                2296
book.mail.php                                      29-May-2024 00:07                2130
book.mailparse.php                                 29-May-2024 00:07                3935
book.math.php                                      29-May-2024 00:07                5359
book.mbstring.php                                  29-May-2024 00:07               12064
book.mcrypt.php                                    29-May-2024 00:07                6910
book.memcache.php                                  29-May-2024 00:07                4247
book.memcached.php                                 29-May-2024 00:07                8094
book.mhash.php                                     29-May-2024 00:07                2606
book.misc.php                                      29-May-2024 00:07                5851
book.mongodb.php                                   29-May-2024 00:07               26860
book.mqseries.php                                  29-May-2024 00:07                3200
book.mysql-xdevapi.php                             29-May-2024 00:07               29035
book.mysql.php                                     29-May-2024 00:07                8003
book.mysqli.php                                    29-May-2024 00:07               18097
book.mysqlnd.php                                   29-May-2024 00:07                2476
book.network.php                                   29-May-2024 00:07                6385
book.oauth.php                                     29-May-2024 00:07                7212
book.oci8.php                                      29-May-2024 00:07               16951
book.opcache.php                                   29-May-2024 00:07                2714
book.openal.php                                    29-May-2024 00:07                4461
book.openssl.php                                   29-May-2024 00:07               11967
book.outcontrol.php                                29-May-2024 00:07                4456
book.parallel.php                                  29-May-2024 00:07                5729
book.parle.php                                     29-May-2024 00:07                8792
book.password.php                                  29-May-2024 00:07                2647
book.pcntl.php                                     29-May-2024 00:07                5579
book.pcre.php                                      29-May-2024 00:07                4075
book.pdo.php                                       29-May-2024 00:07                8740
book.pgsql.php                                     29-May-2024 00:07               12474
book.phar.php                                      29-May-2024 00:07               15728
book.phpdbg.php                                    29-May-2024 00:07                2946
book.posix.php                                     29-May-2024 00:07                7573
book.ps.php                                        29-May-2024 00:07                9218
book.pspell.php                                    29-May-2024 00:07                4456
book.pthreads.php                                  29-May-2024 00:07                5468
book.quickhash.php                                 29-May-2024 00:07                8934
book.radius.php                                    29-May-2024 00:07                5565
book.random.php                                    29-May-2024 00:07                9106
book.rar.php                                       29-May-2024 00:07                5283
book.readline.php                                  29-May-2024 00:07                3695
book.recode.php                                    29-May-2024 00:07                2351
book.reflection.php                                29-May-2024 00:07               40218
book.rnp.php                                       29-May-2024 00:07                6069
book.rpminfo.php                                   29-May-2024 00:07                2541
book.rrd.php                                       29-May-2024 00:07                5126
book.runkit7.php                                   29-May-2024 00:07                4251
book.scoutapm.php                                  29-May-2024 00:07                2203
book.seaslog.php                                   29-May-2024 00:07                5212
book.sem.php                                       29-May-2024 00:07                4178
book.session.php                                   29-May-2024 00:07                8494
book.shmop.php                                     29-May-2024 00:07                2827
book.simdjson.php                                  29-May-2024 00:07                2648
book.simplexml.php                                 29-May-2024 00:07                5808
book.snmp.php                                      29-May-2024 00:07                5861
book.soap.php                                      29-May-2024 00:07                6108
book.sockets.php                                   29-May-2024 00:07                7430
book.sodium.php                                    29-May-2024 00:07               17326
book.solr.php                                      29-May-2024 00:07               53160
book.spl.php                                       29-May-2024 00:07               10035
book.sqlite3.php                                   29-May-2024 00:07                7707
book.sqlsrv.php                                    29-May-2024 00:07                5360
book.ssdeep.php                                    29-May-2024 00:07                2336
book.ssh2.php                                      29-May-2024 00:07                5866
book.stats.php                                     29-May-2024 00:07               11828
book.stomp.php                                     29-May-2024 00:07                4159
book.stream.php                                    29-May-2024 00:07               12866
book.strings.php                                   29-May-2024 00:07               14754
book.svm.php                                       29-May-2024 00:07                3692
book.svn.php                                       29-May-2024 00:07                7616
book.swoole.php                                    29-May-2024 00:07               37330
book.sync.php                                      29-May-2024 00:07                4791
book.taint.php                                     29-May-2024 00:07                2532
book.tcpwrap.php                                   29-May-2024 00:07                2075
book.tidy.php                                      29-May-2024 00:07                7482
book.tokenizer.php                                 29-May-2024 00:07                3298
book.trader.php                                    29-May-2024 00:07               17514
book.ui.php                                        29-May-2024 00:07               27906
book.uodbc.php                                     29-May-2024 00:07                7966
book.uopz.php                                      29-May-2024 00:07                5119
book.url.php                                       29-May-2024 00:07                3144
book.v8js.php                                      29-May-2024 00:07                3108
book.var.php                                       29-May-2024 00:07                6287
book.var_representation.php                        29-May-2024 00:07                2127
book.varnish.php                                   29-May-2024 00:07                5384
book.wddx.php                                      29-May-2024 00:07                2875
book.win32service.php                              29-May-2024 00:07                4109
book.wincache.php                                  29-May-2024 00:07                5623
book.wkhtmltox.php                                 29-May-2024 00:07                3320
book.xattr.php                                     29-May-2024 00:07                2529
book.xdiff.php                                     29-May-2024 00:07                4389
book.xhprof.php                                    29-May-2024 00:07                2473
book.xlswriter.php                                 29-May-2024 00:07                4431
book.xml.php                                       29-May-2024 00:07                6077
book.xmldiff.php                                   29-May-2024 00:07                3100
book.xmlreader.php                                 29-May-2024 00:07                5438
book.xmlrpc.php                                    29-May-2024 00:07                4153
book.xmlwriter.php                                 29-May-2024 00:07                7307
book.xsl.php                                       29-May-2024 00:07                4046
book.yac.php                                       29-May-2024 00:07                2609
book.yaconf.php                                    29-May-2024 00:07                2150
book.yaf.php                                       29-May-2024 00:07               34665
book.yaml.php                                      29-May-2024 00:07                2782
book.yar.php                                       29-May-2024 00:07                3700
book.yaz.php                                       29-May-2024 00:07                4705
book.zip.php                                       29-May-2024 00:07               10588
book.zlib.php                                      29-May-2024 00:07                5643
book.zmq.php                                       29-May-2024 00:07                5487
book.zookeeper.php                                 29-May-2024 00:07                6665
bzip2.configuration.php                            29-May-2024 00:07                1310
bzip2.constants.php                                29-May-2024 00:07                1208
bzip2.examples.php                                 29-May-2024 00:07                4118
bzip2.installation.php                             29-May-2024 00:07                1431
bzip2.requirements.php                             29-May-2024 00:07                1407
bzip2.resources.php                                29-May-2024 00:07                1330
bzip2.setup.php                                    29-May-2024 00:07                1633
cachingiterator.construct.php                      29-May-2024 00:07                2850
cachingiterator.count.php                          29-May-2024 00:07                2542
cachingiterator.current.php                        29-May-2024 00:07                2868
cachingiterator.getcache.php                       29-May-2024 00:07                5907
cachingiterator.getflags.php                       29-May-2024 00:07                2536
cachingiterator.hasnext.php                        29-May-2024 00:07                2664
cachingiterator.key.php                            29-May-2024 00:07                2240
cachingiterator.next.php                           29-May-2024 00:07                2458
cachingiterator.offsetexists.php                   29-May-2024 00:07                2994
cachingiterator.offsetget.php                      29-May-2024 00:07                2742
cachingiterator.offsetset.php                      29-May-2024 00:07                3110
cachingiterator.offsetunset.php                    29-May-2024 00:07                2783
cachingiterator.rewind.php                         29-May-2024 00:07                2474
cachingiterator.setflags.php                       29-May-2024 00:07                2815
cachingiterator.tostring.php                       29-May-2024 00:07                2674
cachingiterator.valid.php                          29-May-2024 00:07                2711
calendar.configuration.php                         29-May-2024 00:07                1331
calendar.constants.php                             29-May-2024 00:07               12989
calendar.installation.php                          29-May-2024 00:07                1535
calendar.requirements.php                          29-May-2024 00:07                1238
calendar.resources.php                             29-May-2024 00:07                1282
calendar.setup.php                                 29-May-2024 00:07                1670
callbackfilteriterator.accept.php                  29-May-2024 00:07                3628
callbackfilteriterator.construct.php               29-May-2024 00:07                3976
cc.license.php                                     29-May-2024 00:07               20756
changelog.misc.php                                 29-May-2024 00:07                1336
changelog.mysql.php                                29-May-2024 00:07                2572
changelog.mysql_xdevapi.php                        29-May-2024 00:07                2370
changelog.mysqli.php                               29-May-2024 00:07                1379
changelog.strings.php                              29-May-2024 00:07                1415
class.addressinfo.php                              29-May-2024 00:07                1767
class.allowdynamicproperties.php                   29-May-2024 00:07                5086
class.apcuiterator.php                             29-May-2024 00:07                7351
class.appenditerator.php                           29-May-2024 00:07                7907
class.argumentcounterror.php                       29-May-2024 00:07                8737
class.arithmeticerror.php                          29-May-2024 00:07                8813
class.arrayaccess.php                              29-May-2024 00:07               11861
class.arrayiterator.php                            29-May-2024 00:07               16849
class.arrayobject.php                              29-May-2024 00:07               16788
class.assertionerror.php                           29-May-2024 00:07                8492
class.attribute.php                                29-May-2024 00:07                8727
class.backedenum.php                               29-May-2024 00:07                4385
class.badfunctioncallexception.php                 29-May-2024 00:07                8616
class.badmethodcallexception.php                   29-May-2024 00:07                8633
class.cachingiterator.php                          29-May-2024 00:07               17260
class.callbackfilteriterator.php                   29-May-2024 00:07               11494
class.closedgeneratorexception.php                 29-May-2024 00:07                8768
class.closure.php                                  29-May-2024 00:07                7031
class.collator.php                                 29-May-2024 00:07               37447
class.collectable.php                              29-May-2024 00:07                2561
class.com-exception.php                            29-May-2024 00:07                8443
class.com-safearray-proxy.php                      29-May-2024 00:07                1927
class.com.php                                      29-May-2024 00:07               12545
class.commonmark-cql.php                           29-May-2024 00:07                7358
class.commonmark-interfaces-ivisitable.php         29-May-2024 00:07                3003
class.commonmark-interfaces-ivisitor.php           29-May-2024 00:07                4598
class.commonmark-node-blockquote.php               29-May-2024 00:07                8474
class.commonmark-node-bulletlist.php               29-May-2024 00:07               10646
class.commonmark-node-code.php                     29-May-2024 00:07                9468
class.commonmark-node-codeblock.php                29-May-2024 00:07               10850
class.commonmark-node-customblock.php              29-May-2024 00:07                9223
class.commonmark-node-custominline.php             29-May-2024 00:07                9203
class.commonmark-node-document.php                 29-May-2024 00:07                8436
class.commonmark-node-heading.php                  29-May-2024 00:07                9827
class.commonmark-node-htmlblock.php                29-May-2024 00:07                9526
class.commonmark-node-htmlinline.php               29-May-2024 00:07                9502
class.commonmark-node-image.php                    29-May-2024 00:07               10735
class.commonmark-node-item.php                     29-May-2024 00:07                8441
class.commonmark-node-linebreak.php                29-May-2024 00:07                8455
class.commonmark-node-link.php                     29-May-2024 00:07               10728
class.commonmark-node-orderedlist.php              29-May-2024 00:07               11612
class.commonmark-node-paragraph.php                29-May-2024 00:07                8480
class.commonmark-node-softbreak.php                29-May-2024 00:07                8473
class.commonmark-node-text-emphasis.php            29-May-2024 00:07                8502
class.commonmark-node-text-strong.php              29-May-2024 00:07                8491
class.commonmark-node-text.php                     29-May-2024 00:07                9865
class.commonmark-node-thematicbreak.php            29-May-2024 00:07                8502
class.commonmark-node.php                          29-May-2024 00:07                9376
class.commonmark-parser.php                        29-May-2024 00:07                3858
class.compersisthelper.php                         29-May-2024 00:07                7471
class.compileerror.php                             29-May-2024 00:07                8425
class.componere-abstract-definition.php            29-May-2024 00:07                4753
class.componere-definition.php                     29-May-2024 00:07               10275
class.componere-method.php                         29-May-2024 00:07                4350
class.componere-patch.php                          29-May-2024 00:07                8370
class.componere-value.php                          29-May-2024 00:07                5453
class.countable.php                                29-May-2024 00:07                2587
class.curlfile.php                                 29-May-2024 00:07                8460
class.curlhandle.php                               29-May-2024 00:07                1802
class.curlmultihandle.php                          29-May-2024 00:07                1840
class.curlsharehandle.php                          29-May-2024 00:07                1837
class.curlstringfile.php                           29-May-2024 00:07                5634
class.dateerror.php                                29-May-2024 00:07                9073
class.dateexception.php                            29-May-2024 00:07                9716
class.dateinterval.php                             29-May-2024 00:07               14004
class.dateinvalidoperationexception.php            29-May-2024 00:07                9179
class.dateinvalidtimezoneexception.php             29-May-2024 00:07                8757
class.datemalformedintervalstringexception.php     29-May-2024 00:07                8856
class.datemalformedperiodstringexception.php       29-May-2024 00:07                8838
class.datemalformedstringexception.php             29-May-2024 00:07                9137
class.dateobjecterror.php                          29-May-2024 00:07                8895
class.dateperiod.php                               29-May-2024 00:07               22422
class.daterangeerror.php                           29-May-2024 00:07                9083
class.datetime.php                                 29-May-2024 00:07               23300
class.datetimeimmutable.php                        29-May-2024 00:07               23398
class.datetimeinterface.php                        29-May-2024 00:07               19907
class.datetimezone.php                             29-May-2024 00:07               16894
class.deflatecontext.php                           29-May-2024 00:07                1832
class.directory.php                                29-May-2024 00:07                5549
class.directoryiterator.php                        29-May-2024 00:07               20036
class.divisionbyzeroerror.php                      29-May-2024 00:07                8464
class.domainexception.php                          29-May-2024 00:07                8548
class.domattr.php                                  29-May-2024 00:07               27673
class.domcdatasection.php                          29-May-2024 00:07               31483
class.domcharacterdata.php                         29-May-2024 00:07               32826
class.domchildnode.php                             29-May-2024 00:07                4244
class.domcomment.php                               29-May-2024 00:07               30206
class.domdocument.php                              29-May-2024 00:07               68517
class.domdocumentfragment.php                      29-May-2024 00:07               28504
class.domdocumenttype.php                          29-May-2024 00:07               26621
class.domelement.php                               29-May-2024 00:07               52364
class.domentity.php                                29-May-2024 00:07               27249
class.domentityreference.php                       29-May-2024 00:07               22742
class.domexception.php                             29-May-2024 00:07                9394
class.domimplementation.php                        29-May-2024 00:07                5947
class.domnamednodemap.php                          29-May-2024 00:07                7562
class.domnamespacenode.php                         29-May-2024 00:07                9433
class.domnode.php                                  29-May-2024 00:07               31660
class.domnodelist.php                              29-May-2024 00:07                6132
class.domnotation.php                              29-May-2024 00:07               23050
class.domparentnode.php                            29-May-2024 00:07                3914
class.domprocessinginstruction.php                 29-May-2024 00:07               24289
class.domtext.php                                  29-May-2024 00:07               33204
class.domxpath.php                                 29-May-2024 00:07                8817
class.dotnet.php                                   29-May-2024 00:07                7149
class.ds-collection.php                            29-May-2024 00:07                6034
class.ds-deque.php                                 29-May-2024 00:07               22125
class.ds-hashable.php                              29-May-2024 00:07                4126
class.ds-map.php                                   29-May-2024 00:07               23065
class.ds-pair.php                                  29-May-2024 00:07                4602
class.ds-priorityqueue.php                         29-May-2024 00:07                8382
class.ds-queue.php                                 29-May-2024 00:07                7868
class.ds-sequence.php                              29-May-2024 00:07               23650
class.ds-set.php                                   29-May-2024 00:07               18596
class.ds-stack.php                                 29-May-2024 00:07                7200
class.ds-vector.php                                29-May-2024 00:07               21661
class.emptyiterator.php                            29-May-2024 00:07                4089
class.enchantbroker.php                            29-May-2024 00:07                1844
class.enchantdictionary.php                        29-May-2024 00:07                1834
class.error.php                                    29-May-2024 00:07               10963
class.errorexception.php                           29-May-2024 00:07               14759
class.ev.php                                       29-May-2024 00:07               42357
class.evcheck.php                                  29-May-2024 00:07               10865
class.evchild.php                                  29-May-2024 00:07               12538
class.evembed.php                                  29-May-2024 00:07               10031
class.event.php                                    29-May-2024 00:07               18454
class.eventbase.php                                29-May-2024 00:07               14913
class.eventbuffer.php                              29-May-2024 00:07               23406
class.eventbufferevent.php                         29-May-2024 00:07               37898
class.eventconfig.php                              29-May-2024 00:07                7848
class.eventdnsbase.php                             29-May-2024 00:07               14283
class.eventexception.php                           29-May-2024 00:07                8564
class.eventhttp.php                                29-May-2024 00:07                9716
class.eventhttpconnection.php                      29-May-2024 00:07               10532
class.eventhttprequest.php                         29-May-2024 00:07               22869
class.eventlistener.php                            29-May-2024 00:07               12802
class.eventsslcontext.php                          29-May-2024 00:07               19167
class.eventutil.php                                29-May-2024 00:07               25568
class.evfork.php                                   29-May-2024 00:07                9031
class.evidle.php                                   29-May-2024 00:07                9858
class.evio.php                                     29-May-2024 00:07               12645
class.evloop.php                                   29-May-2024 00:07               31538
class.evperiodic.php                               29-May-2024 00:07               14960
class.evprepare.php                                29-May-2024 00:07               11004
class.evsignal.php                                 29-May-2024 00:07               11949
class.evstat.php                                   29-May-2024 00:07               14425
class.evtimer.php                                  29-May-2024 00:07               14338
class.evwatcher.php                                29-May-2024 00:07                9999
class.exception.php                                29-May-2024 00:07               11155
class.fannconnection.php                           29-May-2024 00:07                6570
class.ffi-cdata.php                                29-May-2024 00:07                6179
class.ffi-ctype.php                                29-May-2024 00:07               31266
class.ffi-exception.php                            29-May-2024 00:07                8250
class.ffi-parserexception.php                      29-May-2024 00:07                8305
class.ffi.php                                      29-May-2024 00:07               18400
class.fiber.php                                    29-May-2024 00:07                7965
class.fibererror.php                               29-May-2024 00:07                8124
class.filesystemiterator.php                       29-May-2024 00:07               31794
class.filteriterator.php                           29-May-2024 00:07                7341
class.finfo.php                                    29-May-2024 00:07                6315
class.ftp-connection.php                           29-May-2024 00:07                1820
class.gdfont.php                                   29-May-2024 00:07                1751
class.gdimage.php                                  29-May-2024 00:07                1748
class.gearmanclient.php                            29-May-2024 00:07               37792
class.gearmanexception.php                         29-May-2024 00:07                7258
class.gearmanjob.php                               29-May-2024 00:07                9254
class.gearmantask.php                              29-May-2024 00:07                8897
class.gearmanworker.php                            29-May-2024 00:07               13468
class.gender.php                                   29-May-2024 00:07               42239
class.generator.php                                29-May-2024 00:07                6700
class.globiterator.php                             29-May-2024 00:07               26528
class.gmagick.php                                  29-May-2024 00:07               87080
class.gmagickdraw.php                              29-May-2024 00:07               24472
class.gmagickpixel.php                             29-May-2024 00:07                5949
class.gmp.php                                      29-May-2024 00:07                4236
class.hashcontext.php                              29-May-2024 00:07                3384
class.hrtime-performancecounter.php                29-May-2024 00:07                3852
class.hrtime-stopwatch.php                         29-May-2024 00:07                7074
class.hrtime-unit.php                              29-May-2024 00:07                4440
class.imagick.php                                  29-May-2024 00:07              296718
class.imagickdraw.php                              29-May-2024 00:07               85593
class.imagickkernel.php                            29-May-2024 00:07                6561
class.imagickpixel.php                             29-May-2024 00:07               14027
class.imagickpixeliterator.php                     29-May-2024 00:07               10004
class.imap-connection.php                          29-May-2024 00:07                1827
class.infiniteiterator.php                         29-May-2024 00:07                5326
class.inflatecontext.php                           29-May-2024 00:07                1814
class.internaliterator.php                         29-May-2024 00:07                4856
class.intlbreakiterator.php                        29-May-2024 00:07               30526
class.intlcalendar.php                             29-May-2024 00:07               72240
class.intlchar.php                                 29-May-2024 00:07              473346
class.intlcodepointbreakiterator.php               29-May-2024 00:07               21558
class.intldateformatter.php                        29-May-2024 00:07               33006
class.intldatepatterngenerator.php                 29-May-2024 00:07                4743
class.intlexception.php                            29-May-2024 00:07                8667
class.intlgregoriancalendar.php                    29-May-2024 00:07               53277
class.intliterator.php                             29-May-2024 00:07                5073
class.intlpartsiterator.php                        29-May-2024 00:07                7161
class.intlrulebasedbreakiterator.php               29-May-2024 00:07               24473
class.intltimezone.php                             29-May-2024 00:07               28357
class.invalidargumentexception.php                 29-May-2024 00:07                8571
class.iterator.php                                 29-May-2024 00:07               11483
class.iteratoraggregate.php                        29-May-2024 00:07                6845
class.iteratoriterator.php                         29-May-2024 00:07                6322
class.jsonexception.php                            29-May-2024 00:07                9142
class.jsonserializable.php                         29-May-2024 00:07                2834
class.ldap-connection.php                          29-May-2024 00:07                1829
class.ldap-result-entry.php                        29-May-2024 00:07                1844
class.ldap-result.php                              29-May-2024 00:07                1821
class.lengthexception.php                          29-May-2024 00:07                8497
class.libxmlerror.php                              29-May-2024 00:07                5702
class.limititerator.php                            29-May-2024 00:07               11275
class.locale.php                                   29-May-2024 00:07               29032
class.logicexception.php                           29-May-2024 00:07                8557
class.lua.php                                      29-May-2024 00:07                7789
class.luaclosure.php                               29-May-2024 00:07                2702
class.luasandbox.php                               29-May-2024 00:07               14175
class.luasandboxerror.php                          29-May-2024 00:07               10131
class.luasandboxerrorerror.php                     29-May-2024 00:07                7669
class.luasandboxfatalerror.php                     29-May-2024 00:07                7791
class.luasandboxfunction.php                       29-May-2024 00:07                3961
class.luasandboxmemoryerror.php                    29-May-2024 00:07                7987
class.luasandboxruntimeerror.php                   29-May-2024 00:07                7811
class.luasandboxsyntaxerror.php                    29-May-2024 00:07                7673
class.luasandboxtimeouterror.php                   29-May-2024 00:07                7970
class.memcache.php                                 29-May-2024 00:07               19185
class.memcached.php                                29-May-2024 00:07               47520
class.memcachedexception.php                       29-May-2024 00:07                7552
class.messageformatter.php                         29-May-2024 00:07               12601
class.mongodb-bson-binary.php                      29-May-2024 00:07               16925
class.mongodb-bson-binaryinterface.php             29-May-2024 00:07                4753
class.mongodb-bson-dbpointer.php                   29-May-2024 00:07                6074
class.mongodb-bson-decimal128.php                  29-May-2024 00:07                7858
class.mongodb-bson-decimal128interface.php         29-May-2024 00:07                3880
class.mongodb-bson-document.php                    29-May-2024 00:07               14118
class.mongodb-bson-int64.php                       29-May-2024 00:07                7544
class.mongodb-bson-iterator.php                    29-May-2024 00:07                5026
class.mongodb-bson-javascript.php                  29-May-2024 00:07                8806
class.mongodb-bson-javascriptinterface.php         29-May-2024 00:07                4983
class.mongodb-bson-maxkey.php                      29-May-2024 00:07                5905
class.mongodb-bson-maxkeyinterface.php             29-May-2024 00:07                2241
class.mongodb-bson-minkey.php                      29-May-2024 00:07                5896
class.mongodb-bson-minkeyinterface.php             29-May-2024 00:07                2222
class.mongodb-bson-objectid.php                    29-May-2024 00:07                9265
class.mongodb-bson-objectidinterface.php           29-May-2024 00:07                4370
class.mongodb-bson-packedarray.php                 29-May-2024 00:07               11939
class.mongodb-bson-persistable.php                 29-May-2024 00:07                6189
class.mongodb-bson-regex.php                       29-May-2024 00:07                8237
class.mongodb-bson-regexinterface.php              29-May-2024 00:07                4772
class.mongodb-bson-serializable.php                29-May-2024 00:07                4267
class.mongodb-bson-symbol.php                      29-May-2024 00:07                5962
class.mongodb-bson-timestamp.php                   29-May-2024 00:07                8484
class.mongodb-bson-timestampinterface.php          29-May-2024 00:07                4930
class.mongodb-bson-type.php                        29-May-2024 00:07                2067
class.mongodb-bson-undefined.php                   29-May-2024 00:07                6050
class.mongodb-bson-unserializable.php              29-May-2024 00:07                4010
class.mongodb-bson-utcdatetime.php                 29-May-2024 00:07                8084
class.mongodb-bson-utcdatetimeinterface.php        29-May-2024 00:07                4443
class.mongodb-driver-bulkwrite.php                 29-May-2024 00:07               24165
class.mongodb-driver-clientencryption.php          29-May-2024 00:07               23506
class.mongodb-driver-command.php                   29-May-2024 00:07               14269
class.mongodb-driver-cursor.php                    29-May-2024 00:07               25855
class.mongodb-driver-cursorid.php                  29-May-2024 00:07                5593
class.mongodb-driver-cursorinterface.php           29-May-2024 00:07                6231
class.mongodb-driver-exception-authenticationex..> 29-May-2024 00:07                9223
class.mongodb-driver-exception-bulkwriteexcepti..> 29-May-2024 00:07               10077
class.mongodb-driver-exception-commandexception..> 29-May-2024 00:07               10979
class.mongodb-driver-exception-connectionexcept..> 29-May-2024 00:07                9292
class.mongodb-driver-exception-connectiontimeou..> 29-May-2024 00:07                9680
class.mongodb-driver-exception-encryptionexcept..> 29-May-2024 00:07                9226
class.mongodb-driver-exception-exception.php       29-May-2024 00:07                2236
class.mongodb-driver-exception-executiontimeout..> 29-May-2024 00:07               10337
class.mongodb-driver-exception-invalidargumente..> 29-May-2024 00:07                8252
class.mongodb-driver-exception-logicexception.php  29-May-2024 00:07                8136
class.mongodb-driver-exception-runtimeexception..> 29-May-2024 00:07               11734
class.mongodb-driver-exception-serverexception.php 29-May-2024 00:07                9303
class.mongodb-driver-exception-sslconnectionexc..> 29-May-2024 00:07                9569
class.mongodb-driver-exception-unexpectedvaluee..> 29-May-2024 00:07                8269
class.mongodb-driver-exception-writeexception.php  29-May-2024 00:07               12252
class.mongodb-driver-manager.php                   29-May-2024 00:07               21855
class.mongodb-driver-monitoring-commandfailedev..> 29-May-2024 00:07                8680
class.mongodb-driver-monitoring-commandstartede..> 29-May-2024 00:07                7603
class.mongodb-driver-monitoring-commandsubscrib..> 29-May-2024 00:07                6316
class.mongodb-driver-monitoring-commandsucceede..> 29-May-2024 00:07                8271
class.mongodb-driver-monitoring-logsubscriber.php  29-May-2024 00:07               10158
class.mongodb-driver-monitoring-sdamsubscriber.php 29-May-2024 00:07               11666
class.mongodb-driver-monitoring-serverchangedev..> 29-May-2024 00:07                5793
class.mongodb-driver-monitoring-serverclosedeve..> 29-May-2024 00:07                4440
class.mongodb-driver-monitoring-serverheartbeat..> 29-May-2024 00:07                5791
class.mongodb-driver-monitoring-serverheartbeat..> 29-May-2024 00:07                4618
class.mongodb-driver-monitoring-serverheartbeat..> 29-May-2024 00:07                5863
class.mongodb-driver-monitoring-serveropeningev..> 29-May-2024 00:07                4460
class.mongodb-driver-monitoring-subscriber.php     29-May-2024 00:07                2682
class.mongodb-driver-monitoring-topologychanged..> 29-May-2024 00:07                4788
class.mongodb-driver-monitoring-topologyclosede..> 29-May-2024 00:07                3399
class.mongodb-driver-monitoring-topologyopening..> 29-May-2024 00:07                3413
class.mongodb-driver-query.php                     29-May-2024 00:07                3472
class.mongodb-driver-readconcern.php               29-May-2024 00:07               17754
class.mongodb-driver-readpreference.php            29-May-2024 00:07               21956
class.mongodb-driver-server.php                    29-May-2024 00:07               27226
class.mongodb-driver-serverapi.php                 29-May-2024 00:07               14130
class.mongodb-driver-serverdescription.php         29-May-2024 00:07               16924
class.mongodb-driver-session.php                   29-May-2024 00:07               15583
class.mongodb-driver-topologydescription.php       29-May-2024 00:07               11688
class.mongodb-driver-writeconcern.php              29-May-2024 00:07               10341
class.mongodb-driver-writeconcernerror.php         29-May-2024 00:07                4431
class.mongodb-driver-writeerror.php                29-May-2024 00:07                4755
class.mongodb-driver-writeresult.php               29-May-2024 00:07                8733
class.multipleiterator.php                         29-May-2024 00:07               11571
class.mysql-xdevapi-baseresult.php                 29-May-2024 00:07                3096
class.mysql-xdevapi-client.php                     29-May-2024 00:07                3178
class.mysql-xdevapi-collection.php                 29-May-2024 00:07               10856
class.mysql-xdevapi-collectionadd.php              29-May-2024 00:07                2997
class.mysql-xdevapi-collectionfind.php             29-May-2024 00:07                8877
class.mysql-xdevapi-collectionmodify.php           29-May-2024 00:07               10334
class.mysql-xdevapi-collectionremove.php           29-May-2024 00:07                5271
class.mysql-xdevapi-columnresult.php               29-May-2024 00:07                6821
class.mysql-xdevapi-crudoperationbindable.php      29-May-2024 00:07                3033
class.mysql-xdevapi-crudoperationlimitable.php     29-May-2024 00:07                3039
class.mysql-xdevapi-crudoperationskippable.php     29-May-2024 00:07                3050
class.mysql-xdevapi-crudoperationsortable.php      29-May-2024 00:07                3026
class.mysql-xdevapi-databaseobject.php             29-May-2024 00:07                3597
class.mysql-xdevapi-docresult.php                  29-May-2024 00:07                4099
class.mysql-xdevapi-exception.php                  29-May-2024 00:07                2252
class.mysql-xdevapi-executable.php                 29-May-2024 00:07                2675
class.mysql-xdevapi-executionstatus.php            29-May-2024 00:07                4913
class.mysql-xdevapi-expression.php                 29-May-2024 00:07                3306
class.mysql-xdevapi-result.php                     29-May-2024 00:07                4483
class.mysql-xdevapi-rowresult.php                  29-May-2024 00:07                5196
class.mysql-xdevapi-schema.php                     29-May-2024 00:07                7910
class.mysql-xdevapi-schemaobject.php               29-May-2024 00:07                2860
class.mysql-xdevapi-session.php                    29-May-2024 00:07                9760
class.mysql-xdevapi-sqlstatement.php               29-May-2024 00:07                6718
class.mysql-xdevapi-sqlstatementresult.php         29-May-2024 00:07                7378
class.mysql-xdevapi-statement.php                  29-May-2024 00:07                5078
class.mysql-xdevapi-table.php                      29-May-2024 00:07                7479
class.mysql-xdevapi-tabledelete.php                29-May-2024 00:07                5236
class.mysql-xdevapi-tableinsert.php                29-May-2024 00:07                3557
class.mysql-xdevapi-tableselect.php                29-May-2024 00:07                8381
class.mysql-xdevapi-tableupdate.php                29-May-2024 00:07                6171
class.mysql-xdevapi-warning.php                    29-May-2024 00:07                3803
class.mysqli-driver.php                            29-May-2024 00:07                8057
class.mysqli-result.php                            29-May-2024 00:07               16113
class.mysqli-sql-exception.php                     29-May-2024 00:07               10104
class.mysqli-stmt.php                              29-May-2024 00:07               18803
class.mysqli-warning.php                           29-May-2024 00:07                4437
class.mysqli.php                                   29-May-2024 00:07               45324
class.norewinditerator.php                         29-May-2024 00:07                6763
class.normalizer.php                               29-May-2024 00:07               13866
class.numberformatter.php                          29-May-2024 00:07               75129
class.oauth.php                                    29-May-2024 00:07               20050
class.oauthexception.php                           29-May-2024 00:07                8599
class.oauthprovider.php                            29-May-2024 00:07               12974
class.ocicollection.php                            29-May-2024 00:07                7157
class.ocilob.php                                   29-May-2024 00:07               15386
class.opensslasymmetrickey.php                     29-May-2024 00:07                1918
class.opensslcertificate.php                       29-May-2024 00:07                1934
class.opensslcertificatesigningrequest.php         29-May-2024 00:07                2021
class.outeriterator.php                            29-May-2024 00:07                4389
class.outofboundsexception.php                     29-May-2024 00:07                8606
class.outofrangeexception.php                      29-May-2024 00:07                8608
class.overflowexception.php                        29-May-2024 00:07                8527
class.override.php                                 29-May-2024 00:07                4064
class.parallel-channel.php                         29-May-2024 00:07                8255
class.parallel-events-event-type.php               29-May-2024 00:07                3418
class.parallel-events-event.php                    29-May-2024 00:07                3571
class.parallel-events-input.php                    29-May-2024 00:07                4806
class.parallel-events.php                          29-May-2024 00:07                7175
class.parallel-future.php                          29-May-2024 00:07                7844
class.parallel-runtime.php                         29-May-2024 00:07                6455
class.parallel-sync.php                            29-May-2024 00:07                5276
class.parentiterator.php                           29-May-2024 00:07                9651
class.parle-errorinfo.php                          29-May-2024 00:07                3902
class.parle-lexer.php                              29-May-2024 00:07               13231
class.parle-lexerexception.php                     29-May-2024 00:07                7808
class.parle-parser.php                             29-May-2024 00:07               18159
class.parle-parserexception.php                    29-May-2024 00:07                7790
class.parle-rlexer.php                             29-May-2024 00:07               15466
class.parle-rparser.php                            29-May-2024 00:07               18332
class.parle-stack.php                              29-May-2024 00:07                4866
class.parle-token.php                              29-May-2024 00:07                4965
class.parseerror.php                               29-May-2024 00:07                9005
class.pdo.php                                      29-May-2024 00:07               43086
class.pdoexception.php                             29-May-2024 00:07               10510
class.pdorow.php                                   29-May-2024 00:07                4088
class.pdostatement.php                             29-May-2024 00:07               23697
class.pgsql-connection.php                         29-May-2024 00:07                1852
class.pgsql-lob.php                                29-May-2024 00:07                1794
class.pgsql-result.php                             29-May-2024 00:07                1826
class.phar.php                                     29-May-2024 00:07               74240
class.phardata.php                                 29-May-2024 00:07               49646
class.pharexception.php                            29-May-2024 00:07                8496
class.pharfileinfo.php                             29-May-2024 00:07               21703
class.php-user-filter.php                          29-May-2024 00:07                6558
class.phptoken.php                                 29-May-2024 00:07                9076
class.pool.php                                     29-May-2024 00:07                7752
class.pspell-config.php                            29-May-2024 00:07                1828
class.pspell-dictionary.php                        29-May-2024 00:07                1865
class.quickhashinthash.php                         29-May-2024 00:07               15140
class.quickhashintset.php                          29-May-2024 00:07               12923
class.quickhashintstringhash.php                   29-May-2024 00:07               16036
class.quickhashstringinthash.php                   29-May-2024 00:07               13705
class.random-brokenrandomengineerror.php           29-May-2024 00:07                8588
class.random-cryptosafeengine.php                  29-May-2024 00:07                2515
class.random-engine-mt19937.php                    29-May-2024 00:07                5407
class.random-engine-pcgoneseq128xslrr64.php        29-May-2024 00:07                6221
class.random-engine-secure.php                     29-May-2024 00:07                3448
class.random-engine-xoshiro256starstar.php         29-May-2024 00:07                6406
class.random-engine.php                            29-May-2024 00:07                3801
class.random-randomerror.php                       29-May-2024 00:07                8512
class.random-randomexception.php                   29-May-2024 00:07                8632
class.random-randomizer.php                        29-May-2024 00:07               10611
class.rangeexception.php                           29-May-2024 00:07                8736
class.rararchive.php                               29-May-2024 00:07                7768
class.rarentry.php                                 29-May-2024 00:07               49827
class.rarexception.php                             29-May-2024 00:07                8349
class.recursivearrayiterator.php                   29-May-2024 00:07               15959
class.recursivecachingiterator.php                 29-May-2024 00:07               14167
class.recursivecallbackfilteriterator.php          29-May-2024 00:07               13236
class.recursivedirectoryiterator.php               29-May-2024 00:07               29861
class.recursivefilteriterator.php                  29-May-2024 00:07                8282
class.recursiveiterator.php                        29-May-2024 00:07                4927
class.recursiveiteratoriterator.php                29-May-2024 00:07               14673
class.recursiveregexiterator.php                   29-May-2024 00:07               14805
class.recursivetreeiterator.php                    29-May-2024 00:07               25695
class.reflection.php                               29-May-2024 00:07                3554
class.reflectionattribute.php                      29-May-2024 00:07                6443
class.reflectionclass.php                          29-May-2024 00:07               38765
class.reflectionclassconstant.php                  29-May-2024 00:07               16417
class.reflectionenum.php                           29-May-2024 00:07               31727
class.reflectionenumbackedcase.php                 29-May-2024 00:07               12992
class.reflectionenumunitcase.php                   29-May-2024 00:07               12622
class.reflectionexception.php                      29-May-2024 00:07                8669
class.reflectionextension.php                      29-May-2024 00:07               10974
class.reflectionfiber.php                          29-May-2024 00:07                5217
class.reflectionfunction.php                       29-May-2024 00:07               21445
class.reflectionfunctionabstract.php               29-May-2024 00:07               20450
class.reflectiongenerator.php                      29-May-2024 00:07                6377
class.reflectionintersectiontype.php               29-May-2024 00:07                3485
class.reflectionmethod.php                         29-May-2024 00:07               32925
class.reflectionnamedtype.php                      29-May-2024 00:07                3798
class.reflectionobject.php                         29-May-2024 00:07               29555
class.reflectionparameter.php                      29-May-2024 00:07               17107
class.reflectionproperty.php                       29-May-2024 00:07               23115
class.reflectionreference.php                      29-May-2024 00:07                4172
class.reflectiontype.php                           29-May-2024 00:07                4544
class.reflectionuniontype.php                      29-May-2024 00:07                3271
class.reflectionzendextension.php                  29-May-2024 00:07                7919
class.reflector.php                                29-May-2024 00:07                4032
class.regexiterator.php                            29-May-2024 00:07               17649
class.resourcebundle.php                           29-May-2024 00:07               10472
class.returntypewillchange.php                     29-May-2024 00:07                3311
class.rnpffi.php                                   29-May-2024 00:07                1685
class.rrdcreator.php                               29-May-2024 00:07                4529
class.rrdgraph.php                                 29-May-2024 00:07                3951
class.rrdupdater.php                               29-May-2024 00:07                3337
class.runtimeexception.php                         29-May-2024 00:07                8514
class.seaslog.php                                  29-May-2024 00:07               21987
class.seekableiterator.php                         29-May-2024 00:07               11384
class.sensitiveparameter.php                       29-May-2024 00:07                6391
class.sensitiveparametervalue.php                  29-May-2024 00:07                5060
class.serializable.php                             29-May-2024 00:07                8402
class.sessionhandler.php                           29-May-2024 00:07               25987
class.sessionhandlerinterface.php                  29-May-2024 00:07               15833
class.sessionidinterface.php                       29-May-2024 00:07                3227
class.sessionupdatetimestamphandlerinterface.php   29-May-2024 00:07                4525
class.shmop.php                                    29-May-2024 00:07                1726
class.simdjsonexception.php                        29-May-2024 00:07                5064
class.simdjsonvalueerror.php                       29-May-2024 00:07                8385
class.simplexmlelement.php                         29-May-2024 00:07               18930
class.simplexmliterator.php                        29-May-2024 00:07               16669
class.snmp.php                                     29-May-2024 00:07               28322
class.snmpexception.php                            29-May-2024 00:07                9100
class.soapclient.php                               29-May-2024 00:07               34291
class.soapfault.php                                29-May-2024 00:07               14367
class.soapheader.php                               29-May-2024 00:07                6072
class.soapparam.php                                29-May-2024 00:07                3750
class.soapserver.php                               29-May-2024 00:07                9946
class.soapvar.php                                  29-May-2024 00:07                7884
class.socket.php                                   29-May-2024 00:07                1790
class.sodiumexception.php                          29-May-2024 00:07                8445
class.solrclient.php                               29-May-2024 00:07               24750
class.solrclientexception.php                      29-May-2024 00:07                9750
class.solrcollapsefunction.php                     29-May-2024 00:07               11810
class.solrdismaxquery.php                          29-May-2024 00:07              111922
class.solrdocument.php                             29-May-2024 00:07               23468
class.solrdocumentfield.php                        29-May-2024 00:07                4677
class.solrexception.php                            29-May-2024 00:07               10138
class.solrgenericresponse.php                      29-May-2024 00:07               12686
class.solrillegalargumentexception.php             29-May-2024 00:07                9874
class.solrillegaloperationexception.php            29-May-2024 00:07                9912
class.solrinputdocument.php                        29-May-2024 00:07               19507
class.solrmissingmandatoryparameterexception.php   29-May-2024 00:07                9044
class.solrmodifiableparams.php                     29-May-2024 00:07                9004
class.solrobject.php                               29-May-2024 00:07                5867
class.solrparams.php                               29-May-2024 00:07                9161
class.solrpingresponse.php                         29-May-2024 00:07               11155
class.solrquery.php                                29-May-2024 00:07              119020
class.solrqueryresponse.php                        29-May-2024 00:07               12605
class.solrresponse.php                             29-May-2024 00:07               14344
class.solrserverexception.php                      29-May-2024 00:07                9756
class.solrupdateresponse.php                       29-May-2024 00:07               12653
class.solrutils.php                                29-May-2024 00:07                4972
class.spldoublylinkedlist.php                      29-May-2024 00:07               17473
class.splfileinfo.php                              29-May-2024 00:07               18054
class.splfileobject.php                            29-May-2024 00:07               37274
class.splfixedarray.php                            29-May-2024 00:07               19890
class.splheap.php                                  29-May-2024 00:07                7779
class.splmaxheap.php                               29-May-2024 00:07                7223
class.splminheap.php                               29-May-2024 00:07                7233
class.splobjectstorage.php                         29-May-2024 00:07               21109
class.splobserver.php                              29-May-2024 00:07                2856
class.splpriorityqueue.php                         29-May-2024 00:07               11816
class.splqueue.php                                 29-May-2024 00:07               17187
class.splstack.php                                 29-May-2024 00:07               14406
class.splsubject.php                               29-May-2024 00:07                3725
class.spltempfileobject.php                        29-May-2024 00:07               31838
class.spoofchecker.php                             29-May-2024 00:07               17617
class.sqlite3.php                                  29-May-2024 00:07               40119
class.sqlite3exception.php                         29-May-2024 00:07                8437
class.sqlite3result.php                            29-May-2024 00:07                5905
class.sqlite3stmt.php                              29-May-2024 00:07                8432
class.stdclass.php                                 29-May-2024 00:07                6725
class.stomp.php                                    29-May-2024 00:07               21693
class.stompexception.php                           29-May-2024 00:07                5905
class.stompframe.php                               29-May-2024 00:07                4376
class.streamwrapper.php                            29-May-2024 00:07               20798
class.stringable.php                               29-May-2024 00:07                8308
class.svm.php                                      29-May-2024 00:07               18484
class.svmmodel.php                                 29-May-2024 00:07                6949
class.swoole-async.php                             29-May-2024 00:07                8041
class.swoole-atomic.php                            29-May-2024 00:07                5070
class.swoole-buffer.php                            29-May-2024 00:07                7525
class.swoole-channel.php                           29-May-2024 00:07                3968
class.swoole-client.php                            29-May-2024 00:07               16534
class.swoole-connection-iterator.php               29-May-2024 00:07                7521
class.swoole-coroutine.php                         29-May-2024 00:07               18657
class.swoole-event.php                             29-May-2024 00:07                7464
class.swoole-exception.php                         29-May-2024 00:07                4579
class.swoole-http-client.php                       29-May-2024 00:07               14785
class.swoole-http-request.php                      29-May-2024 00:07                3033
class.swoole-http-response.php                     29-May-2024 00:07               10909
class.swoole-http-server.php                       29-May-2024 00:07               26443
class.swoole-lock.php                              29-May-2024 00:07                4678
class.swoole-mmap.php                              29-May-2024 00:07                3079
class.swoole-mysql-exception.php                   29-May-2024 00:07                4620
class.swoole-mysql.php                             29-May-2024 00:07                5417
class.swoole-process.php                           29-May-2024 00:07               13666
class.swoole-redis-server.php                      29-May-2024 00:07               32075
class.swoole-serialize.php                         29-May-2024 00:07                3611
class.swoole-server.php                            29-May-2024 00:07               29576
class.swoole-table.php                             29-May-2024 00:07               12716
class.swoole-timer.php                             29-May-2024 00:07                4999
class.swoole-websocket-frame.php                   29-May-2024 00:07                1952
class.swoole-websocket-server.php                  29-May-2024 00:07                7836
class.syncevent.php                                29-May-2024 00:07                4897
class.syncmutex.php                                29-May-2024 00:07                4223
class.syncreaderwriter.php                         29-May-2024 00:07                5206
class.syncsemaphore.php                            29-May-2024 00:07                4654
class.syncsharedmemory.php                         29-May-2024 00:07                5504
class.sysvmessagequeue.php                         29-May-2024 00:07                1836
class.sysvsemaphore.php                            29-May-2024 00:07                1821
class.sysvsharedmemory.php                         29-May-2024 00:07                1824
class.thread.php                                   29-May-2024 00:07               11427
class.threaded.php                                 29-May-2024 00:07                8845
class.throwable.php                                29-May-2024 00:07                7423
class.tidy.php                                     29-May-2024 00:07               16259
class.tidynode.php                                 29-May-2024 00:07               12063
class.transliterator.php                           29-May-2024 00:07               10182
class.traversable.php                              29-May-2024 00:07                4361
class.typeerror.php                                29-May-2024 00:07                9478
class.uconverter.php                               29-May-2024 00:07               41025
class.ui-area.php                                  29-May-2024 00:07               12256
class.ui-control.php                               29-May-2024 00:07                5476
class.ui-controls-box.php                          29-May-2024 00:07               10123
class.ui-controls-button.php                       29-May-2024 00:07                6684
class.ui-controls-check.php                        29-May-2024 00:07                7528
class.ui-controls-colorbutton.php                  29-May-2024 00:07                6563
class.ui-controls-combo.php                        29-May-2024 00:07                6652
class.ui-controls-editablecombo.php                29-May-2024 00:07                6764
class.ui-controls-entry.php                        29-May-2024 00:07                9646
class.ui-controls-form.php                         29-May-2024 00:07                8052
class.ui-controls-grid.php                         29-May-2024 00:07               13154
class.ui-controls-group.php                        29-May-2024 00:07                8360
class.ui-controls-label.php                        29-May-2024 00:07                6435
class.ui-controls-multilineentry.php               29-May-2024 00:07                9889
class.ui-controls-picker.php                       29-May-2024 00:07                7574
class.ui-controls-progress.php                     29-May-2024 00:07                5936
class.ui-controls-radio.php                        29-May-2024 00:07                6631
class.ui-controls-separator.php                    29-May-2024 00:07                7078
class.ui-controls-slider.php                       29-May-2024 00:07                7019
class.ui-controls-spin.php                         29-May-2024 00:07                6889
class.ui-controls-tab.php                          29-May-2024 00:07                9158
class.ui-draw-brush-gradient.php                   29-May-2024 00:07                7344
class.ui-draw-brush-lineargradient.php             29-May-2024 00:07                6594
class.ui-draw-brush-radialgradient.php             29-May-2024 00:07                6780
class.ui-draw-brush.php                            29-May-2024 00:07                4436
class.ui-draw-color.php                            29-May-2024 00:07                8584
class.ui-draw-line-cap.php                         29-May-2024 00:07                3740
class.ui-draw-line-join.php                        29-May-2024 00:07                3724
class.ui-draw-matrix.php                           29-May-2024 00:07                5626
class.ui-draw-path.php                             29-May-2024 00:07               10762
class.ui-draw-pen.php                              29-May-2024 00:07                8133
class.ui-draw-stroke.php                           29-May-2024 00:07                6884
class.ui-draw-text-font-descriptor.php             29-May-2024 00:07                6046
class.ui-draw-text-font-italic.php                 29-May-2024 00:07                4099
class.ui-draw-text-font-stretch.php                29-May-2024 00:07                8295
class.ui-draw-text-font-weight.php                 29-May-2024 00:07                8897
class.ui-draw-text-font.php                        29-May-2024 00:07                4875
class.ui-draw-text-layout.php                      29-May-2024 00:07                5285
class.ui-exception-invalidargumentexception.php    29-May-2024 00:07                7822
class.ui-exception-runtimeexception.php            29-May-2024 00:07                7745
class.ui-executor.php                              29-May-2024 00:07                5436
class.ui-key.php                                   29-May-2024 00:07               21339
class.ui-menu.php                                  29-May-2024 00:07                6294
class.ui-menuitem.php                              29-May-2024 00:07                3764
class.ui-point.php                                 29-May-2024 00:07                6304
class.ui-size.php                                  29-May-2024 00:07                6405
class.ui-window.php                                29-May-2024 00:07               13102
class.underflowexception.php                       29-May-2024 00:07                8598
class.unexpectedvalueexception.php                 29-May-2024 00:07                8760
class.unhandledmatcherror.php                      29-May-2024 00:07                8582
class.unitenum.php                                 29-May-2024 00:07                2815
class.v8js.php                                     29-May-2024 00:07                9057
class.v8jsexception.php                            29-May-2024 00:07               11380
class.valueerror.php                               29-May-2024 00:07                8576
class.variant.php                                  29-May-2024 00:07                5998
class.varnishadmin.php                             29-May-2024 00:07               11536
class.varnishlog.php                               29-May-2024 00:07               34796
class.varnishstat.php                              29-May-2024 00:07                3013
class.volatile.php                                 29-May-2024 00:07               11748
class.vtiful-kernel-excel.php                      29-May-2024 00:07               12046
class.vtiful-kernel-format.php                     29-May-2024 00:07               16079
class.weakmap.php                                  29-May-2024 00:07                9331
class.weakreference.php                            29-May-2024 00:07                5695
class.win32serviceexception.php                    29-May-2024 00:07                7861
class.wkhtmltox-image-converter.php                29-May-2024 00:07                4163
class.wkhtmltox-pdf-converter.php                  29-May-2024 00:07                4505
class.wkhtmltox-pdf-object.php                     29-May-2024 00:07                2999
class.worker.php                                   29-May-2024 00:07                8558
class.xmldiff-base.php                             29-May-2024 00:07                4120
class.xmldiff-dom.php                              29-May-2024 00:07                5087
class.xmldiff-file.php                             29-May-2024 00:07                5063
class.xmldiff-memory.php                           29-May-2024 00:07                5095
class.xmlparser.php                                29-May-2024 00:07                1850
class.xmlreader.php                                29-May-2024 00:07               40232
class.xmlwriter.php                                29-May-2024 00:07               33215
class.xsltprocessor.php                            29-May-2024 00:07               11817
class.yac.php                                      29-May-2024 00:07                9566
class.yaconf.php                                   29-May-2024 00:07                3495
class.yaf-action-abstract.php                      29-May-2024 00:07               12744
class.yaf-application.php                          29-May-2024 00:07               12677
class.yaf-bootstrap-abstract.php                   29-May-2024 00:07                5564
class.yaf-config-abstract.php                      29-May-2024 00:07                5230
class.yaf-config-ini.php                           29-May-2024 00:07               17821
class.yaf-config-simple.php                        29-May-2024 00:07               13246
class.yaf-controller-abstract.php                  29-May-2024 00:07               19208
class.yaf-dispatcher.php                           29-May-2024 00:07               20266
class.yaf-exception-dispatchfailed.php             29-May-2024 00:07                2669
class.yaf-exception-loadfailed-action.php          29-May-2024 00:07                2740
class.yaf-exception-loadfailed-controller.php      29-May-2024 00:07                2765
class.yaf-exception-loadfailed-module.php          29-May-2024 00:07                2729
class.yaf-exception-loadfailed-view.php            29-May-2024 00:07                2669
class.yaf-exception-loadfailed.php                 29-May-2024 00:07                2643
class.yaf-exception-routerfailed.php               29-May-2024 00:07                2654
class.yaf-exception-startuperror.php               29-May-2024 00:07                2652
class.yaf-exception-typeerror.php                  29-May-2024 00:07                2623
class.yaf-exception.php                            29-May-2024 00:07                8523
class.yaf-loader.php                               29-May-2024 00:07               18761
class.yaf-plugin-abstract.php                      29-May-2024 00:07               16058
class.yaf-registry.php                             29-May-2024 00:07                6042
class.yaf-request-abstract.php                     29-May-2024 00:07               23754
class.yaf-request-http.php                         29-May-2024 00:07               23236
class.yaf-request-simple.php                       29-May-2024 00:07               22712
class.yaf-response-abstract.php                    29-May-2024 00:07               11824
class.yaf-route-interface.php                      29-May-2024 00:07                3747
class.yaf-route-map.php                            29-May-2024 00:07                6518
class.yaf-route-regex.php                          29-May-2024 00:07                8418
class.yaf-route-rewrite.php                        29-May-2024 00:07                7522
class.yaf-route-simple.php                         29-May-2024 00:07                6591
class.yaf-route-static.php                         29-May-2024 00:07                5067
class.yaf-route-supervar.php                       29-May-2024 00:07                4756
class.yaf-router.php                               29-May-2024 00:07               11996
class.yaf-session.php                              29-May-2024 00:07               12657
class.yaf-view-interface.php                       29-May-2024 00:07                6076
class.yaf-view-simple.php                          29-May-2024 00:07               11292
class.yar-client-exception.php                     29-May-2024 00:07                6660
class.yar-client.php                               29-May-2024 00:07                5845
class.yar-concurrent-client.php                    29-May-2024 00:07                6645
class.yar-server-exception.php                     29-May-2024 00:07                7117
class.yar-server.php                               29-May-2024 00:07                3500
class.ziparchive.php                               29-May-2024 00:07               90590
class.zmq.php                                      29-May-2024 00:07               41108
class.zmqcontext.php                               29-May-2024 00:07                5623
class.zmqdevice.php                                29-May-2024 00:07                7072
class.zmqpoll.php                                  29-May-2024 00:07                5208
class.zmqsocket.php                                29-May-2024 00:07               11485
class.zookeeper.php                                29-May-2024 00:07               56117
class.zookeeperauthenticationexception.php         29-May-2024 00:07                7752
class.zookeeperconfig.php                          29-May-2024 00:07                6456
class.zookeeperconnectionexception.php             29-May-2024 00:07                7747
class.zookeeperexception.php                       29-May-2024 00:07                7613
class.zookeepermarshallingexception.php            29-May-2024 00:07                7768
class.zookeepernonodeexception.php                 29-May-2024 00:07                7735
class.zookeeperoperationtimeoutexception.php       29-May-2024 00:07                7778
class.zookeepersessionexception.php                29-May-2024 00:07                7695
classobj.configuration.php                         29-May-2024 00:07                1331
classobj.constants.php                             29-May-2024 00:07                1232
classobj.examples.php                              29-May-2024 00:07               16470
classobj.installation.php                          29-May-2024 00:07                1294
classobj.requirements.php                          29-May-2024 00:07                1238
classobj.resources.php                             29-May-2024 00:07                1282
classobj.setup.php                                 29-May-2024 00:07                1649
closure.bind.php                                   29-May-2024 00:07                8038
closure.bindto.php                                 29-May-2024 00:07                9149
closure.call.php                                   29-May-2024 00:07                6333
closure.construct.php                              29-May-2024 00:07                2482
closure.fromcallable.php                           29-May-2024 00:07                3997
cmark.constants.php                                29-May-2024 00:07                4267
cmark.installation.php                             29-May-2024 00:07                1971
cmark.requirements.php                             29-May-2024 00:07                1320
cmark.setup.php                                    29-May-2024 00:07                1454
collator.asort.php                                 29-May-2024 00:07                9644
collator.compare.php                               29-May-2024 00:07               10773
collator.construct.php                             29-May-2024 00:07                5595
collator.create.php                                29-May-2024 00:07                5605
collator.getattribute.php                          29-May-2024 00:07                6234
collator.geterrorcode.php                          29-May-2024 00:07                5300
collator.geterrormessage.php                       29-May-2024 00:07                5361
collator.getlocale.php                             29-May-2024 00:07                7055
collator.getsortkey.php                            29-May-2024 00:07                7146
collator.getstrength.php                           29-May-2024 00:07                5016
collator.setattribute.php                          29-May-2024 00:07                6782
collator.setstrength.php                           29-May-2024 00:07               13773
collator.sort.php                                  29-May-2024 00:07                8736
collator.sortwithsortkeys.php                      29-May-2024 00:07                6687
collectable.isgarbage.php                          29-May-2024 00:07                3474
com.configuration.php                              29-May-2024 00:07                8270
com.constants.php                                  29-May-2024 00:07               26098
com.construct.php                                  29-May-2024 00:07                9723
com.error-handling.php                             29-May-2024 00:07                1585
com.examples.arrays.php                            29-May-2024 00:07                2186
com.examples.foreach.php                           29-May-2024 00:07                2850
com.examples.php                                   29-May-2024 00:07                1486
com.installation.php                               29-May-2024 00:07                1531
com.requirements.php                               29-May-2024 00:07                1315
com.resources.php                                  29-May-2024 00:07                1248
com.setup.php                                      29-May-2024 00:07                1606
commonmark-cql.construct.php                       29-May-2024 00:07                2250
commonmark-cql.invoke.php                          29-May-2024 00:07                3931
commonmark-interfaces-ivisitable.accept.php        29-May-2024 00:07                3173
commonmark-interfaces-ivisitor.enter.php           29-May-2024 00:07                4205
commonmark-interfaces-ivisitor.leave.php           29-May-2024 00:07                4207
commonmark-node-bulletlist.construct.php           29-May-2024 00:07                3236
commonmark-node-codeblock.construct.php            29-May-2024 00:07                2880
commonmark-node-heading.construct.php              29-May-2024 00:07                2677
commonmark-node-image.construct.php                29-May-2024 00:07                3323
commonmark-node-link.construct.php                 29-May-2024 00:07                3320
commonmark-node-orderedlist.construct.php          29-May-2024 00:07                4208
commonmark-node-text.construct.php                 29-May-2024 00:07                2708
commonmark-node.accept.php                         29-May-2024 00:07                2913
commonmark-node.appendchild.php                    29-May-2024 00:07                2751
commonmark-node.insertafter.php                    29-May-2024 00:07                2776
commonmark-node.insertbefore.php                   29-May-2024 00:07                2774
commonmark-node.prependchild.php                   29-May-2024 00:07                2778
commonmark-node.replace.php                        29-May-2024 00:07                2722
commonmark-node.unlink.php                         29-May-2024 00:07                2430
commonmark-parser.construct.php                    29-May-2024 00:07                3853
commonmark-parser.finish.php                       29-May-2024 00:07                2460
commonmark-parser.parse.php                        29-May-2024 00:07                2681
compersisthelper.construct.php                     29-May-2024 00:07                3743
compersisthelper.getcurfilename.php                29-May-2024 00:07                3187
compersisthelper.getmaxstreamsize.php              29-May-2024 00:07                3193
compersisthelper.initnew.php                       29-May-2024 00:07                3150
compersisthelper.loadfromfile.php                  29-May-2024 00:07                4356
compersisthelper.loadfromstream.php                29-May-2024 00:07                3573
compersisthelper.savetofile.php                    29-May-2024 00:07                6357
compersisthelper.savetostream.php                  29-May-2024 00:07                3600
componere-abstract-definition.addinterface.php     29-May-2024 00:07                3301
componere-abstract-definition.addmethod.php        29-May-2024 00:07                4027
componere-abstract-definition.addtrait.php         29-May-2024 00:07                3253
componere-abstract-definition.getreflector.php     29-May-2024 00:07                2420
componere-definition.addconstant.php               29-May-2024 00:07                4350
componere-definition.addproperty.php               29-May-2024 00:07                3759
componere-definition.construct.php                 29-May-2024 00:07                5989
componere-definition.getclosure.php                29-May-2024 00:07                3465
componere-definition.getclosures.php               29-May-2024 00:07                2702
componere-definition.isregistered.php              29-May-2024 00:07                2302
componere-definition.register.php                  29-May-2024 00:07                2448
componere-method.construct.php                     29-May-2024 00:07                2246
componere-method.getreflector.php                  29-May-2024 00:07                2223
componere-method.setprivate.php                    29-May-2024 00:07                2451
componere-method.setprotected.php                  29-May-2024 00:07                2466
componere-method.setstatic.php                     29-May-2024 00:07                2048
componere-patch.apply.php                          29-May-2024 00:07                1906
componere-patch.construct.php                      29-May-2024 00:07                3658
componere-patch.derive.php                         29-May-2024 00:07                3158
componere-patch.getclosure.php                     29-May-2024 00:07                3095
componere-patch.getclosures.php                    29-May-2024 00:07                2223
componere-patch.isapplied.php                      29-May-2024 00:07                1860
componere-patch.revert.php                         29-May-2024 00:07                1903
componere-value.construct.php                      29-May-2024 00:07                2679
componere-value.hasdefault.php                     29-May-2024 00:07                1909
componere-value.isprivate.php                      29-May-2024 00:07                1925
componere-value.isprotected.php                    29-May-2024 00:07                1935
componere-value.isstatic.php                       29-May-2024 00:07                1919
componere-value.setprivate.php                     29-May-2024 00:07                2474
componere-value.setprotected.php                   29-May-2024 00:07                2488
componere-value.setstatic.php                      29-May-2024 00:07                2065
componere.cast.php                                 29-May-2024 00:07                4938
componere.cast_by_ref.php                          29-May-2024 00:07                5103
componere.installation.php                         29-May-2024 00:07                1359
componere.requirements.php                         29-May-2024 00:07                1210
componere.setup.php                                29-May-2024 00:07                1493
configuration.changes.modes.php                    29-May-2024 00:07                3923
configuration.changes.php                          29-May-2024 00:07                8959
configuration.file.per-user.php                    29-May-2024 00:07                3127
configuration.file.php                             29-May-2024 00:07               10364
configuration.php                                  29-May-2024 00:07                1733
configure.about.php                                29-May-2024 00:07               13151
configure.php                                      29-May-2024 00:07                1506
context.ftp.php                                    29-May-2024 00:07                4437
context.http.php                                   29-May-2024 00:07               16100
context.params.php                                 29-May-2024 00:07                2593
context.phar.php                                   29-May-2024 00:07                2905
context.php                                        29-May-2024 00:07                3164
context.socket.php                                 29-May-2024 00:07                9666
context.ssl.php                                    29-May-2024 00:07               12870
context.zip.php                                    29-May-2024 00:07                4349
context.zlib.php                                   29-May-2024 00:07                2563
control-structures.alternative-syntax.php          29-May-2024 00:07                7108
control-structures.break.php                       29-May-2024 00:07                4792
control-structures.continue.php                    29-May-2024 00:07                8073
control-structures.declare.php                     29-May-2024 00:07               10342
control-structures.do.while.php                    29-May-2024 00:07                4564
control-structures.else.php                        29-May-2024 00:07                4869
control-structures.elseif.php                      29-May-2024 00:07                7668
control-structures.for.php                         29-May-2024 00:07               11788
control-structures.foreach.php                     29-May-2024 00:07               20880
control-structures.goto.php                        29-May-2024 00:07                7209
control-structures.if.php                          29-May-2024 00:07                5007
control-structures.intro.php                       29-May-2024 00:07                2457
control-structures.match.php                       29-May-2024 00:07               17756
control-structures.switch.php                      29-May-2024 00:07               18962
control-structures.while.php                       29-May-2024 00:07                4861
copyright.php                                      29-May-2024 00:07                2098
countable.count.php                                29-May-2024 00:07                5442
ctype.configuration.php                            29-May-2024 00:07                1310
ctype.constants.php                                29-May-2024 00:07                1233
ctype.installation.php                             29-May-2024 00:07                1526
ctype.requirements.php                             29-May-2024 00:07                1236
ctype.resources.php                                29-May-2024 00:07                1261
ctype.setup.php                                    29-May-2024 00:07                1615
cubrid.configuration.php                           29-May-2024 00:07                1262
cubrid.constants.php                               29-May-2024 00:07               13857
cubrid.examples.php                                29-May-2024 00:07               13866
cubrid.installation.php                            29-May-2024 00:07                2085
cubrid.requirements.php                            29-May-2024 00:07                1286
cubrid.resources.php                               29-May-2024 00:07                3151
cubrid.setup.php                                   29-May-2024 00:07                1629
cubridmysql.cubrid.php                             29-May-2024 00:07                4962
curl.configuration.php                             29-May-2024 00:07                2628
curl.constants.php                                 29-May-2024 00:07              187179
curl.examples-basic.php                            29-May-2024 00:07                4656
curl.examples.php                                  29-May-2024 00:07                1427
curl.installation.php                              29-May-2024 00:07                2500
curl.requirements.php                              29-May-2024 00:07                1498
curl.resources.php                                 29-May-2024 00:07                1442
curl.setup.php                                     29-May-2024 00:07                1623
curlfile.construct.php                             29-May-2024 00:07               21277
curlfile.getfilename.php                           29-May-2024 00:07                2202
curlfile.getmimetype.php                           29-May-2024 00:07                2293
curlfile.getpostfilename.php                       29-May-2024 00:07                2262
curlfile.setmimetype.php                           29-May-2024 00:07                2584
curlfile.setpostfilename.php                       29-May-2024 00:07                2619
curlstringfile.construct.php                       29-May-2024 00:07                7012
dateinterval.construct.php                         29-May-2024 00:07               13646
dateinterval.createfromdatestring.php              29-May-2024 00:07               15940
dateinterval.format.php                            29-May-2024 00:07               14742
dateperiod.construct.php                           29-May-2024 00:07               20241
dateperiod.createfromiso8601string.php             29-May-2024 00:07                7895
dateperiod.getdateinterval.php                     29-May-2024 00:07                4809
dateperiod.getenddate.php                          29-May-2024 00:07                7753
dateperiod.getrecurrences.php                      29-May-2024 00:07                8906
dateperiod.getstartdate.php                        29-May-2024 00:07                5284
datetime.add.php                                   29-May-2024 00:07                4918
datetime.configuration.php                         29-May-2024 00:07                6349
datetime.constants.php                             29-May-2024 00:07                2946
datetime.construct.php                             29-May-2024 00:07                6261
datetime.createfromformat.php                      29-May-2024 00:07                7365
datetime.createfromimmutable.php                   29-May-2024 00:07                4880
datetime.createfrominterface.php                   29-May-2024 00:07                4863
datetime.diff.php                                  29-May-2024 00:07               17221
datetime.error.tree.php                            29-May-2024 00:07                3337
datetime.examples-arithmetic.php                   29-May-2024 00:07               15141
datetime.examples.php                              29-May-2024 00:07                1465
datetime.format.php                                29-May-2024 00:07               26792
datetime.formats.php                               29-May-2024 00:07               55254
datetime.getlasterrors.php                         29-May-2024 00:07                1898
datetime.getoffset.php                             29-May-2024 00:07                7906
datetime.gettimestamp.php                          29-May-2024 00:07               10254
datetime.gettimezone.php                           29-May-2024 00:07                7835
datetime.installation.php                          29-May-2024 00:07                1688
datetime.modify.php                                29-May-2024 00:07               14254
datetime.requirements.php                          29-May-2024 00:07                1238
datetime.resources.php                             29-May-2024 00:07                1282
datetime.set-state.php                             29-May-2024 00:07                2888
datetime.setdate.php                               29-May-2024 00:07                5576
datetime.setisodate.php                            29-May-2024 00:07                5745
datetime.settime.php                               29-May-2024 00:07                7077
datetime.settimestamp.php                          29-May-2024 00:07                5040
datetime.settimezone.php                           29-May-2024 00:07                9350
datetime.setup.php                                 29-May-2024 00:07                1677
datetime.sub.php                                   29-May-2024 00:07                6280
datetime.wakeup.php                                29-May-2024 00:07                3069
datetimeimmutable.add.php                          29-May-2024 00:07               10513
datetimeimmutable.construct.php                    29-May-2024 00:07               18462
datetimeimmutable.createfromformat.php             29-May-2024 00:07               47049
datetimeimmutable.createfrominterface.php          29-May-2024 00:07                5127
datetimeimmutable.createfrommutable.php            29-May-2024 00:07                5037
datetimeimmutable.getlasterrors.php                29-May-2024 00:07                5641
datetimeimmutable.modify.php                       29-May-2024 00:07                9338
datetimeimmutable.set-state.php                    29-May-2024 00:07                2803
datetimeimmutable.setdate.php                      29-May-2024 00:07                9162
datetimeimmutable.setisodate.php                   29-May-2024 00:07               12746
datetimeimmutable.settime.php                      29-May-2024 00:07               11962
datetimeimmutable.settimestamp.php                 29-May-2024 00:07                5790
datetimeimmutable.settimezone.php                  29-May-2024 00:07                5997
datetimeimmutable.sub.php                          29-May-2024 00:07               11963
datetimezone.construct.php                         29-May-2024 00:07               10937
datetimezone.getlocation.php                       29-May-2024 00:07                5973
datetimezone.getname.php                           29-May-2024 00:07                3733
datetimezone.getoffset.php                         29-May-2024 00:07                7040
datetimezone.gettransitions.php                    29-May-2024 00:07               12165
datetimezone.listabbreviations.php                 29-May-2024 00:07                6094
datetimezone.listidentifiers.php                   29-May-2024 00:07               14623
dba.configuration.php                              29-May-2024 00:07                2376
dba.constants.php                                  29-May-2024 00:07                2211
dba.example.php                                    29-May-2024 00:07                6235
dba.examples.php                                   29-May-2024 00:07                1370
dba.installation.php                               29-May-2024 00:07                9503
dba.requirements.php                               29-May-2024 00:07                7286
dba.resources.php                                  29-May-2024 00:07                1515
dba.setup.php                                      29-May-2024 00:07                1610
dbase.configuration.php                            29-May-2024 00:07                1310
dbase.constants.php                                29-May-2024 00:07                3699
dbase.installation.php                             29-May-2024 00:07                1587
dbase.requirements.php                             29-May-2024 00:07                1217
dbase.resources.php                                29-May-2024 00:07                1527
dbase.setup.php                                    29-May-2024 00:07                1631
debugger-about.php                                 29-May-2024 00:07                1663
debugger.php                                       29-May-2024 00:07                1444
dio.configuration.php                              29-May-2024 00:07                1296
dio.constants.php                                  29-May-2024 00:07               11065
dio.installation.php                               29-May-2024 00:07                1996
dio.requirements.php                               29-May-2024 00:07                1203
dio.resources.php                                  29-May-2024 00:07                1393
dio.setup.php                                      29-May-2024 00:07                1606
dir.configuration.php                              29-May-2024 00:07                1296
dir.constants.php                                  29-May-2024 00:07                2842
dir.installation.php                               29-May-2024 00:07                1259
dir.requirements.php                               29-May-2024 00:07                1203
dir.resources.php                                  29-May-2024 00:07                1247
dir.setup.php                                      29-May-2024 00:07                1596
directory.close.php                                29-May-2024 00:07                2438
directory.read.php                                 29-May-2024 00:07                2564
directory.rewind.php                               29-May-2024 00:07                2454
directoryiterator.construct.php                    29-May-2024 00:07                5827
directoryiterator.current.php                      29-May-2024 00:07                6132
directoryiterator.getbasename.php                  29-May-2024 00:07                6439
directoryiterator.getextension.php                 29-May-2024 00:07                6174
directoryiterator.getfilename.php                  29-May-2024 00:07                5159
directoryiterator.isdot.php                        29-May-2024 00:07                5345
directoryiterator.key.php                          29-May-2024 00:07                6591
directoryiterator.next.php                         29-May-2024 00:07                5469
directoryiterator.rewind.php                       29-May-2024 00:07                5383
directoryiterator.seek.php                         29-May-2024 00:07                5322
directoryiterator.tostring.php                     29-May-2024 00:07                4664
directoryiterator.valid.php                        29-May-2024 00:07                5791
doc.changelog.php                                  29-May-2024 00:07                1346
dom.configuration.php                              29-May-2024 00:07                1296
dom.constants.php                                  29-May-2024 00:07               19887
dom.examples.php                                   29-May-2024 00:07                3028
dom.installation.php                               29-May-2024 00:07                1317
dom.requirements.php                               29-May-2024 00:07                1491
dom.resources.php                                  29-May-2024 00:07                1247
dom.setup.php                                      29-May-2024 00:07                1600
domattr.construct.php                              29-May-2024 00:07                5743
domattr.isid.php                                   29-May-2024 00:07                5267
domcdatasection.construct.php                      29-May-2024 00:07                5247
domcharacterdata.after.php                         29-May-2024 00:07                7765
domcharacterdata.appenddata.php                    29-May-2024 00:07                3903
domcharacterdata.before.php                        29-May-2024 00:07                7393
domcharacterdata.deletedata.php                    29-May-2024 00:07                5185
domcharacterdata.insertdata.php                    29-May-2024 00:07                4942
domcharacterdata.remove.php                        29-May-2024 00:07                5428
domcharacterdata.replacedata.php                   29-May-2024 00:07                5728
domcharacterdata.replacewith.php                   29-May-2024 00:07                7849
domcharacterdata.substringdata.php                 29-May-2024 00:07                5053
domchildnode.after.php                             29-May-2024 00:07                5691
domchildnode.before.php                            29-May-2024 00:07                5115
domchildnode.remove.php                            29-May-2024 00:07                3141
domchildnode.replacewith.php                       29-May-2024 00:07                5354
domcomment.construct.php                           29-May-2024 00:07                5436
domdocument.adoptnode.php                          29-May-2024 00:07                6734
domdocument.append.php                             29-May-2024 00:07                6816
domdocument.construct.php                          29-May-2024 00:07                4561
domdocument.createattribute.php                    29-May-2024 00:07                6098
domdocument.createattributens.php                  29-May-2024 00:07                6940
domdocument.createcdatasection.php                 29-May-2024 00:07                5711
domdocument.createcomment.php                      29-May-2024 00:07                6084
domdocument.createdocumentfragment.php             29-May-2024 00:07                5930
domdocument.createelement.php                      29-May-2024 00:07               11524
domdocument.createelementns.php                    29-May-2024 00:07               14294
domdocument.createentityreference.php              29-May-2024 00:07                6409
domdocument.createprocessinginstruction.php        29-May-2024 00:07                6727
domdocument.createtextnode.php                     29-May-2024 00:07                6129
domdocument.getelementbyid.php                     29-May-2024 00:07                6270
domdocument.getelementsbytagname.php               29-May-2024 00:07                6059
domdocument.getelementsbytagnamens.php             29-May-2024 00:07                7855
domdocument.importnode.php                         29-May-2024 00:07                9062
domdocument.load.php                               29-May-2024 00:07                6645
domdocument.loadhtml.php                           29-May-2024 00:07                7885
domdocument.loadhtmlfile.php                       29-May-2024 00:07                7981
domdocument.loadxml.php                            29-May-2024 00:07                6349
domdocument.normalizedocument.php                  29-May-2024 00:07                3006
domdocument.prepend.php                            29-May-2024 00:07                6908
domdocument.registernodeclass.php                  29-May-2024 00:07               21178
domdocument.relaxngvalidate.php                    29-May-2024 00:07                4038
domdocument.relaxngvalidatesource.php              29-May-2024 00:07                4080
domdocument.replacechildren.php                    29-May-2024 00:07                7205
domdocument.save.php                               29-May-2024 00:07                7619
domdocument.savehtml.php                           29-May-2024 00:07                7604
domdocument.savehtmlfile.php                       29-May-2024 00:07                7973
domdocument.savexml.php                            29-May-2024 00:07                9819
domdocument.schemavalidate.php                     29-May-2024 00:07                4520
domdocument.schemavalidatesource.php               29-May-2024 00:07                4524
domdocument.validate.php                           29-May-2024 00:07                6079
domdocument.xinclude.php                           29-May-2024 00:07                7799
domdocumentfragment.append.php                     29-May-2024 00:07                7506
domdocumentfragment.appendxml.php                  29-May-2024 00:07                5909
domdocumentfragment.construct.php                  29-May-2024 00:07                2172
domdocumentfragment.prepend.php                    29-May-2024 00:07                7564
domdocumentfragment.replacechildren.php            29-May-2024 00:07                7949
domelement.after.php                               29-May-2024 00:07                7443
domelement.append.php                              29-May-2024 00:07                7128
domelement.before.php                              29-May-2024 00:07                7028
domelement.construct.php                           29-May-2024 00:07                7034
domelement.getattribute.php                        29-May-2024 00:07                4228
domelement.getattributenames.php                   29-May-2024 00:07                3992
domelement.getattributenode.php                    29-May-2024 00:07                4167
domelement.getattributenodens.php                  29-May-2024 00:07                4704
domelement.getattributens.php                      29-May-2024 00:07                4149
domelement.getelementsbytagname.php                29-May-2024 00:07                3583
domelement.getelementsbytagnamens.php              29-May-2024 00:07                4919
domelement.hasattribute.php                        29-May-2024 00:07                3998
domelement.hasattributens.php                      29-May-2024 00:07                4522
domelement.insertadjacentelement.php               29-May-2024 00:07                6669
domelement.insertadjacenttext.php                  29-May-2024 00:07                6481
domelement.prepend.php                             29-May-2024 00:07                7178
domelement.remove.php                              29-May-2024 00:07                5071
domelement.removeattribute.php                     29-May-2024 00:07                4114
domelement.removeattributenode.php                 29-May-2024 00:07                4616
domelement.removeattributens.php                   29-May-2024 00:07                4527
domelement.replacechildren.php                     29-May-2024 00:07                7769
domelement.replacewith.php                         29-May-2024 00:07                7833
domelement.setattribute.php                        29-May-2024 00:07                6299
domelement.setattributenode.php                    29-May-2024 00:07                4976
domelement.setattributenodens.php                  29-May-2024 00:07                5088
domelement.setattributens.php                      29-May-2024 00:07                5256
domelement.setidattribute.php                      29-May-2024 00:07                4902
domelement.setidattributenode.php                  29-May-2024 00:07                4967
domelement.setidattributens.php                    29-May-2024 00:07                5384
domelement.toggleattribute.php                     29-May-2024 00:07                6442
domentityreference.construct.php                   29-May-2024 00:07                5073
domimplementation.construct.php                    29-May-2024 00:07                2279
domimplementation.createdocument.php               29-May-2024 00:07                7754
domimplementation.createdocumenttype.php           29-May-2024 00:07               10044
domimplementation.hasfeature.php                   29-May-2024 00:07                9127
domnamednodemap.count.php                          29-May-2024 00:07                2484
domnamednodemap.getiterator.php                    29-May-2024 00:07                3292
domnamednodemap.getnameditem.php                   29-May-2024 00:07                3379
domnamednodemap.getnameditemns.php                 29-May-2024 00:07                3860
domnamednodemap.item.php                           29-May-2024 00:07                3110
domnode.appendchild.php                            29-May-2024 00:07                8955
domnode.c14n.php                                   29-May-2024 00:07                5395
domnode.c14nfile.php                               29-May-2024 00:07                5725
domnode.clonenode.php                              29-May-2024 00:07                2799
domnode.contains.php                               29-May-2024 00:07                5377
domnode.getlineno.php                              29-May-2024 00:07                4914
domnode.getnodepath.php                            29-May-2024 00:07                5200
domnode.getrootnode.php                            29-May-2024 00:07                4420
domnode.hasattributes.php                          29-May-2024 00:07                3136
domnode.haschildnodes.php                          29-May-2024 00:07                3002
domnode.insertbefore.php                           29-May-2024 00:07                5615
domnode.isdefaultnamespace.php                     29-May-2024 00:07                3029
domnode.isequalnode.php                            29-May-2024 00:07                4716
domnode.issamenode.php                             29-May-2024 00:07                2814
domnode.issupported.php                            29-May-2024 00:07                3927
domnode.lookupnamespaceuri.php                     29-May-2024 00:07                3720
domnode.lookupprefix.php                           29-May-2024 00:07                3408
domnode.normalize.php                              29-May-2024 00:07                2856
domnode.removechild.php                            29-May-2024 00:07                6953
domnode.replacechild.php                           29-May-2024 00:07                5939
domnodelist.count.php                              29-May-2024 00:07                2419
domnodelist.getiterator.php                        29-May-2024 00:07                3195
domnodelist.item.php                               29-May-2024 00:07                7049
domparentnode.append.php                           29-May-2024 00:07                4791
domparentnode.prepend.php                          29-May-2024 00:07                4831
domparentnode.replacechildren.php                  29-May-2024 00:07                6632
domprocessinginstruction.construct.php             29-May-2024 00:07                6683
domtext.construct.php                              29-May-2024 00:07                4895
domtext.iselementcontentwhitespace.php             29-May-2024 00:07                2944
domtext.iswhitespaceinelementcontent.php           29-May-2024 00:07                2886
domtext.splittext.php                              29-May-2024 00:07                3211
domxpath.construct.php                             29-May-2024 00:07                3042
domxpath.evaluate.php                              29-May-2024 00:07                7564
domxpath.query.php                                 29-May-2024 00:07               12130
domxpath.registernamespace.php                     29-May-2024 00:07                3472
domxpath.registerphpfunctions.php                  29-May-2024 00:07               13868
dotnet.construct.php                               29-May-2024 00:07                3105
ds-collection.clear.php                            29-May-2024 00:07                3943
ds-collection.copy.php                             29-May-2024 00:07                4351
ds-collection.isempty.php                          29-May-2024 00:07                4279
ds-collection.toarray.php                          29-May-2024 00:07                4273
ds-deque.allocate.php                              29-May-2024 00:07                4697
ds-deque.apply.php                                 29-May-2024 00:07                4987
ds-deque.capacity.php                              29-May-2024 00:07                3978
ds-deque.clear.php                                 29-May-2024 00:07                3860
ds-deque.construct.php                             29-May-2024 00:07                4338
ds-deque.contains.php                              29-May-2024 00:07                7108
ds-deque.copy.php                                  29-May-2024 00:07                4217
ds-deque.count.php                                 29-May-2024 00:07                1624
ds-deque.filter.php                                29-May-2024 00:07                7635
ds-deque.find.php                                  29-May-2024 00:07                5450
ds-deque.first.php                                 29-May-2024 00:07                3789
ds-deque.get.php                                   29-May-2024 00:07                6612
ds-deque.insert.php                                29-May-2024 00:07                6691
ds-deque.isempty.php                               29-May-2024 00:07                4165
ds-deque.join.php                                  29-May-2024 00:07                5760
ds-deque.jsonserialize.php                         29-May-2024 00:07                1883
ds-deque.last.php                                  29-May-2024 00:07                3777
ds-deque.map.php                                   29-May-2024 00:07                5346
ds-deque.merge.php                                 29-May-2024 00:07                4896
ds-deque.pop.php                                   29-May-2024 00:07                4274
ds-deque.push.php                                  29-May-2024 00:07                4691
ds-deque.reduce.php                                29-May-2024 00:07                8006
ds-deque.remove.php                                29-May-2024 00:07                4891
ds-deque.reverse.php                               29-May-2024 00:07                3696
ds-deque.reversed.php                              29-May-2024 00:07                4047
ds-deque.rotate.php                                29-May-2024 00:07                5077
ds-deque.set.php                                   29-May-2024 00:07                6084
ds-deque.shift.php                                 29-May-2024 00:07                4375
ds-deque.slice.php                                 29-May-2024 00:07                7169
ds-deque.sort.php                                  29-May-2024 00:07                7500
ds-deque.sorted.php                                29-May-2024 00:07                7522
ds-deque.sum.php                                   29-May-2024 00:07                5294
ds-deque.toarray.php                               29-May-2024 00:07                4159
ds-deque.unshift.php                               29-May-2024 00:07                4775
ds-hashable.equals.php                             29-May-2024 00:07                3722
ds-hashable.hash.php                               29-May-2024 00:07                7488
ds-map.allocate.php                                29-May-2024 00:07                4563
ds-map.apply.php                                   29-May-2024 00:07                5683
ds-map.capacity.php                                29-May-2024 00:07                3268
ds-map.clear.php                                   29-May-2024 00:07                4336
ds-map.construct.php                               29-May-2024 00:07                4840
ds-map.copy.php                                    29-May-2024 00:07                4077
ds-map.count.php                                   29-May-2024 00:07                1585
ds-map.diff.php                                    29-May-2024 00:07                5476
ds-map.filter.php                                  29-May-2024 00:07                8419
ds-map.first.php                                   29-May-2024 00:07                4088
ds-map.get.php                                     29-May-2024 00:07                8442
ds-map.haskey.php                                  29-May-2024 00:07                4704
ds-map.hasvalue.php                                29-May-2024 00:07                4748
ds-map.intersect.php                               29-May-2024 00:07                6002
ds-map.isempty.php                                 29-May-2024 00:07                4387
ds-map.jsonserialize.php                           29-May-2024 00:07                1861
ds-map.keys.php                                    29-May-2024 00:07                3978
ds-map.ksort.php                                   29-May-2024 00:07                8187
ds-map.ksorted.php                                 29-May-2024 00:07                8271
ds-map.last.php                                    29-May-2024 00:07                4073
ds-map.map.php                                     29-May-2024 00:07                6327
ds-map.merge.php                                   29-May-2024 00:07                5881
ds-map.pairs.php                                   29-May-2024 00:07                4393
ds-map.put.php                                     29-May-2024 00:07               13965
ds-map.putall.php                                  29-May-2024 00:07                5561
ds-map.reduce.php                                  29-May-2024 00:07                8941
ds-map.remove.php                                  29-May-2024 00:07                6996
ds-map.reverse.php                                 29-May-2024 00:07                4148
ds-map.reversed.php                                29-May-2024 00:07                4257
ds-map.skip.php                                    29-May-2024 00:07                4641
ds-map.slice.php                                   29-May-2024 00:07                8021
ds-map.sort.php                                    29-May-2024 00:07                8110
ds-map.sorted.php                                  29-May-2024 00:07                8250
ds-map.sum.php                                     29-May-2024 00:07                5761
ds-map.toarray.php                                 29-May-2024 00:07                5154
ds-map.union.php                                   29-May-2024 00:07                5986
ds-map.values.php                                  29-May-2024 00:07                3977
ds-map.xor.php                                     29-May-2024 00:07                5542
ds-pair.clear.php                                  29-May-2024 00:07                3765
ds-pair.construct.php                              29-May-2024 00:07                2617
ds-pair.copy.php                                   29-May-2024 00:07                4131
ds-pair.isempty.php                                29-May-2024 00:07                4115
ds-pair.jsonserialize.php                          29-May-2024 00:07                1881
ds-pair.toarray.php                                29-May-2024 00:07                4093
ds-priorityqueue.allocate.php                      29-May-2024 00:07                4863
ds-priorityqueue.capacity.php                      29-May-2024 00:07                3477
ds-priorityqueue.clear.php                         29-May-2024 00:07                4517
ds-priorityqueue.construct.php                     29-May-2024 00:07                2931
ds-priorityqueue.copy.php                          29-May-2024 00:07                4520
ds-priorityqueue.count.php                         29-May-2024 00:07                1733
ds-priorityqueue.isempty.php                       29-May-2024 00:07                5075
ds-priorityqueue.jsonserialize.php                 29-May-2024 00:07                2001
ds-priorityqueue.peek.php                          29-May-2024 00:07                4767
ds-priorityqueue.pop.php                           29-May-2024 00:07                5542
ds-priorityqueue.push.php                          29-May-2024 00:07                5617
ds-priorityqueue.toarray.php                       29-May-2024 00:07                5263
ds-queue.allocate.php                              29-May-2024 00:07                4895
ds-queue.capacity.php                              29-May-2024 00:07                3984
ds-queue.clear.php                                 29-May-2024 00:07                3845
ds-queue.construct.php                             29-May-2024 00:07                4336
ds-queue.copy.php                                  29-May-2024 00:07                4319
ds-queue.count.php                                 29-May-2024 00:07                1621
ds-queue.isempty.php                               29-May-2024 00:07                4181
ds-queue.jsonserialize.php                         29-May-2024 00:07                1889
ds-queue.peek.php                                  29-May-2024 00:07                4371
ds-queue.pop.php                                   29-May-2024 00:07                4905
ds-queue.push.php                                  29-May-2024 00:07                4726
ds-queue.toarray.php                               29-May-2024 00:07                4328
ds-sequence.allocate.php                           29-May-2024 00:07                4596
ds-sequence.apply.php                              29-May-2024 00:07                5102
ds-sequence.capacity.php                           29-May-2024 00:07                4533
ds-sequence.contains.php                           29-May-2024 00:07                7235
ds-sequence.filter.php                             29-May-2024 00:07                7774
ds-sequence.find.php                               29-May-2024 00:07                5562
ds-sequence.first.php                              29-May-2024 00:07                3904
ds-sequence.get.php                                29-May-2024 00:07                6740
ds-sequence.insert.php                             29-May-2024 00:07                6810
ds-sequence.join.php                               29-May-2024 00:07                5856
ds-sequence.last.php                               29-May-2024 00:07                3871
ds-sequence.map.php                                29-May-2024 00:07                5475
ds-sequence.merge.php                              29-May-2024 00:07                5022
ds-sequence.pop.php                                29-May-2024 00:07                4386
ds-sequence.push.php                               29-May-2024 00:07                4813
ds-sequence.reduce.php                             29-May-2024 00:07                8125
ds-sequence.remove.php                             29-May-2024 00:07                5003
ds-sequence.reverse.php                            29-May-2024 00:07                3809
ds-sequence.reversed.php                           29-May-2024 00:07                4170
ds-sequence.rotate.php                             29-May-2024 00:07                5214
ds-sequence.set.php                                29-May-2024 00:07                6208
ds-sequence.shift.php                              29-May-2024 00:07                4487
ds-sequence.slice.php                              29-May-2024 00:07                7334
ds-sequence.sort.php                               29-May-2024 00:07                7627
ds-sequence.sorted.php                             29-May-2024 00:07                7649
ds-sequence.sum.php                                29-May-2024 00:07                5419
ds-sequence.unshift.php                            29-May-2024 00:07                4886
ds-set.add.php                                     29-May-2024 00:07               12193
ds-set.allocate.php                                29-May-2024 00:07                4572
ds-set.capacity.php                                29-May-2024 00:07                3936
ds-set.clear.php                                   29-May-2024 00:07                3791
ds-set.construct.php                               29-May-2024 00:07                4290
ds-set.contains.php                                29-May-2024 00:07                7305
ds-set.copy.php                                    29-May-2024 00:07                4258
ds-set.count.php                                   29-May-2024 00:07                1585
ds-set.diff.php                                    29-May-2024 00:07                4766
ds-set.filter.php                                  29-May-2024 00:07                7583
ds-set.first.php                                   29-May-2024 00:07                3742
ds-set.get.php                                     29-May-2024 00:07                6556
ds-set.intersect.php                               29-May-2024 00:07                4997
ds-set.isempty.php                                 29-May-2024 00:07                4123
ds-set.join.php                                    29-May-2024 00:07                5706
ds-set.jsonserialize.php                           29-May-2024 00:07                1855
ds-set.last.php                                    29-May-2024 00:07                3743
ds-set.merge.php                                   29-May-2024 00:07                4822
ds-set.reduce.php                                  29-May-2024 00:07                7952
ds-set.remove.php                                  29-May-2024 00:07                4997
ds-set.reverse.php                                 29-May-2024 00:07                3644
ds-set.reversed.php                                29-May-2024 00:07                3985
ds-set.slice.php                                   29-May-2024 00:07                7083
ds-set.sort.php                                    29-May-2024 00:07                7436
ds-set.sorted.php                                  29-May-2024 00:07                7458
ds-set.sum.php                                     29-May-2024 00:07                5234
ds-set.toarray.php                                 29-May-2024 00:07                4105
ds-set.union.php                                   29-May-2024 00:07                4960
ds-set.xor.php                                     29-May-2024 00:07                4936
ds-stack.allocate.php                              29-May-2024 00:07                2878
ds-stack.capacity.php                              29-May-2024 00:07                2217
ds-stack.clear.php                                 29-May-2024 00:07                3841
ds-stack.construct.php                             29-May-2024 00:07                4302
ds-stack.copy.php                                  29-May-2024 00:07                4319
ds-stack.count.php                                 29-May-2024 00:07                1621
ds-stack.isempty.php                               29-May-2024 00:07                4181
ds-stack.jsonserialize.php                         29-May-2024 00:07                1889
ds-stack.peek.php                                  29-May-2024 00:07                4365
ds-stack.pop.php                                   29-May-2024 00:07                4899
ds-stack.push.php                                  29-May-2024 00:07                4726
ds-stack.toarray.php                               29-May-2024 00:07                4150
ds-vector.allocate.php                             29-May-2024 00:07                4513
ds-vector.apply.php                                29-May-2024 00:07                5013
ds-vector.capacity.php                             29-May-2024 00:07                4438
ds-vector.clear.php                                29-May-2024 00:07                3872
ds-vector.construct.php                            29-May-2024 00:07                4370
ds-vector.contains.php                             29-May-2024 00:07                7138
ds-vector.copy.php                                 29-May-2024 00:07                4343
ds-vector.count.php                                29-May-2024 00:07                1638
ds-vector.filter.php                               29-May-2024 00:07                7669
ds-vector.find.php                                 29-May-2024 00:07                5475
ds-vector.first.php                                29-May-2024 00:07                3815
ds-vector.get.php                                  29-May-2024 00:07                6643
ds-vector.insert.php                               29-May-2024 00:07                6721
ds-vector.isempty.php                              29-May-2024 00:07                4189
ds-vector.join.php                                 29-May-2024 00:07                5787
ds-vector.jsonserialize.php                        29-May-2024 00:07                1897
ds-vector.last.php                                 29-May-2024 00:07                3802
ds-vector.map.php                                  29-May-2024 00:07                5378
ds-vector.merge.php                                29-May-2024 00:07                4927
ds-vector.pop.php                                  29-May-2024 00:07                4299
ds-vector.push.php                                 29-May-2024 00:07                4720
ds-vector.reduce.php                               29-May-2024 00:07                8034
ds-vector.remove.php                               29-May-2024 00:07                4916
ds-vector.reverse.php                              29-May-2024 00:07                3722
ds-vector.reversed.php                             29-May-2024 00:07                4077
ds-vector.rotate.php                               29-May-2024 00:07                5111
ds-vector.set.php                                  29-May-2024 00:07                6115
ds-vector.shift.php                                29-May-2024 00:07                4400
ds-vector.slice.php                                29-May-2024 00:07                7215
ds-vector.sort.php                                 29-May-2024 00:07                7532
ds-vector.sorted.php                               29-May-2024 00:07                7554
ds-vector.sum.php                                  29-May-2024 00:07                5324
ds-vector.toarray.php                              29-May-2024 00:07                4184
ds-vector.unshift.php                              29-May-2024 00:07                4805
ds.constants.php                                   29-May-2024 00:07                1181
ds.examples.php                                    29-May-2024 00:07                4739
ds.installation.php                                29-May-2024 00:07                2522
ds.requirements.php                                29-May-2024 00:07                1211
ds.setup.php                                       29-May-2024 00:07                1430
eio.configuration.php                              29-May-2024 00:07                1294
eio.constants.php                                  29-May-2024 00:07               21890
eio.examples.php                                   29-May-2024 00:07               27087
eio.installation.php                               29-May-2024 00:07                1721
eio.requirements.php                               29-May-2024 00:07                1331
eio.resources.php                                  29-May-2024 00:07                1281
eio.setup.php                                      29-May-2024 00:07                1612
emptyiterator.current.php                          29-May-2024 00:07                2770
emptyiterator.key.php                              29-May-2024 00:07                2734
emptyiterator.next.php                             29-May-2024 00:07                2430
emptyiterator.rewind.php                           29-May-2024 00:07                2452
emptyiterator.valid.php                            29-May-2024 00:07                2775
enchant.configuration.php                          29-May-2024 00:07                1324
enchant.constants.php                              29-May-2024 00:07                2971
enchant.examples.php                               29-May-2024 00:07                5449
enchant.installation.php                           29-May-2024 00:07                3272
enchant.requirements.php                           29-May-2024 00:07                1814
enchant.resources.php                              29-May-2024 00:07                1388
enchant.setup.php                                  29-May-2024 00:07                1657
error.clone.php                                    29-May-2024 00:07                2869
error.construct.php                                29-May-2024 00:07                3454
error.getcode.php                                  29-May-2024 00:07                4100
error.getfile.php                                  29-May-2024 00:07                3839
error.getline.php                                  29-May-2024 00:07                4067
error.getmessage.php                               29-May-2024 00:07                3914
error.getprevious.php                              29-May-2024 00:07                6683
error.gettrace.php                                 29-May-2024 00:07                4434
error.gettraceasstring.php                         29-May-2024 00:07                4190
error.tostring.php                                 29-May-2024 00:07                3880
errorexception.construct.php                       29-May-2024 00:07                6315
errorexception.getseverity.php                     29-May-2024 00:07                4424
errorfunc.configuration.php                        29-May-2024 00:07               26585
errorfunc.constants.php                            29-May-2024 00:07               11782
errorfunc.examples.php                             29-May-2024 00:07               19385
errorfunc.installation.php                         29-May-2024 00:07                1301
errorfunc.requirements.php                         29-May-2024 00:07                1245
errorfunc.resources.php                            29-May-2024 00:07                1289
errorfunc.setup.php                                29-May-2024 00:07                1667
ev.backend.php                                     29-May-2024 00:07                3431
ev.configuration.php                               29-May-2024 00:07                1289
ev.depth.php                                       29-May-2024 00:07                3301
ev.embeddablebackends.php                          29-May-2024 00:07                6499
ev.examples.php                                    29-May-2024 00:07               41804
ev.feedsignal.php                                  29-May-2024 00:07                3415
ev.feedsignalevent.php                             29-May-2024 00:07                3202
ev.global.constants.php                            29-May-2024 00:07                1352
ev.installation.php                                29-May-2024 00:07                1700
ev.iteration.php                                   29-May-2024 00:07                2677
ev.now.php                                         29-May-2024 00:07                3148
ev.nowupdate.php                                   29-May-2024 00:07                3227
ev.periodic-modes.php                              29-May-2024 00:07                7684
ev.recommendedbackends.php                         29-May-2024 00:07                7191
ev.requirements.php                                29-May-2024 00:07                1266
ev.resources.php                                   29-May-2024 00:07                1247
ev.resume.php                                      29-May-2024 00:07                3749
ev.run.php                                         29-May-2024 00:07                5113
ev.setup.php                                       29-May-2024 00:07                1567
ev.sleep.php                                       29-May-2024 00:07                2469
ev.stop.php                                        29-May-2024 00:07                2914
ev.supportedbackends.php                           29-May-2024 00:07                6481
ev.suspend.php                                     29-May-2024 00:07                3516
ev.time.php                                        29-May-2024 00:07                2722
ev.verify.php                                      29-May-2024 00:07                2302
ev.watcher-callbacks.php                           29-May-2024 00:07                4559
ev.watchers.php                                    29-May-2024 00:07                3432
evcheck.construct.php                              29-May-2024 00:07                3691
evcheck.createstopped.php                          29-May-2024 00:07                3800
evchild.construct.php                              29-May-2024 00:07                6768
evchild.createstopped.php                          29-May-2024 00:07                5171
evchild.set.php                                    29-May-2024 00:07                3251
evembed.construct.php                              29-May-2024 00:07                7983
evembed.createstopped.php                          29-May-2024 00:07                4813
evembed.set.php                                    29-May-2024 00:07                2593
evembed.sweep.php                                  29-May-2024 00:07                3112
event.add.php                                      29-May-2024 00:07               10339
event.addsignal.php                                29-May-2024 00:07                1705
event.addtimer.php                                 29-May-2024 00:07                1714
event.callbacks.php                                29-May-2024 00:07                5714
event.configuration.php                            29-May-2024 00:07                1310
event.construct.php                                29-May-2024 00:07                4619
event.constructing.signal.events.php               29-May-2024 00:07                6073
event.del.php                                      29-May-2024 00:07                2690
event.delsignal.php                                29-May-2024 00:07                1705
event.deltimer.php                                 29-May-2024 00:07                1702
event.examples.php                                 29-May-2024 00:07              165067
event.flags.php                                    29-May-2024 00:07                2645
event.free.php                                     29-May-2024 00:07                3070
event.getsupportedmethods.php                      29-May-2024 00:07                2719
event.installation.php                             29-May-2024 00:07                1727
event.pending.php                                  29-May-2024 00:07                3157
event.persistence.php                              29-May-2024 00:07                2968
event.requirements.php                             29-May-2024 00:07                1484
event.resources.php                                29-May-2024 00:07                1248
event.set.php                                      29-May-2024 00:07                4741
event.setpriority.php                              29-May-2024 00:07                2657
event.settimer.php                                 29-May-2024 00:07                4175
event.setup.php                                    29-May-2024 00:07                1606
event.signal.php                                   29-May-2024 00:07                4353
event.timer.php                                    29-May-2024 00:07                3638
eventbase.construct.php                            29-May-2024 00:07                3095
eventbase.dispatch.php                             29-May-2024 00:07                3383
eventbase.exit.php                                 29-May-2024 00:07                3161
eventbase.free.php                                 29-May-2024 00:07                3425
eventbase.getfeatures.php                          29-May-2024 00:07                5821
eventbase.getmethod.php                            29-May-2024 00:07                4611
eventbase.gettimeofdaycached.php                   29-May-2024 00:07                2785
eventbase.gotexit.php                              29-May-2024 00:07                3410
eventbase.gotstop.php                              29-May-2024 00:07                3382
eventbase.loop.php                                 29-May-2024 00:07                3703
eventbase.priorityinit.php                         29-May-2024 00:07                3138
eventbase.reinit.php                               29-May-2024 00:07                2469
eventbase.stop.php                                 29-May-2024 00:07                2943
eventbuffer.add.php                                29-May-2024 00:07                3139
eventbuffer.addbuffer.php                          29-May-2024 00:07                3491
eventbuffer.appendfrom.php                         29-May-2024 00:07                4983
eventbuffer.construct.php                          29-May-2024 00:07                2021
eventbuffer.copyout.php                            29-May-2024 00:07                4027
eventbuffer.drain.php                              29-May-2024 00:07                3614
eventbuffer.enablelocking.php                      29-May-2024 00:07                2953
eventbuffer.expand.php                             29-May-2024 00:07                2930
eventbuffer.freeze.php                             29-May-2024 00:07                3187
eventbuffer.lock.php                               29-May-2024 00:07                3078
eventbuffer.prepend.php                            29-May-2024 00:07                3614
eventbuffer.prependbuffer.php                      29-May-2024 00:07                3776
eventbuffer.pullup.php                             29-May-2024 00:07                4734
eventbuffer.read.php                               29-May-2024 00:07                5008
eventbuffer.readfrom.php                           29-May-2024 00:07                4440
eventbuffer.readline.php                           29-May-2024 00:07                4361
eventbuffer.search.php                             29-May-2024 00:07                8510
eventbuffer.searcheol.php                          29-May-2024 00:07                5050
eventbuffer.substr.php                             29-May-2024 00:07                3647
eventbuffer.unfreeze.php                           29-May-2024 00:07                3201
eventbuffer.unlock.php                             29-May-2024 00:07                2918
eventbuffer.write.php                              29-May-2024 00:07                3553
eventbufferevent.about.callbacks.php               29-May-2024 00:07                6179
eventbufferevent.close.php                         29-May-2024 00:07                2637
eventbufferevent.connect.php                       29-May-2024 00:07               23987
eventbufferevent.connecthost.php                   29-May-2024 00:07               17888
eventbufferevent.construct.php                     29-May-2024 00:07                6941
eventbufferevent.createpair.php                    29-May-2024 00:07                4394
eventbufferevent.disable.php                       29-May-2024 00:07                3642
eventbufferevent.enable.php                        29-May-2024 00:07                4112
eventbufferevent.free.php                          29-May-2024 00:07                2858
eventbufferevent.getdnserrorstring.php             29-May-2024 00:07                3189
eventbufferevent.getenabled.php                    29-May-2024 00:07                3138
eventbufferevent.getinput.php                      29-May-2024 00:07                5079
eventbufferevent.getoutput.php                     29-May-2024 00:07                7960
eventbufferevent.read.php                          29-May-2024 00:07                3149
eventbufferevent.readbuffer.php                    29-May-2024 00:07                3328
eventbufferevent.setcallbacks.php                  29-May-2024 00:07                4638
eventbufferevent.setpriority.php                   29-May-2024 00:07                3039
eventbufferevent.settimeouts.php                   29-May-2024 00:07                3264
eventbufferevent.setwatermark.php                  29-May-2024 00:07                4165
eventbufferevent.sslerror.php                      29-May-2024 00:07                5966
eventbufferevent.sslfilter.php                     29-May-2024 00:07               34571
eventbufferevent.sslgetcipherinfo.php              29-May-2024 00:07                3000
eventbufferevent.sslgetciphername.php              29-May-2024 00:07                2903
eventbufferevent.sslgetcipherversion.php           29-May-2024 00:07                2932
eventbufferevent.sslgetprotocol.php                29-May-2024 00:07                2809
eventbufferevent.sslrenegotiate.php                29-May-2024 00:07                2893
eventbufferevent.sslsocket.php                     29-May-2024 00:07                5972
eventbufferevent.write.php                         29-May-2024 00:07                3324
eventbufferevent.writebuffer.php                   29-May-2024 00:07                3446
eventconfig.avoidmethod.php                        29-May-2024 00:07                4485
eventconfig.construct.php                          29-May-2024 00:07                4119
eventconfig.requirefeatures.php                    29-May-2024 00:07                6086
eventconfig.setflags.php                           29-May-2024 00:07                3441
eventconfig.setmaxdispatchinterval.php             29-May-2024 00:07                4637
eventdnsbase.addnameserverip.php                   29-May-2024 00:07                3066
eventdnsbase.addsearch.php                         29-May-2024 00:07                2623
eventdnsbase.clearsearch.php                       29-May-2024 00:07                2884
eventdnsbase.construct.php                         29-May-2024 00:07                7590
eventdnsbase.countnameservers.php                  29-May-2024 00:07                2611
eventdnsbase.loadhosts.php                         29-May-2024 00:07                2939
eventdnsbase.parseresolvconf.php                   29-May-2024 00:07                4315
eventdnsbase.setoption.php                         29-May-2024 00:07                3513
eventdnsbase.setsearchndots.php                    29-May-2024 00:07                3002
eventhttp.accept.php                               29-May-2024 00:07               12491
eventhttp.addserveralias.php                       29-May-2024 00:07                6527
eventhttp.bind.php                                 29-May-2024 00:07                7949
eventhttp.construct.php                            29-May-2024 00:07               17463
eventhttp.removeserveralias.php                    29-May-2024 00:07                3334
eventhttp.setallowedmethods.php                    29-May-2024 00:07                3462
eventhttp.setcallback.php                          29-May-2024 00:07               18148
eventhttp.setdefaultcallback.php                   29-May-2024 00:07                7945
eventhttp.setmaxbodysize.php                       29-May-2024 00:07                2982
eventhttp.setmaxheaderssize.php                    29-May-2024 00:07                2894
eventhttp.settimeout.php                           29-May-2024 00:07                2576
eventhttpconnection.construct.php                  29-May-2024 00:07                5184
eventhttpconnection.getbase.php                    29-May-2024 00:07                2686
eventhttpconnection.getpeer.php                    29-May-2024 00:07                3092
eventhttpconnection.makerequest.php                29-May-2024 00:07               11756
eventhttpconnection.setclosecallback.php           29-May-2024 00:07                9496
eventhttpconnection.setlocaladdress.php            29-May-2024 00:07                3281
eventhttpconnection.setlocalport.php               29-May-2024 00:07                3170
eventhttpconnection.setmaxbodysize.php             29-May-2024 00:07                3206
eventhttpconnection.setmaxheaderssize.php          29-May-2024 00:07                3227
eventhttpconnection.setretries.php                 29-May-2024 00:07                2806
eventhttpconnection.settimeout.php                 29-May-2024 00:07                2703
eventhttprequest.addheader.php                     29-May-2024 00:07                4056
eventhttprequest.cancel.php                        29-May-2024 00:07                2912
eventhttprequest.clearheaders.php                  29-May-2024 00:07                2869
eventhttprequest.closeconnection.php               29-May-2024 00:07                2467
eventhttprequest.construct.php                     29-May-2024 00:07               11474
eventhttprequest.findheader.php                    29-May-2024 00:07                3612
eventhttprequest.free.php                          29-May-2024 00:07                2375
eventhttprequest.getbufferevent.php                29-May-2024 00:07                3750
eventhttprequest.getcommand.php                    29-May-2024 00:07                2750
eventhttprequest.getconnection.php                 29-May-2024 00:07                4504
eventhttprequest.gethost.php                       29-May-2024 00:07                2932
eventhttprequest.getinputbuffer.php                29-May-2024 00:07                2834
eventhttprequest.getinputheaders.php               29-May-2024 00:07                2925
eventhttprequest.getoutputbuffer.php               29-May-2024 00:07                2893
eventhttprequest.getoutputheaders.php              29-May-2024 00:07                2876
eventhttprequest.getresponsecode.php               29-May-2024 00:07                3212
eventhttprequest.geturi.php                        29-May-2024 00:07                3125
eventhttprequest.removeheader.php                  29-May-2024 00:07                3572
eventhttprequest.senderror.php                     29-May-2024 00:07                5908
eventhttprequest.sendreply.php                     29-May-2024 00:07                4117
eventhttprequest.sendreplychunk.php                29-May-2024 00:07                3489
eventhttprequest.sendreplyend.php                  29-May-2024 00:07                3102
eventhttprequest.sendreplystart.php                29-May-2024 00:07                4376
eventlistener.construct.php                        29-May-2024 00:07               22470
eventlistener.disable.php                          29-May-2024 00:07                2894
eventlistener.enable.php                           29-May-2024 00:07                2880
eventlistener.getbase.php                          29-May-2024 00:07                2389
eventlistener.getsocketname.php                    29-May-2024 00:07                3434
eventlistener.setcallback.php                      29-May-2024 00:07                6084
eventlistener.seterrorcallback.php                 29-May-2024 00:07                4461
eventsslcontext.construct.php                      29-May-2024 00:07                5346
eventutil.construct.php                            29-May-2024 00:07                2215
eventutil.getlastsocketerrno.php                   29-May-2024 00:07                3361
eventutil.getlastsocketerror.php                   29-May-2024 00:07                3177
eventutil.getsocketfd.php                          29-May-2024 00:07                3274
eventutil.getsocketname.php                        29-May-2024 00:07                3837
eventutil.setsocketoption.php                      29-May-2024 00:07                5816
eventutil.sslrandpoll.php                          29-May-2024 00:07                2440
evfork.construct.php                               29-May-2024 00:07                3717
evfork.createstopped.php                           29-May-2024 00:07                4002
evidle.construct.php                               29-May-2024 00:07                3721
evidle.createstopped.php                           29-May-2024 00:07                4200
evio.construct.php                                 29-May-2024 00:07                4869
evio.createstopped.php                             29-May-2024 00:07                5206
evio.set.php                                       29-May-2024 00:07                2888
evloop.backend.php                                 29-May-2024 00:07                2778
evloop.check.php                                   29-May-2024 00:07                3357
evloop.child.php                                   29-May-2024 00:07                3839
evloop.construct.php                               29-May-2024 00:07                4088
evloop.defaultloop.php                             29-May-2024 00:07                4686
evloop.embed.php                                   29-May-2024 00:07                3882
evloop.fork.php                                    29-May-2024 00:07                3439
evloop.idle.php                                    29-May-2024 00:07                3459
evloop.invokepending.php                           29-May-2024 00:07                2282
evloop.io.php                                      29-May-2024 00:07                3895
evloop.loopfork.php                                29-May-2024 00:07                2620
evloop.now.php                                     29-May-2024 00:07                2892
evloop.nowupdate.php                               29-May-2024 00:07                3206
evloop.periodic.php                                29-May-2024 00:07                4033
evloop.prepare.php                                 29-May-2024 00:07                3457
evloop.resume.php                                  29-May-2024 00:07                2866
evloop.run.php                                     29-May-2024 00:07                5096
evloop.signal.php                                  29-May-2024 00:07                3762
evloop.stat.php                                    29-May-2024 00:07                3943
evloop.stop.php                                    29-May-2024 00:07                3026
evloop.suspend.php                                 29-May-2024 00:07                2858
evloop.timer.php                                   29-May-2024 00:07                3960
evloop.verify.php                                  29-May-2024 00:07                2631
evperiodic.again.php                               29-May-2024 00:07                2621
evperiodic.at.php                                  29-May-2024 00:07                2690
evperiodic.construct.php                           29-May-2024 00:07               10069
evperiodic.createstopped.php                       29-May-2024 00:07                5908
evperiodic.set.php                                 29-May-2024 00:07                3245
evprepare.construct.php                            29-May-2024 00:07                3624
evprepare.createstopped.php                        29-May-2024 00:07                4363
evsignal.construct.php                             29-May-2024 00:07                5545
evsignal.createstopped.php                         29-May-2024 00:07                4888
evsignal.set.php                                   29-May-2024 00:07                2545
evstat.attr.php                                    29-May-2024 00:07                8277
evstat.construct.php                               29-May-2024 00:07                7259
evstat.createstopped.php                           29-May-2024 00:07                5264
evstat.prev.php                                    29-May-2024 00:07                2990
evstat.set.php                                     29-May-2024 00:07                2904
evstat.stat.php                                    29-May-2024 00:07                3047
evtimer.again.php                                  29-May-2024 00:07                3116
evtimer.construct.php                              29-May-2024 00:07               12711
evtimer.createstopped.php                          29-May-2024 00:07                8403
evtimer.set.php                                    29-May-2024 00:07                3061
evwatcher.clear.php                                29-May-2024 00:07                2877
evwatcher.construct.php                            29-May-2024 00:07                2156
evwatcher.feed.php                                 29-May-2024 00:07                2658
evwatcher.getloop.php                              29-May-2024 00:07                2363
evwatcher.invoke.php                               29-May-2024 00:07                2665
evwatcher.keepalive.php                            29-May-2024 00:07                5379
evwatcher.setcallback.php                          29-May-2024 00:07                2620
evwatcher.start.php                                29-May-2024 00:07                2563
evwatcher.stop.php                                 29-May-2024 00:07                2532
example.xml-external-entity.php                    29-May-2024 00:07               21424
example.xml-map-tags.php                           29-May-2024 00:07                8280
example.xml-structure.php                          29-May-2024 00:07                6284
example.xmlwriter-namespace.php                    29-May-2024 00:07                5500
example.xmlwriter-oop.php                          29-May-2024 00:07                3526
example.xmlwriter-simple.php                       29-May-2024 00:07                8736
exception.clone.php                                29-May-2024 00:07                3121
exception.construct.php                            29-May-2024 00:07                3835
exception.getcode.php                              29-May-2024 00:07                4800
exception.getfile.php                              29-May-2024 00:07                3937
exception.getline.php                              29-May-2024 00:07                4193
exception.getmessage.php                           29-May-2024 00:07                3997
exception.getprevious.php                          29-May-2024 00:07                6890
exception.gettrace.php                             29-May-2024 00:07                4423
exception.gettraceasstring.php                     29-May-2024 00:07                4310
exception.tostring.php                             29-May-2024 00:07                4228
exec.configuration.php                             29-May-2024 00:07                1303
exec.constants.php                                 29-May-2024 00:07                1222
exec.installation.php                              29-May-2024 00:07                1266
exec.requirements.php                              29-May-2024 00:07                1210
exec.resources.php                                 29-May-2024 00:07                1411
exec.setup.php                                     29-May-2024 00:07                1613
exif.configuration.php                             29-May-2024 00:07                7679
exif.constants.php                                 29-May-2024 00:07                2075
exif.installation.php                              29-May-2024 00:07                1779
exif.requirements.php                              29-May-2024 00:07                1834
exif.resources.php                                 29-May-2024 00:07                1254
exif.setup.php                                     29-May-2024 00:07                1625
expect.configuration.php                           29-May-2024 00:07                5511
expect.constants.php                               29-May-2024 00:07                3933
expect.examples-usage.php                          29-May-2024 00:07               12225
expect.examples.php                                29-May-2024 00:07                1434
expect.installation.php                            29-May-2024 00:07                2348
expect.requirements.php                            29-May-2024 00:07                1337
expect.resources.php                               29-May-2024 00:07                1465
expect.setup.php                                   29-May-2024 00:07                1650
extensions.alphabetical.php                        29-May-2024 00:07               20742
extensions.membership.php                          29-May-2024 00:07               20568
extensions.php                                     29-May-2024 00:07                1691
extensions.state.php                               29-May-2024 00:07                2829
fann.configuration.php                             29-May-2024 00:07                1303
fann.constants.php                                 29-May-2024 00:07               23657
fann.examples-1.php                                29-May-2024 00:07                8533
fann.examples.php                                  29-May-2024 00:07                1388
fann.installation.php                              29-May-2024 00:07                4925
fann.requirements.php                              29-May-2024 00:07                1192
fann.resources.php                                 29-May-2024 00:07                1202
fann.setup.php                                     29-May-2024 00:07                1597
fannconnection.construct.php                       29-May-2024 00:07                3045
fannconnection.getfromneuron.php                   29-May-2024 00:07                2416
fannconnection.gettoneuron.php                     29-May-2024 00:07                2404
fannconnection.getweight.php                       29-May-2024 00:07                2339
fannconnection.setweight.php                       29-May-2024 00:07                2972
faq.build.php                                      29-May-2024 00:07               24535
faq.com.php                                        29-May-2024 00:07               12803
faq.databases.php                                  29-May-2024 00:07                8298
faq.general.php                                    29-May-2024 00:07                4928
faq.html.php                                       29-May-2024 00:07               20152
faq.installation.php                               29-May-2024 00:07               25836
faq.mailinglist.php                                29-May-2024 00:07               10759
faq.misc.php                                       29-May-2024 00:07                4449
faq.obtaining.php                                  29-May-2024 00:07               10987
faq.passwords.php                                  29-May-2024 00:07               10281
faq.php                                            29-May-2024 00:07                2039
faq.using.php                                      29-May-2024 00:07               23541
fdf.configuration.php                              29-May-2024 00:07                1296
fdf.constants.php                                  29-May-2024 00:07                9270
fdf.examples.php                                   29-May-2024 00:07                6041
fdf.installation.php                               29-May-2024 00:07                3456
fdf.requirements.php                               29-May-2024 00:07                1529
fdf.resources.php                                  29-May-2024 00:07                1762
fdf.setup.php                                      29-May-2024 00:07                1605
features.commandline.differences.php               29-May-2024 00:07               12252
features.commandline.ini.php                       29-May-2024 00:07                2399
features.commandline.interactive.php               29-May-2024 00:07                8921
features.commandline.introduction.php              29-May-2024 00:07                7253
features.commandline.io-streams.php                29-May-2024 00:07                5994
features.commandline.options.php                   29-May-2024 00:07               26272
features.commandline.php                           29-May-2024 00:07                2130
features.commandline.usage.php                     29-May-2024 00:07               14543
features.commandline.webserver.php                 29-May-2024 00:07               12424
features.connection-handling.php                   29-May-2024 00:07                5798
features.cookies.php                               29-May-2024 00:07                3110
features.dtrace.dtrace.php                         29-May-2024 00:07               13972
features.dtrace.introduction.php                   29-May-2024 00:07                3140
features.dtrace.php                                29-May-2024 00:07                1679
features.dtrace.systemtap.php                      29-May-2024 00:07                8072
features.file-upload.common-pitfalls.php           29-May-2024 00:07                4979
features.file-upload.errors.php                    29-May-2024 00:07                3792
features.file-upload.errors.seealso.php            29-May-2024 00:07                1396
features.file-upload.multiple.php                  29-May-2024 00:07                6720
features.file-upload.php                           29-May-2024 00:07                2012
features.file-upload.post-method.php               29-May-2024 00:07               16623
features.file-upload.put-method.php                29-May-2024 00:07                5668
features.gc.collecting-cycles.php                  29-May-2024 00:07                7969
features.gc.performance-considerations.php         29-May-2024 00:07               13839
features.gc.php                                    29-May-2024 00:07                1775
features.gc.refcounting-basics.php                 29-May-2024 00:07               21455
features.http-auth.php                             29-May-2024 00:07               23488
features.persistent-connections.php                29-May-2024 00:07                8542
features.php                                       29-May-2024 00:07                4272
features.remote-files.php                          29-May-2024 00:07                8201
features.session.security.management.php           29-May-2024 00:07               26876
features.sessions.php                              29-May-2024 00:07                1479
features.xforms.php                                29-May-2024 00:07                5387
ffi-ctype.getalignment.php                         29-May-2024 00:07                2393
ffi-ctype.getarrayelementtype.php                  29-May-2024 00:07                2479
ffi-ctype.getarraylength.php                       29-May-2024 00:07                2436
ffi-ctype.getattributes.php                        29-May-2024 00:07                2412
ffi-ctype.getenumkind.php                          29-May-2024 00:07                2388
ffi-ctype.getfuncabi.php                           29-May-2024 00:07                2396
ffi-ctype.getfuncparametercount.php                29-May-2024 00:07                2502
ffi-ctype.getfuncparametertype.php                 29-May-2024 00:07                2736
ffi-ctype.getfuncreturntype.php                    29-May-2024 00:07                2461
ffi-ctype.getkind.php                              29-May-2024 00:07                2350
ffi-ctype.getname.php                              29-May-2024 00:07                2356
ffi-ctype.getpointertype.php                       29-May-2024 00:07                2405
ffi-ctype.getsize.php                              29-May-2024 00:07                2368
ffi-ctype.getstructfieldnames.php                  29-May-2024 00:07                2478
ffi-ctype.getstructfieldoffset.php                 29-May-2024 00:07                2732
ffi-ctype.getstructfieldtype.php                   29-May-2024 00:07                2694
ffi.addr.php                                       29-May-2024 00:07                2820
ffi.alignof.php                                    29-May-2024 00:07                2950
ffi.arraytype.php                                  29-May-2024 00:07                4650
ffi.cast.php                                       29-May-2024 00:07                4864
ffi.cdef.php                                       29-May-2024 00:07                4492
ffi.configuration.php                              29-May-2024 00:07                4409
ffi.constants.php                                  29-May-2024 00:07                1192
ffi.examples-basic.php                             29-May-2024 00:07               15829
ffi.examples-callback.php                          29-May-2024 00:07                4953
ffi.examples-complete.php                          29-May-2024 00:07                5358
ffi.examples.php                                   29-May-2024 00:07                1545
ffi.free.php                                       29-May-2024 00:07                2459
ffi.installation.php                               29-May-2024 00:07                1449
ffi.isnull.php                                     29-May-2024 00:07                2563
ffi.load.php                                       29-May-2024 00:07                4338
ffi.memcmp.php                                     29-May-2024 00:07                4128
ffi.memcpy.php                                     29-May-2024 00:07                3311
ffi.memset.php                                     29-May-2024 00:07                3151
ffi.new.php                                        29-May-2024 00:07                5196
ffi.requirements.php                               29-May-2024 00:07                1288
ffi.resources.php                                  29-May-2024 00:07                1247
ffi.scope.php                                      29-May-2024 00:07                3177
ffi.setup.php                                      29-May-2024 00:07                1595
ffi.sizeof.php                                     29-May-2024 00:07                2791
ffi.string.php                                     29-May-2024 00:07                4233
ffi.type.php                                       29-May-2024 00:07                3610
ffi.typeof.php                                     29-May-2024 00:07                2884
fiber.construct.php                                29-May-2024 00:07                2344
fiber.getcurrent.php                               29-May-2024 00:07                2557
fiber.getreturn.php                                29-May-2024 00:07                2609
fiber.isrunning.php                                29-May-2024 00:07                2773
fiber.isstarted.php                                29-May-2024 00:07                2355
fiber.issuspended.php                              29-May-2024 00:07                2367
fiber.isterminated.php                             29-May-2024 00:07                2420
fiber.resume.php                                   29-May-2024 00:07                3453
fiber.start.php                                    29-May-2024 00:07                3133
fiber.suspend.php                                  29-May-2024 00:07                4087
fiber.throw.php                                    29-May-2024 00:07                3292
fibererror.construct.php                           29-May-2024 00:07                2243
fileinfo.configuration.php                         29-May-2024 00:07                1331
fileinfo.constants.php                             29-May-2024 00:07                6272
fileinfo.installation.php                          29-May-2024 00:07                1801
fileinfo.requirements.php                          29-May-2024 00:07                1238
fileinfo.resources.php                             29-May-2024 00:07                1492
fileinfo.setup.php                                 29-May-2024 00:07                1671
filesystem.configuration.php                       29-May-2024 00:07                7909
filesystem.constants.php                           29-May-2024 00:07               12612
filesystem.installation.php                        29-May-2024 00:07                1308
filesystem.requirements.php                        29-May-2024 00:07                1252
filesystem.resources.php                           29-May-2024 00:07                1347
filesystem.setup.php                               29-May-2024 00:07                1696
filesystemiterator.construct.php                   29-May-2024 00:07                7573
filesystemiterator.current.php                     29-May-2024 00:07                5426
filesystemiterator.getflags.php                    29-May-2024 00:07                3247
filesystemiterator.key.php                         29-May-2024 00:07                5144
filesystemiterator.next.php                        29-May-2024 00:07                4553
filesystemiterator.rewind.php                      29-May-2024 00:07                5182
filesystemiterator.setflags.php                    29-May-2024 00:07                6694
filter.configuration.php                           29-May-2024 00:07                5152
filter.constants.php                               29-May-2024 00:07               25041
filter.examples.php                                29-May-2024 00:07                1495
filter.examples.sanitization.php                   29-May-2024 00:07                5591
filter.examples.validation.php                     29-May-2024 00:07               10163
filter.filters.flags.php                           29-May-2024 00:07               16870
filter.filters.misc.php                            29-May-2024 00:07                1947
filter.filters.php                                 29-May-2024 00:07                1648
filter.filters.sanitize.php                        29-May-2024 00:07               13635
filter.filters.validate.php                        29-May-2024 00:07               13956
filter.installation.php                            29-May-2024 00:07                1339
filter.requirements.php                            29-May-2024 00:07                1224
filter.resources.php                               29-May-2024 00:07                1257
filter.setup.php                                   29-May-2024 00:07                1634
filteriterator.accept.php                          29-May-2024 00:07                5337
filteriterator.construct.php                       29-May-2024 00:07                3117
filteriterator.current.php                         29-May-2024 00:07                3013
filteriterator.key.php                             29-May-2024 00:07                2953
filteriterator.next.php                            29-May-2024 00:07                2968
filteriterator.rewind.php                          29-May-2024 00:07                3146
filteriterator.valid.php                           29-May-2024 00:07                2858
filters.compression.php                            29-May-2024 00:07               16252
filters.convert.php                                29-May-2024 00:07               13331
filters.encryption.php                             29-May-2024 00:07               41067
filters.php                                        29-May-2024 00:07                3486
filters.string.php                                 29-May-2024 00:07               10426
finfo.buffer.php                                   29-May-2024 00:07                2917
finfo.construct.php                                29-May-2024 00:07                3182
finfo.file.php                                     29-May-2024 00:07                2908
finfo.set-flags.php                                29-May-2024 00:07                2127
fpm.observability.php                              29-May-2024 00:07                1416
fpm.setup.php                                      29-May-2024 00:07                1309
fpm.status.php                                     29-May-2024 00:07               10135
ftp.configuration.php                              29-May-2024 00:07                1296
ftp.constants.php                                  29-May-2024 00:07                5462
ftp.examples-basic.php                             29-May-2024 00:07                4963
ftp.examples.php                                   29-May-2024 00:07                1392
ftp.installation.php                               29-May-2024 00:07                1497
ftp.requirements.php                               29-May-2024 00:07                1203
ftp.resources.php                                  29-May-2024 00:07                1584
ftp.setup.php                                      29-May-2024 00:07                1605
funchand.configuration.php                         29-May-2024 00:07                1331
funchand.constants.php                             29-May-2024 00:07                1245
funchand.installation.php                          29-May-2024 00:07                1294
funchand.requirements.php                          29-May-2024 00:07                1238
funchand.resources.php                             29-May-2024 00:07                1282
funchand.setup.php                                 29-May-2024 00:07                1649
funcref.php                                        29-May-2024 00:07               14678
function.abs.php                                   29-May-2024 00:07                5620
function.acos.php                                  29-May-2024 00:07                3513
function.acosh.php                                 29-May-2024 00:07                3287
function.addcslashes.php                           29-May-2024 00:07                8051
function.addslashes.php                            29-May-2024 00:07                6488
function.apache-child-terminate.php                29-May-2024 00:07                3449
function.apache-get-modules.php                    29-May-2024 00:07                3379
function.apache-get-version.php                    29-May-2024 00:07                3992
function.apache-getenv.php                         29-May-2024 00:07                5308
function.apache-lookup-uri.php                     29-May-2024 00:07                5678
function.apache-note.php                           29-May-2024 00:07                7349
function.apache-request-headers.php                29-May-2024 00:07                5853
function.apache-response-headers.php               29-May-2024 00:07                4538
function.apache-setenv.php                         29-May-2024 00:07                5865
function.apcu-add.php                              29-May-2024 00:07                8538
function.apcu-cache-info.php                       29-May-2024 00:07                6783
function.apcu-cas.php                              29-May-2024 00:07                8838
function.apcu-clear-cache.php                      29-May-2024 00:07                2657
function.apcu-dec.php                              29-May-2024 00:07                8308
function.apcu-delete.php                           29-May-2024 00:07                6129
function.apcu-enabled.php                          29-May-2024 00:07                2441
function.apcu-entry.php                            29-May-2024 00:07                8508
function.apcu-exists.php                           29-May-2024 00:07                7004
function.apcu-fetch.php                            29-May-2024 00:07                5836
function.apcu-inc.php                              29-May-2024 00:07                8292
function.apcu-key-info.php                         29-May-2024 00:07                5025
function.apcu-sma-info.php                         29-May-2024 00:07                4673
function.apcu-store.php                            29-May-2024 00:07                7417
function.array-change-key-case.php                 29-May-2024 00:07                5445
function.array-chunk.php                           29-May-2024 00:07                7869
function.array-column.php                          29-May-2024 00:07               17051
function.array-combine.php                         29-May-2024 00:07                7519
function.array-count-values.php                    29-May-2024 00:07                5988
function.array-diff-assoc.php                      29-May-2024 00:07               11318
function.array-diff-key.php                        29-May-2024 00:07               13002
function.array-diff-uassoc.php                     29-May-2024 00:07               12264
function.array-diff-ukey.php                       29-May-2024 00:07               12578
function.array-diff.php                            29-May-2024 00:07               12297
function.array-fill-keys.php                       29-May-2024 00:07                5464
function.array-fill.php                            29-May-2024 00:07                8944
function.array-filter.php                          29-May-2024 00:07               17021
function.array-flip.php                            29-May-2024 00:07                7299
function.array-intersect-assoc.php                 29-May-2024 00:07                8920
function.array-intersect-key.php                   29-May-2024 00:07               10453
function.array-intersect-uassoc.php                29-May-2024 00:07                9386
function.array-intersect-ukey.php                  29-May-2024 00:07               12452
function.array-intersect.php                       29-May-2024 00:07                7086
function.array-is-list.php                         29-May-2024 00:07                7045
function.array-key-exists.php                      29-May-2024 00:07                9051
function.array-key-first.php                       29-May-2024 00:07                7192
function.array-key-last.php                        29-May-2024 00:07                3455
function.array-keys.php                            29-May-2024 00:07                8594
function.array-map.php                             29-May-2024 00:07               27719
function.array-merge-recursive.php                 29-May-2024 00:07                6840
function.array-merge.php                           29-May-2024 00:07               12526
function.array-multisort.php                       29-May-2024 00:07               23976
function.array-pad.php                             29-May-2024 00:07                7193
function.array-pop.php                             29-May-2024 00:07                5715
function.array-product.php                         29-May-2024 00:07                4460
function.array-push.php                            29-May-2024 00:07                7045
function.array-rand.php                            29-May-2024 00:07                8293
function.array-reduce.php                          29-May-2024 00:07               10213
function.array-replace-recursive.php               29-May-2024 00:07               11044
function.array-replace.php                         29-May-2024 00:07                6670
function.array-reverse.php                         29-May-2024 00:07                6257
function.array-search.php                          29-May-2024 00:07                8656
function.array-shift.php                           29-May-2024 00:07                5753
function.array-slice.php                           29-May-2024 00:07               14087
function.array-splice.php                          29-May-2024 00:07               18742
function.array-sum.php                             29-May-2024 00:07                5129
function.array-udiff-assoc.php                     29-May-2024 00:07               15039
function.array-udiff-uassoc.php                    29-May-2024 00:07               16528
function.array-udiff.php                           29-May-2024 00:07               27324
function.array-uintersect-assoc.php                29-May-2024 00:07                8884
function.array-uintersect-uassoc.php               29-May-2024 00:07                9535
function.array-uintersect.php                      29-May-2024 00:07                8412
function.array-unique.php                          29-May-2024 00:07                9896
function.array-unshift.php                         29-May-2024 00:07               11150
function.array-values.php                          29-May-2024 00:07                4732
function.array-walk-recursive.php                  29-May-2024 00:07                7803
function.array-walk.php                            29-May-2024 00:07               14466
function.array.php                                 29-May-2024 00:07               12025
function.arsort.php                                29-May-2024 00:07                9358
function.asin.php                                  29-May-2024 00:07                3508
function.asinh.php                                 29-May-2024 00:07                3283
function.asort.php                                 29-May-2024 00:07                9617
function.assert-options.php                        29-May-2024 00:07               14476
function.assert.php                                29-May-2024 00:07               30800
function.atan.php                                  29-May-2024 00:07                3521
function.atan2.php                                 29-May-2024 00:07                3477
function.atanh.php                                 29-May-2024 00:07                3308
function.autoload.php                              29-May-2024 00:07                3242
function.base-convert.php                          29-May-2024 00:07                6654
function.base64-decode.php                         29-May-2024 00:07                5180
function.base64-encode.php                         29-May-2024 00:07                4792
function.basename.php                              29-May-2024 00:07                7574
function.bcadd.php                                 29-May-2024 00:07                5996
function.bccomp.php                                29-May-2024 00:07                5936
function.bcdiv.php                                 29-May-2024 00:07                5552
function.bcmod.php                                 29-May-2024 00:07                7673
function.bcmul.php                                 29-May-2024 00:07                7422
function.bcpow.php                                 29-May-2024 00:07                7426
function.bcpowmod.php                              29-May-2024 00:07                7573
function.bcscale.php                               29-May-2024 00:07                5783
function.bcsqrt.php                                29-May-2024 00:07                6415
function.bcsub.php                                 29-May-2024 00:07                5992
function.bin2hex.php                               29-May-2024 00:07                4787
function.bind-textdomain-codeset.php               29-May-2024 00:07                4716
function.bindec.php                                29-May-2024 00:07               14912
function.bindtextdomain.php                        29-May-2024 00:07                5664
function.boolval.php                               29-May-2024 00:07               10309
function.bzclose.php                               29-May-2024 00:07                3209
function.bzcompress.php                            29-May-2024 00:07                5393
function.bzdecompress.php                          29-May-2024 00:07                6743
function.bzerrno.php                               29-May-2024 00:07                3250
function.bzerror.php                               29-May-2024 00:07                4519
function.bzerrstr.php                              29-May-2024 00:07                3271
function.bzflush.php                               29-May-2024 00:07                3513
function.bzopen.php                                29-May-2024 00:07                5322
function.bzread.php                                29-May-2024 00:07                6736
function.bzwrite.php                               29-May-2024 00:07                6616
function.cal-days-in-month.php                     29-May-2024 00:07                4688
function.cal-from-jd.php                           29-May-2024 00:07                7222
function.cal-info.php                              29-May-2024 00:07                6105
function.cal-to-jd.php                             29-May-2024 00:07                6413
function.call-user-func-array.php                  29-May-2024 00:07               18224
function.call-user-func.php                        29-May-2024 00:07               14663
function.ceil.php                                  29-May-2024 00:07                5197
function.chdir.php                                 29-May-2024 00:07                5819
function.checkdate.php                             29-May-2024 00:07                5670
function.checkdnsrr.php                            29-May-2024 00:07                5209
function.chgrp.php                                 29-May-2024 00:07                6676
function.chmod.php                                 29-May-2024 00:07                8840
function.chop.php                                  29-May-2024 00:07                2019
function.chown.php                                 29-May-2024 00:07                6930
function.chr.php                                   29-May-2024 00:07                8913
function.chroot.php                                29-May-2024 00:07                4829
function.chunk-split.php                           29-May-2024 00:07                5404
function.class-alias.php                           29-May-2024 00:07                8476
function.class-exists.php                          29-May-2024 00:07                7212
function.class-implements.php                      29-May-2024 00:07                7418
function.class-parents.php                         29-May-2024 00:07                7090
function.class-uses.php                            29-May-2024 00:07                6392
function.clearstatcache.php                        29-May-2024 00:07               11227
function.cli-get-process-title.php                 29-May-2024 00:07                4644
function.cli-set-process-title.php                 29-May-2024 00:07                6173
function.closedir.php                              29-May-2024 00:07                5290
function.closelog.php                              29-May-2024 00:07                3048
function.com-create-guid.php                       29-May-2024 00:07                2933
function.com-event-sink.php                        29-May-2024 00:07               10671
function.com-get-active-object.php                 29-May-2024 00:07                5922
function.com-load-typelib.php                      29-May-2024 00:07                5316
function.com-message-pump.php                      29-May-2024 00:07                4063
function.com-print-typeinfo.php                    29-May-2024 00:07                5175
function.commonmark-parse.php                      29-May-2024 00:07                4198
function.commonmark-render-html.php                29-May-2024 00:07                4739
function.commonmark-render-latex.php               29-May-2024 00:07                5069
function.commonmark-render-man.php                 29-May-2024 00:07                5051
function.commonmark-render-xml.php                 29-May-2024 00:07                4696
function.commonmark-render.php                     29-May-2024 00:07                4997
function.compact.php                               29-May-2024 00:07                8422
function.connection-aborted.php                    29-May-2024 00:07                3204
function.connection-status.php                     29-May-2024 00:07                3284
function.constant.php                              29-May-2024 00:07                9312
function.convert-cyr-string.php                    29-May-2024 00:07                5224
function.convert-uudecode.php                      29-May-2024 00:07                4664
function.convert-uuencode.php                      29-May-2024 00:07                5530
function.copy.php                                  29-May-2024 00:07                6111
function.cos.php                                   29-May-2024 00:07                3993
function.cosh.php                                  29-May-2024 00:07                3228
function.count-chars.php                           29-May-2024 00:07                7340
function.count.php                                 29-May-2024 00:07               16199
function.crc32.php                                 29-May-2024 00:07                7764
function.create-function.php                       29-May-2024 00:07               31352
function.crypt.php                                 29-May-2024 00:07               13891
function.ctype-alnum.php                           29-May-2024 00:07                7052
function.ctype-alpha.php                           29-May-2024 00:07                7345
function.ctype-cntrl.php                           29-May-2024 00:07                6941
function.ctype-digit.php                           29-May-2024 00:07                9041
function.ctype-graph.php                           29-May-2024 00:07                7761
function.ctype-lower.php                           29-May-2024 00:07                6973
function.ctype-print.php                           29-May-2024 00:07                7793
function.ctype-punct.php                           29-May-2024 00:07                7090
function.ctype-space.php                           29-May-2024 00:07                7687
function.ctype-upper.php                           29-May-2024 00:07                7042
function.ctype-xdigit.php                          29-May-2024 00:07                6819
function.cubrid-affected-rows.php                  29-May-2024 00:07                9457
function.cubrid-bind.php                           29-May-2024 00:07               20768
function.cubrid-client-encoding.php                29-May-2024 00:07                5337
function.cubrid-close-prepare.php                  29-May-2024 00:07                6311
function.cubrid-close-request.php                  29-May-2024 00:07                6322
function.cubrid-close.php                          29-May-2024 00:07                6452
function.cubrid-col-get.php                        29-May-2024 00:07                8611
function.cubrid-col-size.php                       29-May-2024 00:07                8729
function.cubrid-column-names.php                   29-May-2024 00:07                8575
function.cubrid-column-types.php                   29-May-2024 00:07                8555
function.cubrid-commit.php                         29-May-2024 00:07               15392
function.cubrid-connect-with-url.php               29-May-2024 00:07               15175
function.cubrid-connect.php                        29-May-2024 00:07               12389
function.cubrid-current-oid.php                    29-May-2024 00:07                6056
function.cubrid-data-seek.php                      29-May-2024 00:07                7516
function.cubrid-db-name.php                        29-May-2024 00:07                6609
function.cubrid-disconnect.php                     29-May-2024 00:07                7193
function.cubrid-drop.php                           29-May-2024 00:07               11487
function.cubrid-errno.php                          29-May-2024 00:07                6897
function.cubrid-error-code-facility.php            29-May-2024 00:07                5885
function.cubrid-error-code.php                     29-May-2024 00:07                5795
function.cubrid-error-msg.php                      29-May-2024 00:07                5245
function.cubrid-error.php                          29-May-2024 00:07                6426
function.cubrid-execute.php                        29-May-2024 00:07               14439
function.cubrid-fetch-array.php                    29-May-2024 00:07                9867
function.cubrid-fetch-assoc.php                    29-May-2024 00:07                9101
function.cubrid-fetch-field.php                    29-May-2024 00:07               14128
function.cubrid-fetch-lengths.php                  29-May-2024 00:07                6183
function.cubrid-fetch-object.php                   29-May-2024 00:07               12046
function.cubrid-fetch-row.php                      29-May-2024 00:07                9025
function.cubrid-fetch.php                          29-May-2024 00:07               10001
function.cubrid-field-flags.php                    29-May-2024 00:07                7836
function.cubrid-field-len.php                      29-May-2024 00:07                8345
function.cubrid-field-name.php                     29-May-2024 00:07                7251
function.cubrid-field-seek.php                     29-May-2024 00:07               11003
function.cubrid-field-table.php                    29-May-2024 00:07                7456
function.cubrid-field-type.php                     29-May-2024 00:07                7518
function.cubrid-free-result.php                    29-May-2024 00:07                5995
function.cubrid-get-autocommit.php                 29-May-2024 00:07                3858
function.cubrid-get-charset.php                    29-May-2024 00:07                5068
function.cubrid-get-class-name.php                 29-May-2024 00:07                6398
function.cubrid-get-client-info.php                29-May-2024 00:07                8197
function.cubrid-get-db-parameter.php               29-May-2024 00:07               14365
function.cubrid-get-query-timeout.php              29-May-2024 00:07                6784
function.cubrid-get-server-info.php                29-May-2024 00:07                8488
function.cubrid-get.php                            29-May-2024 00:07                9911
function.cubrid-insert-id.php                      29-May-2024 00:07                7195
function.cubrid-is-instance.php                    29-May-2024 00:07                7235
function.cubrid-list-dbs.php                       29-May-2024 00:07                4598
function.cubrid-load-from-glo.php                  29-May-2024 00:07                6944
function.cubrid-lob-close.php                      29-May-2024 00:07                7312
function.cubrid-lob-export.php                     29-May-2024 00:07                7905
function.cubrid-lob-get.php                        29-May-2024 00:07                7695
function.cubrid-lob-send.php                       29-May-2024 00:07                7066
function.cubrid-lob-size.php                       29-May-2024 00:07                5894
function.cubrid-lob2-bind.php                      29-May-2024 00:07                9776
function.cubrid-lob2-close.php                     29-May-2024 00:07                3468
function.cubrid-lob2-export.php                    29-May-2024 00:07                8769
function.cubrid-lob2-import.php                    29-May-2024 00:07                8638
function.cubrid-lob2-new.php                       29-May-2024 00:07                3993
function.cubrid-lob2-read.php                      29-May-2024 00:07               13739
function.cubrid-lob2-seek.php                      29-May-2024 00:07               11300
function.cubrid-lob2-seek64.php                    29-May-2024 00:07               12725
function.cubrid-lob2-size.php                      29-May-2024 00:07                4374
function.cubrid-lob2-size64.php                    29-May-2024 00:07                4554
function.cubrid-lob2-tell.php                      29-May-2024 00:07                4393
function.cubrid-lob2-tell64.php                    29-May-2024 00:07                4591
function.cubrid-lob2-write.php                     29-May-2024 00:07               14060
function.cubrid-lock-read.php                      29-May-2024 00:07                9208
function.cubrid-lock-write.php                     29-May-2024 00:07                9596
function.cubrid-move-cursor.php                    29-May-2024 00:07                9580
function.cubrid-new-glo.php                        29-May-2024 00:07                6995
function.cubrid-next-result.php                    29-May-2024 00:07               16367
function.cubrid-num-cols.php                       29-May-2024 00:07                6032
function.cubrid-num-fields.php                     29-May-2024 00:07                5745
function.cubrid-num-rows.php                       29-May-2024 00:07                7216
function.cubrid-pconnect-with-url.php              29-May-2024 00:07               14502
function.cubrid-pconnect.php                       29-May-2024 00:07               12170
function.cubrid-ping.php                           29-May-2024 00:07                6129
function.cubrid-prepare.php                        29-May-2024 00:07               10325
function.cubrid-put.php                            29-May-2024 00:07               11429
function.cubrid-query.php                          29-May-2024 00:07               14770
function.cubrid-real-escape-string.php             29-May-2024 00:07                8266
function.cubrid-result.php                         29-May-2024 00:07                7476
function.cubrid-rollback.php                       29-May-2024 00:07               14687
function.cubrid-save-to-glo.php                    29-May-2024 00:07                6857
function.cubrid-schema.php                         29-May-2024 00:07               20520
function.cubrid-send-glo.php                       29-May-2024 00:07                6324
function.cubrid-seq-drop.php                       29-May-2024 00:07                9857
function.cubrid-seq-insert.php                     29-May-2024 00:07               10363
function.cubrid-seq-put.php                        29-May-2024 00:07               10290
function.cubrid-set-add.php                        29-May-2024 00:07                9629
function.cubrid-set-autocommit.php                 29-May-2024 00:07                4231
function.cubrid-set-db-parameter.php               29-May-2024 00:07                8249
function.cubrid-set-drop.php                       29-May-2024 00:07                9606
function.cubrid-set-query-timeout.php              29-May-2024 00:07                3619
function.cubrid-unbuffered-query.php               29-May-2024 00:07                7063
function.cubrid-version.php                        29-May-2024 00:07                8747
function.curl-close.php                            29-May-2024 00:07                6197
function.curl-copy-handle.php                      29-May-2024 00:07                6517
function.curl-errno.php                            29-May-2024 00:07                5857
function.curl-error.php                            29-May-2024 00:07                6019
function.curl-escape.php                           29-May-2024 00:07                7580
function.curl-exec.php                             29-May-2024 00:07                7622
function.curl-getinfo.php                          29-May-2024 00:07               37276
function.curl-init.php                             29-May-2024 00:07                7479
function.curl-multi-add-handle.php                 29-May-2024 00:07               10774
function.curl-multi-close.php                      29-May-2024 00:07                9752
function.curl-multi-errno.php                      29-May-2024 00:07                3978
function.curl-multi-exec.php                       29-May-2024 00:07               10780
function.curl-multi-getcontent.php                 29-May-2024 00:07                4487
function.curl-multi-info-read.php                  29-May-2024 00:07               12193
function.curl-multi-init.php                       29-May-2024 00:07                9193
function.curl-multi-remove-handle.php              29-May-2024 00:07                5566
function.curl-multi-select.php                     29-May-2024 00:07                4446
function.curl-multi-setopt.php                     29-May-2024 00:07               12958
function.curl-multi-strerror.php                   29-May-2024 00:07                7168
function.curl-pause.php                            29-May-2024 00:07                3934
function.curl-reset.php                            29-May-2024 00:07                6475
function.curl-setopt-array.php                     29-May-2024 00:07                7655
function.curl-setopt.php                           29-May-2024 00:07              173338
function.curl-share-close.php                      29-May-2024 00:07                8152
function.curl-share-errno.php                      29-May-2024 00:07                4007
function.curl-share-init.php                       29-May-2024 00:07                7753
function.curl-share-setopt.php                     29-May-2024 00:07               10365
function.curl-share-strerror.php                   29-May-2024 00:07                3541
function.curl-strerror.php                         29-May-2024 00:07                6340
function.curl-unescape.php                         29-May-2024 00:07                8080
function.curl-version.php                          29-May-2024 00:07                7027
function.curl_upkeep.php                           29-May-2024 00:07                6945
function.current.php                               29-May-2024 00:07               11415
function.date-add.php                              29-May-2024 00:07                1777
function.date-create-from-format.php               29-May-2024 00:07                1951
function.date-create-immutable-from-format.php     29-May-2024 00:07                2062
function.date-create-immutable.php                 29-May-2024 00:07                4279
function.date-create.php                           29-May-2024 00:07                4473
function.date-date-set.php                         29-May-2024 00:07                1836
function.date-default-timezone-get.php             29-May-2024 00:07                7183
function.date-default-timezone-set.php             29-May-2024 00:07                5887
function.date-diff.php                             29-May-2024 00:07                1796
function.date-format.php                           29-May-2024 00:07                1804
function.date-get-last-errors.php                  29-May-2024 00:07                1969
function.date-interval-create-from-date-string.php 29-May-2024 00:07                2080
function.date-interval-format.php                  29-May-2024 00:07                1931
function.date-isodate-set.php                      29-May-2024 00:07                1859
function.date-modify.php                           29-May-2024 00:07                1808
function.date-offset-get.php                       29-May-2024 00:07                1852
function.date-parse-from-format.php                29-May-2024 00:07               14029
function.date-parse.php                            29-May-2024 00:07               19513
function.date-sub.php                              29-May-2024 00:07                2388
function.date-sun-info.php                         29-May-2024 00:07               15947
function.date-sunrise.php                          29-May-2024 00:07               14253
function.date-sunset.php                           29-May-2024 00:07               14285
function.date-time-set.php                         29-May-2024 00:07                1822
function.date-timestamp-get.php                    29-May-2024 00:07                1881
function.date-timestamp-set.php                    29-May-2024 00:07                1889
function.date-timezone-get.php                     29-May-2024 00:07                1878
function.date-timezone-set.php                     29-May-2024 00:07                1850
function.date.php                                  29-May-2024 00:07               22214
function.db2-autocommit.php                        29-May-2024 00:07               11165
function.db2-bind-param.php                        29-May-2024 00:07               22937
function.db2-client-info.php                       29-May-2024 00:07               11694
function.db2-close.php                             29-May-2024 00:07                5735
function.db2-column-privileges.php                 29-May-2024 00:07                9194
function.db2-columns.php                           29-May-2024 00:07               11243
function.db2-commit.php                            29-May-2024 00:07                3775
function.db2-conn-error.php                        29-May-2024 00:07                7009
function.db2-conn-errormsg.php                     29-May-2024 00:07                6773
function.db2-connect.php                           29-May-2024 00:07               39201
function.db2-cursor-type.php                       29-May-2024 00:07                3364
function.db2-escape-string.php                     29-May-2024 00:07                7618
function.db2-exec.php                              29-May-2024 00:07               26328
function.db2-execute.php                           29-May-2024 00:07               25703
function.db2-fetch-array.php                       29-May-2024 00:07               11354
function.db2-fetch-assoc.php                       29-May-2024 00:07               11346
function.db2-fetch-both.php                        29-May-2024 00:07               11879
function.db2-fetch-object.php                      29-May-2024 00:07                9056
function.db2-fetch-row.php                         29-May-2024 00:07               16343
function.db2-field-display-size.php                29-May-2024 00:07                5158
function.db2-field-name.php                        29-May-2024 00:07                5046
function.db2-field-num.php                         29-May-2024 00:07                5054
function.db2-field-precision.php                   29-May-2024 00:07                5086
function.db2-field-scale.php                       29-May-2024 00:07                5048
function.db2-field-type.php                        29-May-2024 00:07                5051
function.db2-field-width.php                       29-May-2024 00:07                5256
function.db2-foreign-keys.php                      29-May-2024 00:07                9099
function.db2-free-result.php                       29-May-2024 00:07                3433
function.db2-free-stmt.php                         29-May-2024 00:07                3421
function.db2-get-option.php                        29-May-2024 00:07               24162
function.db2-last-insert-id.php                    29-May-2024 00:07                8188
function.db2-lob-read.php                          29-May-2024 00:07               16425
function.db2-next-result.php                       29-May-2024 00:07                8862
function.db2-num-fields.php                        29-May-2024 00:07                7212
function.db2-num-rows.php                          29-May-2024 00:07                4789
function.db2-pclose.php                            29-May-2024 00:07                5905
function.db2-pconnect.php                          29-May-2024 00:07               32334
function.db2-prepare.php                           29-May-2024 00:07               10613
function.db2-primary-keys.php                      29-May-2024 00:07                7733
function.db2-procedure-columns.php                 29-May-2024 00:07               12201
function.db2-procedures.php                        29-May-2024 00:07                8062
function.db2-result.php                            29-May-2024 00:07                8015
function.db2-rollback.php                          29-May-2024 00:07                9359
function.db2-server-info.php                       29-May-2024 00:07               22540
function.db2-set-option.php                        29-May-2024 00:07               67461
function.db2-special-columns.php                   29-May-2024 00:07               10314
function.db2-statistics.php                        29-May-2024 00:07               12585
function.db2-stmt-error.php                        29-May-2024 00:07                4663
function.db2-stmt-errormsg.php                     29-May-2024 00:07                4294
function.db2-table-privileges.php                  29-May-2024 00:07                8623
function.db2-tables.php                            29-May-2024 00:07                8953
function.dba-close.php                             29-May-2024 00:07                3229
function.dba-delete.php                            29-May-2024 00:07                4179
function.dba-exists.php                            29-May-2024 00:07                4203
function.dba-fetch.php                             29-May-2024 00:07                7156
function.dba-firstkey.php                          29-May-2024 00:07                3702
function.dba-handlers.php                          29-May-2024 00:07                5567
function.dba-insert.php                            29-May-2024 00:07                4817
function.dba-key-split.php                         29-May-2024 00:07                3992
function.dba-list.php                              29-May-2024 00:07                2275
function.dba-nextkey.php                           29-May-2024 00:07                3624
function.dba-open.php                              29-May-2024 00:07               13887
function.dba-optimize.php                          29-May-2024 00:07                3263
function.dba-popen.php                             29-May-2024 00:07                9212
function.dba-replace.php                           29-May-2024 00:07                4645
function.dba-sync.php                              29-May-2024 00:07                3283
function.dbase-add-record.php                      29-May-2024 00:07                6974
function.dbase-close.php                           29-May-2024 00:07                5306
function.dbase-create.php                          29-May-2024 00:07                8288
function.dbase-delete-record.php                   29-May-2024 00:07                5051
function.dbase-get-header-info.php                 29-May-2024 00:07                7040
function.dbase-get-record-with-names.php           29-May-2024 00:07                8891
function.dbase-get-record.php                      29-May-2024 00:07                5841
function.dbase-numfields.php                       29-May-2024 00:07                6017
function.dbase-numrecords.php                      29-May-2024 00:07                6968
function.dbase-open.php                            29-May-2024 00:07                6637
function.dbase-pack.php                            29-May-2024 00:07                6398
function.dbase-replace-record.php                  29-May-2024 00:07                9536
function.dcgettext.php                             29-May-2024 00:07                3669
function.dcngettext.php                            29-May-2024 00:07                4346
function.debug-backtrace.php                       29-May-2024 00:07               11824
function.debug-print-backtrace.php                 29-May-2024 00:07                6767
function.debug-zval-dump.php                       29-May-2024 00:07               10018
function.decbin.php                                29-May-2024 00:07                8800
function.dechex.php                                29-May-2024 00:07                7192
function.decoct.php                                29-May-2024 00:07                4833
function.define.php                                29-May-2024 00:07               12234
function.defined.php                               29-May-2024 00:07                7912
function.deflate-add.php                           29-May-2024 00:07                6018
function.deflate-init.php                          29-May-2024 00:07                7959
function.deg2rad.php                               29-May-2024 00:07                4044
function.delete.php                                29-May-2024 00:07                2491
function.dgettext.php                              29-May-2024 00:07                3320
function.die.php                                   29-May-2024 00:07                1611
function.dio-close.php                             29-May-2024 00:07                4092
function.dio-fcntl.php                             29-May-2024 00:07               10020
function.dio-open.php                              29-May-2024 00:07                8697
function.dio-read.php                              29-May-2024 00:07                3668
function.dio-seek.php                              29-May-2024 00:07                7514
function.dio-stat.php                              29-May-2024 00:07                4454
function.dio-tcsetattr.php                         29-May-2024 00:07                7031
function.dio-truncate.php                          29-May-2024 00:07                3747
function.dio-write.php                             29-May-2024 00:07                4002
function.dir.php                                   29-May-2024 00:07                7293
function.dirname.php                               29-May-2024 00:07                9602
function.disk-free-space.php                       29-May-2024 00:07                5655
function.disk-total-space.php                      29-May-2024 00:07                5294
function.diskfreespace.php                         29-May-2024 00:07                1817
function.dl.php                                    29-May-2024 00:07                9953
function.dngettext.php                             29-May-2024 00:07                4032
function.dns-check-record.php                      29-May-2024 00:07                1779
function.dns-get-mx.php                            29-May-2024 00:07                1750
function.dns-get-record.php                        29-May-2024 00:07               24909
function.dom-import-simplexml.php                  29-May-2024 00:07                7230
function.doubleval.php                             29-May-2024 00:07                1739
function.each.php                                  29-May-2024 00:07               11323
function.easter-date.php                           29-May-2024 00:07               14421
function.easter-days.php                           29-May-2024 00:07                7608
function.echo.php                                  29-May-2024 00:07               17681
function.eio-busy.php                              29-May-2024 00:07                4970
function.eio-cancel.php                            29-May-2024 00:07                7532
function.eio-chmod.php                             29-May-2024 00:07                6211
function.eio-chown.php                             29-May-2024 00:07                6413
function.eio-close.php                             29-May-2024 00:07                5644
function.eio-custom.php                            29-May-2024 00:07               10296
function.eio-dup2.php                              29-May-2024 00:07                5689
function.eio-event-loop.php                        29-May-2024 00:07                5830
function.eio-fallocate.php                         29-May-2024 00:07                7549
function.eio-fchmod.php                            29-May-2024 00:07                6171
function.eio-fchown.php                            29-May-2024 00:07                6473
function.eio-fdatasync.php                         29-May-2024 00:07                5553
function.eio-fstat.php                             29-May-2024 00:07               11542
function.eio-fstatvfs.php                          29-May-2024 00:07                5686
function.eio-fsync.php                             29-May-2024 00:07                5660
function.eio-ftruncate.php                         29-May-2024 00:07                6189
function.eio-futime.php                            29-May-2024 00:07                6495
function.eio-get-event-stream.php                  29-May-2024 00:07                8088
function.eio-get-last-error.php                    29-May-2024 00:07                3167
function.eio-grp-add.php                           29-May-2024 00:07               11477
function.eio-grp-cancel.php                        29-May-2024 00:07                3164
function.eio-grp-limit.php                         29-May-2024 00:07                3078
function.eio-grp.php                               29-May-2024 00:07               11738
function.eio-init.php                              29-May-2024 00:07                2631
function.eio-link.php                              29-May-2024 00:07               12542
function.eio-lstat.php                             29-May-2024 00:07                9915
function.eio-mkdir.php                             29-May-2024 00:07                9228
function.eio-mknod.php                             29-May-2024 00:07               11519
function.eio-nop.php                               29-May-2024 00:07                5317
function.eio-npending.php                          29-May-2024 00:07                3048
function.eio-nready.php                            29-May-2024 00:07                2796
function.eio-nreqs.php                             29-May-2024 00:07                5580
function.eio-nthreads.php                          29-May-2024 00:07                3470
function.eio-open.php                              29-May-2024 00:07               11497
function.eio-poll.php                              29-May-2024 00:07                5713
function.eio-read.php                              29-May-2024 00:07               12512
function.eio-readahead.php                         29-May-2024 00:07                6222
function.eio-readdir.php                           29-May-2024 00:07               18247
function.eio-readlink.php                          29-May-2024 00:07               12239
function.eio-realpath.php                          29-May-2024 00:07                5373
function.eio-rename.php                            29-May-2024 00:07                9308
function.eio-rmdir.php                             29-May-2024 00:07                8259
function.eio-seek.php                              29-May-2024 00:07                7032
function.eio-sendfile.php                          29-May-2024 00:07                6547
function.eio-set-max-idle.php                      29-May-2024 00:07                3167
function.eio-set-max-parallel.php                  29-May-2024 00:07                3216
function.eio-set-max-poll-reqs.php                 29-May-2024 00:07                2529
function.eio-set-max-poll-time.php                 29-May-2024 00:07                2599
function.eio-set-min-parallel.php                  29-May-2024 00:07                3207
function.eio-stat.php                              29-May-2024 00:07                9892
function.eio-statvfs.php                           29-May-2024 00:07                8382
function.eio-symlink.php                           29-May-2024 00:07               10873
function.eio-sync-file-range.php                   29-May-2024 00:07                7327
function.eio-sync.php                              29-May-2024 00:07                2941
function.eio-syncfs.php                            29-May-2024 00:07                5236
function.eio-truncate.php                          29-May-2024 00:07                6166
function.eio-unlink.php                            29-May-2024 00:07                5342
function.eio-utime.php                             29-May-2024 00:07                6204
function.eio-write.php                             29-May-2024 00:07                6922
function.empty.php                                 29-May-2024 00:07                9398
function.enchant-broker-describe.php               29-May-2024 00:07                6103
function.enchant-broker-dict-exists.php            29-May-2024 00:07                5781
function.enchant-broker-free-dict.php              29-May-2024 00:07                4864
function.enchant-broker-free.php                   29-May-2024 00:07                4416
function.enchant-broker-get-dict-path.php          29-May-2024 00:07                5386
function.enchant-broker-get-error.php              29-May-2024 00:07                3727
function.enchant-broker-init.php                   29-May-2024 00:07                3545
function.enchant-broker-list-dicts.php             29-May-2024 00:07                6984
function.enchant-broker-request-dict.php           29-May-2024 00:07                7112
function.enchant-broker-request-pwl-dict.php       29-May-2024 00:07                5436
function.enchant-broker-set-dict-path.php          29-May-2024 00:07                5668
function.enchant-broker-set-ordering.php           29-May-2024 00:07                4865
function.enchant-dict-add-to-personal.php          29-May-2024 00:07                2240
function.enchant-dict-add-to-session.php           29-May-2024 00:07                4494
function.enchant-dict-add.php                      29-May-2024 00:07                6444
function.enchant-dict-check.php                    29-May-2024 00:07                4308
function.enchant-dict-describe.php                 29-May-2024 00:07                6595
function.enchant-dict-get-error.php                29-May-2024 00:07                3930
function.enchant-dict-is-added.php                 29-May-2024 00:07                4544
function.enchant-dict-is-in-session.php            29-May-2024 00:07                2226
function.enchant-dict-quick-check.php              29-May-2024 00:07                8356
function.enchant-dict-store-replacement.php        29-May-2024 00:07                4776
function.enchant-dict-suggest.php                  29-May-2024 00:07                7503
function.end.php                                   29-May-2024 00:07                6653
function.enum-exists.php                           29-May-2024 00:07                5458
function.error-clear-last.php                      29-May-2024 00:07                4655
function.error-get-last.php                        29-May-2024 00:07                4932
function.error-log.php                             29-May-2024 00:07               10977
function.error-reporting.php                       29-May-2024 00:07                8982
function.escapeshellarg.php                        29-May-2024 00:07                5585
function.escapeshellcmd.php                        29-May-2024 00:07                7780
function.eval.php                                  29-May-2024 00:07                9208
function.exec.php                                  29-May-2024 00:07               11054
function.exif-imagetype.php                        29-May-2024 00:07               10259
function.exif-read-data.php                        29-May-2024 00:07               22930
function.exif-tagname.php                          29-May-2024 00:07                4844
function.exif-thumbnail.php                        29-May-2024 00:07                9285
function.exit.php                                  29-May-2024 00:07                9379
function.exp.php                                   29-May-2024 00:07                4355
function.expect-expectl.php                        29-May-2024 00:07               11123
function.expect-popen.php                          29-May-2024 00:07                4681
function.explode.php                               29-May-2024 00:07               14905
function.expm1.php                                 29-May-2024 00:07                3513
function.extension-loaded.php                      29-May-2024 00:07                5651
function.extract.php                               29-May-2024 00:07               14283
function.ezmlm-hash.php                            29-May-2024 00:07                4656
function.fann-cascadetrain-on-data.php             29-May-2024 00:07                6649
function.fann-cascadetrain-on-file.php             29-May-2024 00:07                5615
function.fann-clear-scaling-params.php             29-May-2024 00:07                2741
function.fann-copy.php                             29-May-2024 00:07                3265
function.fann-create-from-file.php                 29-May-2024 00:07                3292
function.fann-create-shortcut-array.php            29-May-2024 00:07                4201
function.fann-create-shortcut.php                  29-May-2024 00:07                5221
function.fann-create-sparse-array.php              29-May-2024 00:07                4840
function.fann-create-sparse.php                    29-May-2024 00:07                5598
function.fann-create-standard-array.php            29-May-2024 00:07                4514
function.fann-create-standard.php                  29-May-2024 00:07                5289
function.fann-create-train-from-callback.php       29-May-2024 00:07                9086
function.fann-create-train.php                     29-May-2024 00:07                4614
function.fann-descale-input.php                    29-May-2024 00:07                3806
function.fann-descale-output.php                   29-May-2024 00:07                3822
function.fann-descale-train.php                    29-May-2024 00:07                3748
function.fann-destroy-train.php                    29-May-2024 00:07                2696
function.fann-destroy.php                          29-May-2024 00:07                2728
function.fann-duplicate-train-data.php             29-May-2024 00:07                2880
function.fann-get-activation-function.php          29-May-2024 00:07                5278
function.fann-get-activation-steepness.php         29-May-2024 00:07                5691
function.fann-get-bias-array.php                   29-May-2024 00:07                2613
function.fann-get-bit-fail-limit.php               29-May-2024 00:07                3838
function.fann-get-bit-fail.php                     29-May-2024 00:07                4926
function.fann-get-cascade-activation-functions-..> 29-May-2024 00:07                3875
function.fann-get-cascade-activation-functions.php 29-May-2024 00:07                4691
function.fann-get-cascade-activation-steepnesse..> 29-May-2024 00:07                3931
function.fann-get-cascade-activation-steepnesse..> 29-May-2024 00:07                4082
function.fann-get-cascade-candidate-change-frac..> 29-May-2024 00:07                5188
function.fann-get-cascade-candidate-limit.php      29-May-2024 00:07                3578
function.fann-get-cascade-candidate-stagnation-..> 29-May-2024 00:07                4314
function.fann-get-cascade-max-cand-epochs.php      29-May-2024 00:07                3460
function.fann-get-cascade-max-out-epochs.php       29-May-2024 00:07                3381
function.fann-get-cascade-min-cand-epochs.php      29-May-2024 00:07                3760
function.fann-get-cascade-min-out-epochs.php       29-May-2024 00:07                3717
function.fann-get-cascade-num-candidate-groups.php 29-May-2024 00:07                3858
function.fann-get-cascade-num-candidates.php       29-May-2024 00:07                5992
function.fann-get-cascade-output-change-fractio..> 29-May-2024 00:07                5116
function.fann-get-cascade-output-stagnation-epo..> 29-May-2024 00:07                4257
function.fann-get-cascade-weight-multiplier.php    29-May-2024 00:07                3536
function.fann-get-connection-array.php             29-May-2024 00:07                2640
function.fann-get-connection-rate.php              29-May-2024 00:07                2763
function.fann-get-errno.php                        29-May-2024 00:07                3155
function.fann-get-errstr.php                       29-May-2024 00:07                3160
function.fann-get-layer-array.php                  29-May-2024 00:07                2714
function.fann-get-learning-momentum.php            29-May-2024 00:07                3919
function.fann-get-learning-rate.php                29-May-2024 00:07                3855
function.fann-get-mse.php                          29-May-2024 00:07                3241
function.fann-get-network-type.php                 29-May-2024 00:07                2733
function.fann-get-num-input.php                    29-May-2024 00:07                2620
function.fann-get-num-layers.php                   29-May-2024 00:07                2675
function.fann-get-num-output.php                   29-May-2024 00:07                2639
function.fann-get-quickprop-decay.php              29-May-2024 00:07                3393
function.fann-get-quickprop-mu.php                 29-May-2024 00:07                3286
function.fann-get-rprop-decrease-factor.php        29-May-2024 00:07                3347
function.fann-get-rprop-delta-max.php              29-May-2024 00:07                3409
function.fann-get-rprop-delta-min.php              29-May-2024 00:07                3220
function.fann-get-rprop-delta-zero.php             29-May-2024 00:07                3593
function.fann-get-rprop-increase-factor.php        29-May-2024 00:07                3372
function.fann-get-sarprop-step-error-shift.php     29-May-2024 00:07                3677
function.fann-get-sarprop-step-error-threshold-..> 29-May-2024 00:07                3829
function.fann-get-sarprop-temperature.php          29-May-2024 00:07                3591
function.fann-get-sarprop-weight-decay-shift.php   29-May-2024 00:07                3658
function.fann-get-total-connections.php            29-May-2024 00:07                2812
function.fann-get-total-neurons.php                29-May-2024 00:07                2859
function.fann-get-train-error-function.php         29-May-2024 00:07                3625
function.fann-get-train-stop-function.php          29-May-2024 00:07                3611
function.fann-get-training-algorithm.php           29-May-2024 00:07                3845
function.fann-init-weights.php                     29-May-2024 00:07                4399
function.fann-length-train-data.php                29-May-2024 00:07                2937
function.fann-merge-train-data.php                 29-May-2024 00:07                3223
function.fann-num-input-train-data.php             29-May-2024 00:07                3579
function.fann-num-output-train-data.php            29-May-2024 00:07                3577
function.fann-print-error.php                      29-May-2024 00:07                2903
function.fann-randomize-weights.php                29-May-2024 00:07                3996
function.fann-read-train-from-file.php             29-May-2024 00:07                5023
function.fann-reset-errno.php                      29-May-2024 00:07                3079
function.fann-reset-errstr.php                     29-May-2024 00:07                3060
function.fann-reset-mse.php                        29-May-2024 00:07                3483
function.fann-run.php                              29-May-2024 00:07                2929
function.fann-save-train.php                       29-May-2024 00:07                3548
function.fann-save.php                             29-May-2024 00:07                4359
function.fann-scale-input-train-data.php           29-May-2024 00:07                4175
function.fann-scale-input.php                      29-May-2024 00:07                3820
function.fann-scale-output-train-data.php          29-May-2024 00:07                4203
function.fann-scale-output.php                     29-May-2024 00:07                3824
function.fann-scale-train-data.php                 29-May-2024 00:07                4173
function.fann-scale-train.php                      29-May-2024 00:07                3766
function.fann-set-activation-function-hidden.php   29-May-2024 00:07                4515
function.fann-set-activation-function-layer.php    29-May-2024 00:07                5029
function.fann-set-activation-function-output.php   29-May-2024 00:07                4531
function.fann-set-activation-function.php          29-May-2024 00:07                6506
function.fann-set-activation-steepness-hidden.php  29-May-2024 00:07                4801
function.fann-set-activation-steepness-layer.php   29-May-2024 00:07                5266
function.fann-set-activation-steepness-output.php  29-May-2024 00:07                4782
function.fann-set-activation-steepness.php         29-May-2024 00:07                6162
function.fann-set-bit-fail-limit.php               29-May-2024 00:07                3504
function.fann-set-callback.php                     29-May-2024 00:07                5677
function.fann-set-cascade-activation-functions.php 29-May-2024 00:07                4160
function.fann-set-cascade-activation-steepnesse..> 29-May-2024 00:07                4373
function.fann-set-cascade-candidate-change-frac..> 29-May-2024 00:07                3855
function.fann-set-cascade-candidate-limit.php      29-May-2024 00:07                3662
function.fann-set-cascade-candidate-stagnation-..> 29-May-2024 00:07                3917
function.fann-set-cascade-max-cand-epochs.php      29-May-2024 00:07                3663
function.fann-set-cascade-max-out-epochs.php       29-May-2024 00:07                3614
function.fann-set-cascade-min-cand-epochs.php      29-May-2024 00:07                3968
function.fann-set-cascade-min-out-epochs.php       29-May-2024 00:07                3950
function.fann-set-cascade-num-candidate-groups.php 29-May-2024 00:07                3748
function.fann-set-cascade-output-change-fractio..> 29-May-2024 00:07                3812
function.fann-set-cascade-output-stagnation-epo..> 29-May-2024 00:07                3878
function.fann-set-cascade-weight-multiplier.php    29-May-2024 00:07                3647
function.fann-set-error-log.php                    29-May-2024 00:07                2919
function.fann-set-input-scaling-params.php         29-May-2024 00:07                4526
function.fann-set-learning-momentum.php            29-May-2024 00:07                3888
function.fann-set-learning-rate.php                29-May-2024 00:07                3814
function.fann-set-output-scaling-params.php        29-May-2024 00:07                4546
function.fann-set-quickprop-decay.php              29-May-2024 00:07                3575
function.fann-set-quickprop-mu.php                 29-May-2024 00:07                3430
function.fann-set-rprop-decrease-factor.php        29-May-2024 00:07                3632
function.fann-set-rprop-delta-max.php              29-May-2024 00:07                3744
function.fann-set-rprop-delta-min.php              29-May-2024 00:07                3550
function.fann-set-rprop-delta-zero.php             29-May-2024 00:07                3932
function.fann-set-rprop-increase-factor.php        29-May-2024 00:07                3658
function.fann-set-sarprop-step-error-shift.php     29-May-2024 00:07                4018
function.fann-set-sarprop-step-error-threshold-..> 29-May-2024 00:07                4212
function.fann-set-sarprop-temperature.php          29-May-2024 00:07                3929
function.fann-set-sarprop-weight-decay-shift.php   29-May-2024 00:07                4012
function.fann-set-scaling-params.php               29-May-2024 00:07                5563
function.fann-set-train-error-function.php         29-May-2024 00:07                3844
function.fann-set-train-stop-function.php          29-May-2024 00:07                3832
function.fann-set-training-algorithm.php           29-May-2024 00:07                3780
function.fann-set-weight-array.php                 29-May-2024 00:07                3283
function.fann-set-weight.php                       29-May-2024 00:07                3731
function.fann-shuffle-train-data.php               29-May-2024 00:07                2896
function.fann-subset-train-data.php                29-May-2024 00:07                4252
function.fann-test-data.php                        29-May-2024 00:07                4159
function.fann-test.php                             29-May-2024 00:07                4539
function.fann-train-epoch.php                      29-May-2024 00:07                4533
function.fann-train-on-data.php                    29-May-2024 00:07                6473
function.fann-train-on-file.php                    29-May-2024 00:07                6488
function.fann-train.php                            29-May-2024 00:07                4615
function.fastcgi-finish-request.php                29-May-2024 00:07                2654
function.fbird-add-user.php                        29-May-2024 00:07                2368
function.fbird-affected-rows.php                   29-May-2024 00:07                2381
function.fbird-backup.php                          29-May-2024 00:07                1797
function.fbird-blob-add.php                        29-May-2024 00:07                2697
function.fbird-blob-cancel.php                     29-May-2024 00:07                3751
function.fbird-blob-close.php                      29-May-2024 00:07                2728
function.fbird-blob-create.php                     29-May-2024 00:07                2728
function.fbird-blob-echo.php                       29-May-2024 00:07                2531
function.fbird-blob-get.php                        29-May-2024 00:07                2524
function.fbird-blob-import.php                     29-May-2024 00:07                2724
function.fbird-blob-info.php                       29-May-2024 00:07                1829
function.fbird-blob-open.php                       29-May-2024 00:07                2521
function.fbird-close.php                           29-May-2024 00:07                2304
function.fbird-commit-ret.php                      29-May-2024 00:07                1822
function.fbird-commit.php                          29-May-2024 00:07                1790
function.fbird-connect.php                         29-May-2024 00:07                2310
function.fbird-db-info.php                         29-May-2024 00:07                1803
function.fbird-delete-user.php                     29-May-2024 00:07                2378
function.fbird-drop-db.php                         29-May-2024 00:07                2326
function.fbird-errcode.php                         29-May-2024 00:07                2146
function.fbird-errmsg.php                          29-May-2024 00:07                2139
function.fbird-execute.php                         29-May-2024 00:07                2151
function.fbird-fetch-assoc.php                     29-May-2024 00:07                2394
function.fbird-fetch-object.php                    29-May-2024 00:07                2405
function.fbird-fetch-row.php                       29-May-2024 00:07                2382
function.fbird-field-info.php                      29-May-2024 00:07                2221
function.fbird-free-event-handler.php              29-May-2024 00:07                2325
function.fbird-free-query.php                      29-May-2024 00:07                1858
function.fbird-free-result.php                     29-May-2024 00:07                1843
function.fbird-gen-id.php                          29-May-2024 00:07                1800
function.fbird-maintain-db.php                     29-May-2024 00:07                1845
function.fbird-modify-user.php                     29-May-2024 00:07                2394
function.fbird-name-result.php                     29-May-2024 00:07                2377
function.fbird-num-fields.php                      29-May-2024 00:07                2210
function.fbird-num-params.php                      29-May-2024 00:07                2372
function.fbird-param-info.php                      29-May-2024 00:07                2377
function.fbird-pconnect.php                        29-May-2024 00:07                2327
function.fbird-prepare.php                         29-May-2024 00:07                1793
function.fbird-query.php                           29-May-2024 00:07                2649
function.fbird-restore.php                         29-May-2024 00:07                1800
function.fbird-rollback-ret.php                    29-May-2024 00:07                1852
function.fbird-rollback.php                        29-May-2024 00:07                1824
function.fbird-server-info.php                     29-May-2024 00:07                1855
function.fbird-service-attach.php                  29-May-2024 00:07                1894
function.fbird-service-detach.php                  29-May-2024 00:07                1906
function.fbird-set-event-handler.php               29-May-2024 00:07                2487
function.fbird-trans.php                           29-May-2024 00:07                1799
function.fbird-wait-event.php                      29-May-2024 00:07                2412
function.fclose.php                                29-May-2024 00:07                4599
function.fdatasync.php                             29-May-2024 00:07                6101
function.fdf-add-doc-javascript.php                29-May-2024 00:07                5575
function.fdf-add-template.php                      29-May-2024 00:07                2930
function.fdf-close.php                             29-May-2024 00:07                3119
function.fdf-create.php                            29-May-2024 00:07                5629
function.fdf-enum-values.php                       29-May-2024 00:07                2503
function.fdf-errno.php                             29-May-2024 00:07                2808
function.fdf-error.php                             29-May-2024 00:07                3243
function.fdf-get-ap.php                            29-May-2024 00:07                4463
function.fdf-get-attachment.php                    29-May-2024 00:07                6120
function.fdf-get-encoding.php                      29-May-2024 00:07                3425
function.fdf-get-file.php                          29-May-2024 00:07                3245
function.fdf-get-flags.php                         29-May-2024 00:07                2423
function.fdf-get-opt.php                           29-May-2024 00:07                2462
function.fdf-get-status.php                        29-May-2024 00:07                3264
function.fdf-get-value.php                         29-May-2024 00:07                4568
function.fdf-get-version.php                       29-May-2024 00:07                3624
function.fdf-header.php                            29-May-2024 00:07                2371
function.fdf-next-field-name.php                   29-May-2024 00:07                5417
function.fdf-open-string.php                       29-May-2024 00:07                4873
function.fdf-open.php                              29-May-2024 00:07                5884
function.fdf-remove-item.php                       29-May-2024 00:07                2436
function.fdf-save-string.php                       29-May-2024 00:07                5650
function.fdf-save.php                              29-May-2024 00:07                4140
function.fdf-set-ap.php                            29-May-2024 00:07                4690
function.fdf-set-encoding.php                      29-May-2024 00:07                3818
function.fdf-set-file.php                          29-May-2024 00:07                6758
function.fdf-set-flags.php                         29-May-2024 00:07                4446
function.fdf-set-javascript-action.php             29-May-2024 00:07                4643
function.fdf-set-on-import-javascript.php          29-May-2024 00:07                3218
function.fdf-set-opt.php                           29-May-2024 00:07                4729
function.fdf-set-status.php                        29-May-2024 00:07                3859
function.fdf-set-submit-form-action.php            29-May-2024 00:07                4942
function.fdf-set-target-frame.php                  29-May-2024 00:07                3859
function.fdf-set-value.php                         29-May-2024 00:07                5301
function.fdf-set-version.php                       29-May-2024 00:07                4083
function.fdiv.php                                  29-May-2024 00:07                6398
function.feof.php                                  29-May-2024 00:07                5754
function.fflush.php                                29-May-2024 00:07                5730
function.fgetc.php                                 29-May-2024 00:07                6772
function.fgetcsv.php                               29-May-2024 00:07               12942
function.fgets.php                                 29-May-2024 00:07                8728
function.fgetss.php                                29-May-2024 00:07                9730
function.file-exists.php                           29-May-2024 00:07                7340
function.file-get-contents.php                     29-May-2024 00:07               18810
function.file-put-contents.php                     29-May-2024 00:07               13199
function.file.php                                  29-May-2024 00:07               12332
function.fileatime.php                             29-May-2024 00:07                7067
function.filectime.php                             29-May-2024 00:07                7171
function.filegroup.php                             29-May-2024 00:07                5761
function.fileinode.php                             29-May-2024 00:07                5510
function.filemtime.php                             29-May-2024 00:07                6854
function.fileowner.php                             29-May-2024 00:07                5734
function.fileperms.php                             29-May-2024 00:07               16452
function.filesize.php                              29-May-2024 00:07                5968
function.filetype.php                              29-May-2024 00:07                6859
function.filter-has-var.php                        29-May-2024 00:07                3457
function.filter-id.php                             29-May-2024 00:07                3016
function.filter-input-array.php                    29-May-2024 00:07               13254
function.filter-input.php                          29-May-2024 00:07                8497
function.filter-list.php                           29-May-2024 00:07                3714
function.filter-var-array.php                      29-May-2024 00:07               12133
function.filter-var.php                            29-May-2024 00:07               14232
function.finfo-buffer.php                          29-May-2024 00:07                8716
function.finfo-close.php                           29-May-2024 00:07                3596
function.finfo-file.php                            29-May-2024 00:07                9166
function.finfo-open.php                            29-May-2024 00:07               10401
function.finfo-set-flags.php                       29-May-2024 00:07                4796
function.floatval.php                              29-May-2024 00:07                7093
function.flock.php                                 29-May-2024 00:07               13464
function.floor.php                                 29-May-2024 00:07                4984
function.flush.php                                 29-May-2024 00:07                4880
function.fmod.php                                  29-May-2024 00:07                5048
function.fnmatch.php                               29-May-2024 00:07                9339
function.fopen.php                                 29-May-2024 00:07               23876
function.forward-static-call-array.php             29-May-2024 00:07                9703
function.forward-static-call.php                   29-May-2024 00:07                9107
function.fpassthru.php                             29-May-2024 00:07                7353
function.fpm-get-status.php                        29-May-2024 00:07                2841
function.fprintf.php                               29-May-2024 00:07               23137
function.fputcsv.php                               29-May-2024 00:07               10638
function.fputs.php                                 29-May-2024 00:07                1702
function.fread.php                                 29-May-2024 00:07               14765
function.frenchtojd.php                            29-May-2024 00:07                4231
function.fscanf.php                                29-May-2024 00:07                9491
function.fseek.php                                 29-May-2024 00:07                8186
function.fsockopen.php                             29-May-2024 00:07               17452
function.fstat.php                                 29-May-2024 00:07                6100
function.fsync.php                                 29-May-2024 00:07                5863
function.ftell.php                                 29-May-2024 00:07                6339
function.ftok.php                                  29-May-2024 00:07                3691
function.ftp-alloc.php                             29-May-2024 00:07                8346
function.ftp-append.php                            29-May-2024 00:07                4571
function.ftp-cdup.php                              29-May-2024 00:07                6673
function.ftp-chdir.php                             29-May-2024 00:07                7601
function.ftp-chmod.php                             29-May-2024 00:07                7237
function.ftp-close.php                             29-May-2024 00:07                6055
function.ftp-connect.php                           29-May-2024 00:07                6731
function.ftp-delete.php                            29-May-2024 00:07                6311
function.ftp-exec.php                              29-May-2024 00:07                6784
function.ftp-fget.php                              29-May-2024 00:07                9971
function.ftp-fput.php                              29-May-2024 00:07                9621
function.ftp-get-option.php                        29-May-2024 00:07                6381
function.ftp-get.php                               29-May-2024 00:07                9239
function.ftp-login.php                             29-May-2024 00:07                6888
function.ftp-mdtm.php                              29-May-2024 00:07                7181
function.ftp-mkdir.php                             29-May-2024 00:07                6919
function.ftp-mlsd.php                              29-May-2024 00:07                9233
function.ftp-nb-continue.php                       29-May-2024 00:07                5576
function.ftp-nb-fget.php                           29-May-2024 00:07               10548
function.ftp-nb-fput.php                           29-May-2024 00:07               10462
function.ftp-nb-get.php                            29-May-2024 00:07               14522
function.ftp-nb-put.php                            29-May-2024 00:07               11756
function.ftp-nlist.php                             29-May-2024 00:07                7198
function.ftp-pasv.php                              29-May-2024 00:07                7705
function.ftp-put.php                               29-May-2024 00:07                9415
function.ftp-pwd.php                               29-May-2024 00:07                6299
function.ftp-quit.php                              29-May-2024 00:07                1711
function.ftp-raw.php                               29-May-2024 00:07                5644
function.ftp-rawlist.php                           29-May-2024 00:07                8606
function.ftp-rename.php                            29-May-2024 00:07                7271
function.ftp-rmdir.php                             29-May-2024 00:07                6581
function.ftp-set-option.php                        29-May-2024 00:07                7406
function.ftp-site.php                              29-May-2024 00:07                6792
function.ftp-size.php                              29-May-2024 00:07                6928
function.ftp-ssl-connect.php                       29-May-2024 00:07                8960
function.ftp-systype.php                           29-May-2024 00:07                5608
function.ftruncate.php                             29-May-2024 00:07                6622
function.func-get-arg.php                          29-May-2024 00:07               11808
function.func-get-args.php                         29-May-2024 00:07               12453
function.func-num-args.php                         29-May-2024 00:07                6406
function.function-exists.php                       29-May-2024 00:07                6156
function.fwrite.php                                29-May-2024 00:07               14638
function.gc-collect-cycles.php                     29-May-2024 00:07                2747
function.gc-disable.php                            29-May-2024 00:07                2642
function.gc-enable.php                             29-May-2024 00:07                2615
function.gc-enabled.php                            29-May-2024 00:07                3481
function.gc-mem-caches.php                         29-May-2024 00:07                2581
function.gc-status.php                             29-May-2024 00:07                5906
function.gd-info.php                               29-May-2024 00:07               10034
function.geoip-asnum-by-name.php                   29-May-2024 00:07                4271
function.geoip-continent-code-by-name.php          29-May-2024 00:07                5784
function.geoip-country-code-by-name.php            29-May-2024 00:07                5505
function.geoip-country-code3-by-name.php           29-May-2024 00:07                5070
function.geoip-country-name-by-name.php            29-May-2024 00:07                5034
function.geoip-database-info.php                   29-May-2024 00:07                4352
function.geoip-db-avail.php                        29-May-2024 00:07                4568
function.geoip-db-filename.php                     29-May-2024 00:07                4228
function.geoip-db-get-all-info.php                 29-May-2024 00:07                6809
function.geoip-domain-by-name.php                  29-May-2024 00:07                4503
function.geoip-id-by-name.php                      29-May-2024 00:07                5575
function.geoip-isp-by-name.php                     29-May-2024 00:07                4507
function.geoip-netspeedcell-by-name.php            29-May-2024 00:07                5245
function.geoip-org-by-name.php                     29-May-2024 00:07                4526
function.geoip-record-by-name.php                  29-May-2024 00:07                7852
function.geoip-region-by-name.php                  29-May-2024 00:07                5187
function.geoip-region-name-by-code.php             29-May-2024 00:07                7236
function.geoip-setup-custom-directory.php          29-May-2024 00:07                4268
function.geoip-time-zone-by-country-and-region.php 29-May-2024 00:07                7446
function.get-browser.php                           29-May-2024 00:07                8748
function.get-called-class.php                      29-May-2024 00:07                6373
function.get-cfg-var.php                           29-May-2024 00:07                4016
function.get-class-methods.php                     29-May-2024 00:07                7082
function.get-class-vars.php                        29-May-2024 00:07                9853
function.get-class.php                             29-May-2024 00:07               13638
function.get-current-user.php                      29-May-2024 00:07                4549
function.get-debug-type.php                        29-May-2024 00:07                9691
function.get-declared-classes.php                  29-May-2024 00:07                5429
function.get-declared-interfaces.php               29-May-2024 00:07                4366
function.get-declared-traits.php                   29-May-2024 00:07                2974
function.get-defined-constants.php                 29-May-2024 00:07                7764
function.get-defined-functions.php                 29-May-2024 00:07                7399
function.get-defined-vars.php                      29-May-2024 00:07                6362
function.get-extension-funcs.php                   29-May-2024 00:07                5773
function.get-headers.php                           29-May-2024 00:07                9610
function.get-html-translation-table.php            29-May-2024 00:07               14719
function.get-include-path.php                      29-May-2024 00:07                4541
function.get-included-files.php                    29-May-2024 00:07                5957
function.get-loaded-extensions.php                 29-May-2024 00:07                5322
function.get-magic-quotes-gpc.php                  29-May-2024 00:07                4073
function.get-magic-quotes-runtime.php              29-May-2024 00:07                3799
function.get-mangled-object-vars.php               29-May-2024 00:07                8177
function.get-meta-tags.php                         29-May-2024 00:07                8336
function.get-object-vars.php                       29-May-2024 00:07                6259
function.get-parent-class.php                      29-May-2024 00:07                7835
function.get-required-files.php                    29-May-2024 00:07                1887
function.get-resource-id.php                       29-May-2024 00:07                5035
function.get-resource-type.php                     29-May-2024 00:07                5387
function.get-resources.php                         29-May-2024 00:07                7991
function.getallheaders.php                         29-May-2024 00:07                5026
function.getcwd.php                                29-May-2024 00:07                5465
function.getdate.php                               29-May-2024 00:07                9920
function.getenv.php                                29-May-2024 00:07                8752
function.gethostbyaddr.php                         29-May-2024 00:07                4401
function.gethostbyname.php                         29-May-2024 00:07                4590
function.gethostbynamel.php                        29-May-2024 00:07                5160
function.gethostname.php                           29-May-2024 00:07                4096
function.getimagesize.php                          29-May-2024 00:07               17640
function.getimagesizefromstring.php                29-May-2024 00:07                5726
function.getlastmod.php                            29-May-2024 00:07                6373
function.getmxrr.php                               29-May-2024 00:07                6119
function.getmygid.php                              29-May-2024 00:07                3687
function.getmyinode.php                            29-May-2024 00:07                3730
function.getmypid.php                              29-May-2024 00:07                3973
function.getmyuid.php                              29-May-2024 00:07                3677
function.getopt.php                                29-May-2024 00:07               15782
function.getprotobyname.php                        29-May-2024 00:07                4788
function.getprotobynumber.php                      29-May-2024 00:07                3415
function.getrandmax.php                            29-May-2024 00:07                3046
function.getrusage.php                             29-May-2024 00:07               11394
function.getservbyname.php                         29-May-2024 00:07                6532
function.getservbyport.php                         29-May-2024 00:07                3927
function.gettext.php                               29-May-2024 00:07                5879
function.gettimeofday.php                          29-May-2024 00:07                5170
function.gettype.php                               29-May-2024 00:07                9016
function.glob.php                                  29-May-2024 00:07               10370
function.gmdate.php                                29-May-2024 00:07                8022
function.gmmktime.php                              29-May-2024 00:07               11723
function.gmp-abs.php                               29-May-2024 00:07                4436
function.gmp-add.php                               29-May-2024 00:07                4691
function.gmp-and.php                               29-May-2024 00:07                5142
function.gmp-binomial.php                          29-May-2024 00:07                4005
function.gmp-clrbit.php                            29-May-2024 00:07                5531
function.gmp-cmp.php                               29-May-2024 00:07                5554
function.gmp-com.php                               29-May-2024 00:07                3927
function.gmp-div-q.php                             29-May-2024 00:07                9982
function.gmp-div-qr.php                            29-May-2024 00:07                6690
function.gmp-div-r.php                             29-May-2024 00:07                6081
function.gmp-div.php                               29-May-2024 00:07                1719
function.gmp-divexact.php                          29-May-2024 00:07                5784
function.gmp-export.php                            29-May-2024 00:07                5743
function.gmp-fact.php                              29-May-2024 00:07                4799
function.gmp-gcd.php                               29-May-2024 00:07                5079
function.gmp-gcdext.php                            29-May-2024 00:07                9243
function.gmp-hamdist.php                           29-May-2024 00:07                6430
function.gmp-import.php                            29-May-2024 00:07                6062
function.gmp-init.php                              29-May-2024 00:07                5684
function.gmp-intval.php                            29-May-2024 00:07                5290
function.gmp-invert.php                            29-May-2024 00:07                5276
function.gmp-jacobi.php                            29-May-2024 00:07                5593
function.gmp-kronecker.php                         29-May-2024 00:07                3924
function.gmp-lcm.php                               29-May-2024 00:07                3695
function.gmp-legendre.php                          29-May-2024 00:07                5612
function.gmp-mod.php                               29-May-2024 00:07                4816
function.gmp-mul.php                               29-May-2024 00:07                4898
function.gmp-neg.php                               29-May-2024 00:07                4383
function.gmp-nextprime.php                         29-May-2024 00:07                5039
function.gmp-or.php                                29-May-2024 00:07                5357
function.gmp-perfect-power.php                     29-May-2024 00:07                3354
function.gmp-perfect-square.php                    29-May-2024 00:07                5595
function.gmp-popcount.php                          29-May-2024 00:07                4878
function.gmp-pow.php                               29-May-2024 00:07                5736
function.gmp-powm.php                              29-May-2024 00:07                5690
function.gmp-prob-prime.php                        29-May-2024 00:07                5693
function.gmp-random-bits.php                       29-May-2024 00:07                6076
function.gmp-random-range.php                      29-May-2024 00:07                7441
function.gmp-random-seed.php                       29-May-2024 00:07                7525
function.gmp-random.php                            29-May-2024 00:07                6367
function.gmp-root.php                              29-May-2024 00:07                3188
function.gmp-rootrem.php                           29-May-2024 00:07                3354
function.gmp-scan0.php                             29-May-2024 00:07                5543
function.gmp-scan1.php                             29-May-2024 00:07                5555
function.gmp-setbit.php                            29-May-2024 00:07               11651
function.gmp-sign.php                              29-May-2024 00:07                5198
function.gmp-sqrt.php                              29-May-2024 00:07                4955
function.gmp-sqrtrem.php                           29-May-2024 00:07                6335
function.gmp-strval.php                            29-May-2024 00:07                4716
function.gmp-sub.php                               29-May-2024 00:07                4970
function.gmp-testbit.php                           29-May-2024 00:07                6003
function.gmp-xor.php                               29-May-2024 00:07                5363
function.gmstrftime.php                            29-May-2024 00:07                9365
function.gnupg-adddecryptkey.php                   29-May-2024 00:07                5431
function.gnupg-addencryptkey.php                   29-May-2024 00:07                4975
function.gnupg-addsignkey.php                      29-May-2024 00:07                5448
function.gnupg-cleardecryptkeys.php                29-May-2024 00:07                4518
function.gnupg-clearencryptkeys.php                29-May-2024 00:07                4523
function.gnupg-clearsignkeys.php                   29-May-2024 00:07                4465
function.gnupg-decrypt.php                         29-May-2024 00:07                6177
function.gnupg-decryptverify.php                   29-May-2024 00:07                7329
function.gnupg-deletekey.php                       29-May-2024 00:07                5261
function.gnupg-encrypt.php                         29-May-2024 00:07                6080
function.gnupg-encryptsign.php                     29-May-2024 00:07                6980
function.gnupg-export.php                          29-May-2024 00:07                5279
function.gnupg-getengineinfo.php                   29-May-2024 00:07                5651
function.gnupg-geterror.php                        29-May-2024 00:07                4431
function.gnupg-geterrorinfo.php                    29-May-2024 00:07                5754
function.gnupg-getprotocol.php                     29-May-2024 00:07                4519
function.gnupg-gettrustlist.php                    29-May-2024 00:07                5341
function.gnupg-import.php                          29-May-2024 00:07                5538
function.gnupg-init.php                            29-May-2024 00:07                7307
function.gnupg-keyinfo.php                         29-May-2024 00:07                5465
function.gnupg-listsignatures.php                  29-May-2024 00:07                5565
function.gnupg-setarmor.php                        29-May-2024 00:07                5734
function.gnupg-seterrormode.php                    29-May-2024 00:07                5781
function.gnupg-setsignmode.php                     29-May-2024 00:07                5869
function.gnupg-sign.php                            29-May-2024 00:07                6322
function.gnupg-verify.php                          29-May-2024 00:07                8570
function.grapheme-extract.php                      29-May-2024 00:07                8927
function.grapheme-stripos.php                      29-May-2024 00:07                8425
function.grapheme-stristr.php                      29-May-2024 00:07                7846
function.grapheme-strlen.php                       29-May-2024 00:07                5724
function.grapheme-strpos.php                       29-May-2024 00:07                8119
function.grapheme-strripos.php                     29-May-2024 00:07                7770
function.grapheme-strrpos.php                      29-May-2024 00:07                7464
function.grapheme-strstr.php                       29-May-2024 00:07                7565
function.grapheme-substr.php                       29-May-2024 00:07                8667
function.gregoriantojd.php                         29-May-2024 00:07                7771
function.gzclose.php                               29-May-2024 00:07                4424
function.gzcompress.php                            29-May-2024 00:07                6421
function.gzdecode.php                              29-May-2024 00:07                3903
function.gzdeflate.php                             29-May-2024 00:07                6049
function.gzencode.php                              29-May-2024 00:07                7433
function.gzeof.php                                 29-May-2024 00:07                4284
function.gzfile.php                                29-May-2024 00:07                5008
function.gzgetc.php                                29-May-2024 00:07                4898
function.gzgets.php                                29-May-2024 00:07                6570
function.gzgetss.php                               29-May-2024 00:07                6315
function.gzinflate.php                             29-May-2024 00:07                5680
function.gzopen.php                                29-May-2024 00:07                6160
function.gzpassthru.php                            29-May-2024 00:07                4850
function.gzputs.php                                29-May-2024 00:07                1693
function.gzread.php                                29-May-2024 00:07                6365
function.gzrewind.php                              29-May-2024 00:07                3452
function.gzseek.php                                29-May-2024 00:07                6640
function.gztell.php                                29-May-2024 00:07                3643
function.gzuncompress.php                          29-May-2024 00:07                5645
function.gzwrite.php                               29-May-2024 00:07                6968
function.halt-compiler.php                         29-May-2024 00:07                4738
function.hash-algos.php                            29-May-2024 00:07                6004
function.hash-copy.php                             29-May-2024 00:07                5833
function.hash-equals.php                           29-May-2024 00:07                7114
function.hash-file.php                             29-May-2024 00:07                8029
function.hash-final.php                            29-May-2024 00:07                4381
function.hash-hkdf.php                             29-May-2024 00:07                9956
function.hash-hmac-algos.php                       29-May-2024 00:07                5473
function.hash-hmac-file.php                        29-May-2024 00:07                9048
function.hash-hmac.php                             29-May-2024 00:07                8398
function.hash-init.php                             29-May-2024 00:07               11068
function.hash-pbkdf2.php                           29-May-2024 00:07               12020
function.hash-update-file.php                      29-May-2024 00:07                6324
function.hash-update-stream.php                    29-May-2024 00:07                7765
function.hash-update.php                           29-May-2024 00:07                4751
function.hash.php                                  29-May-2024 00:07                7659
function.header-register-callback.php              29-May-2024 00:07                7054
function.header-remove.php                         29-May-2024 00:07                7160
function.header.php                                29-May-2024 00:07               18934
function.headers-list.php                          29-May-2024 00:07                6290
function.headers-sent.php                          29-May-2024 00:07                8576
function.hebrev.php                                29-May-2024 00:07                3483
function.hebrevc.php                               29-May-2024 00:07                3903
function.hex2bin.php                               29-May-2024 00:07                5114
function.hexdec.php                                29-May-2024 00:07                6500
function.highlight-file.php                        29-May-2024 00:07                5805
function.highlight-string.php                      29-May-2024 00:07                6147
function.hrtime.php                                29-May-2024 00:07                5760
function.html-entity-decode.php                    29-May-2024 00:07               12126
function.htmlentities.php                          29-May-2024 00:07               15442
function.htmlspecialchars-decode.php               29-May-2024 00:07               10030
function.htmlspecialchars.php                      29-May-2024 00:07               23639
function.http-build-query.php                      29-May-2024 00:07               20050
function.http-response-code.php                    29-May-2024 00:07                6969
function.hypot.php                                 29-May-2024 00:07                3102
function.ibase-add-user.php                        29-May-2024 00:07                5227
function.ibase-affected-rows.php                   29-May-2024 00:07                3490
function.ibase-backup.php                          29-May-2024 00:07               10543
function.ibase-blob-add.php                        29-May-2024 00:07                4030
function.ibase-blob-cancel.php                     29-May-2024 00:07                3750
function.ibase-blob-close.php                      29-May-2024 00:07                4012
function.ibase-blob-create.php                     29-May-2024 00:07                4099
function.ibase-blob-echo.php                       29-May-2024 00:07                4277
function.ibase-blob-get.php                        29-May-2024 00:07                6615
function.ibase-blob-import.php                     29-May-2024 00:07                8027
function.ibase-blob-info.php                       29-May-2024 00:07                3550
function.ibase-blob-open.php                       29-May-2024 00:07                4494
function.ibase-close.php                           29-May-2024 00:07                3852
function.ibase-commit-ret.php                      29-May-2024 00:07                3366
function.ibase-commit.php                          29-May-2024 00:07                3167
function.ibase-connect.php                         29-May-2024 00:07               10559
function.ibase-db-info.php                         29-May-2024 00:07                2754
function.ibase-delete-user.php                     29-May-2024 00:07                3643
function.ibase-drop-db.php                         29-May-2024 00:07                3750
function.ibase-errcode.php                         29-May-2024 00:07                2735
function.ibase-errmsg.php                          29-May-2024 00:07                2728
function.ibase-execute.php                         29-May-2024 00:07                7014
function.ibase-fetch-assoc.php                     29-May-2024 00:07                4765
function.ibase-fetch-object.php                    29-May-2024 00:07                6692
function.ibase-fetch-row.php                       29-May-2024 00:07                4582
function.ibase-field-info.php                      29-May-2024 00:07                6988
function.ibase-free-event-handler.php              29-May-2024 00:07                3588
function.ibase-free-query.php                      29-May-2024 00:07                2882
function.ibase-free-result.php                     29-May-2024 00:07                2974
function.ibase-gen-id.php                          29-May-2024 00:07                2872
function.ibase-maintain-db.php                     29-May-2024 00:07                3198
function.ibase-modify-user.php                     29-May-2024 00:07                5232
function.ibase-name-result.php                     29-May-2024 00:07                5865
function.ibase-num-fields.php                      29-May-2024 00:07                6449
function.ibase-num-params.php                      29-May-2024 00:07                3480
function.ibase-param-info.php                      29-May-2024 00:07                3732
function.ibase-pconnect.php                        29-May-2024 00:07                7959
function.ibase-prepare.php                         29-May-2024 00:07                4699
function.ibase-query.php                           29-May-2024 00:07                7270
function.ibase-restore.php                         29-May-2024 00:07               10810
function.ibase-rollback-ret.php                    29-May-2024 00:07                3407
function.ibase-rollback.php                        29-May-2024 00:07                3212
function.ibase-server-info.php                     29-May-2024 00:07                9875
function.ibase-service-attach.php                  29-May-2024 00:07               11087
function.ibase-service-detach.php                  29-May-2024 00:07                6192
function.ibase-set-event-handler.php               29-May-2024 00:07                7922
function.ibase-trans.php                           29-May-2024 00:07                5931
function.ibase-wait-event.php                      29-May-2024 00:07                4381
function.iconv-get-encoding.php                    29-May-2024 00:07                6109
function.iconv-mime-decode-headers.php             29-May-2024 00:07               10711
function.iconv-mime-decode.php                     29-May-2024 00:07                8761
function.iconv-mime-encode.php                     29-May-2024 00:07               11913
function.iconv-set-encoding.php                    29-May-2024 00:07                5108
function.iconv-strlen.php                          29-May-2024 00:07                5199
function.iconv-strpos.php                          29-May-2024 00:07                7430
function.iconv-strrpos.php                         29-May-2024 00:07                6719
function.iconv-substr.php                          29-May-2024 00:07                8165
function.iconv.php                                 29-May-2024 00:07                8959
function.idate.php                                 29-May-2024 00:07               11672
function.idn-to-ascii.php                          29-May-2024 00:07                8166
function.idn-to-utf8.php                           29-May-2024 00:07                8186
function.igbinary-serialize.php                    29-May-2024 00:07               10011
function.igbinary-unserialize.php                  29-May-2024 00:07                9996
function.ignore-user-abort.php                     29-May-2024 00:07                7462
function.image-type-to-extension.php               29-May-2024 00:07                5583
function.image-type-to-mime-type.php               29-May-2024 00:07                9448
function.image2wbmp.php                            29-May-2024 00:07                6813
function.imageaffine.php                           29-May-2024 00:07                5135
function.imageaffinematrixconcat.php               29-May-2024 00:07                6911
function.imageaffinematrixget.php                  29-May-2024 00:07                6953
function.imagealphablending.php                    29-May-2024 00:07                7849
function.imageantialias.php                        29-May-2024 00:07               11402
function.imagearc.php                              29-May-2024 00:07               14019
function.imageavif.php                             29-May-2024 00:07                6331
function.imagebmp.php                              29-May-2024 00:07                8428
function.imagechar.php                             29-May-2024 00:07               10385
function.imagecharup.php                           29-May-2024 00:07               10475
function.imagecolorallocate.php                    29-May-2024 00:07               10353
function.imagecolorallocatealpha.php               29-May-2024 00:07               18558
function.imagecolorat.php                          29-May-2024 00:07                9978
function.imagecolorclosest.php                     29-May-2024 00:07               12620
function.imagecolorclosestalpha.php                29-May-2024 00:07               12526
function.imagecolorclosesthwb.php                  29-May-2024 00:07                6916
function.imagecolordeallocate.php                  29-May-2024 00:07                6197
function.imagecolorexact.php                       29-May-2024 00:07                8787
function.imagecolorexactalpha.php                  29-May-2024 00:07                9650
function.imagecolormatch.php                       29-May-2024 00:07                8722
function.imagecolorresolve.php                     29-May-2024 00:07                8132
function.imagecolorresolvealpha.php                29-May-2024 00:07                8637
function.imagecolorset.php                         29-May-2024 00:07                9081
function.imagecolorsforindex.php                   29-May-2024 00:07                7782
function.imagecolorstotal.php                      29-May-2024 00:07                6131
function.imagecolortransparent.php                 29-May-2024 00:07                9344
function.imageconvolution.php                      29-May-2024 00:07               12135
function.imagecopy.php                             29-May-2024 00:07                9559
function.imagecopymerge.php                        29-May-2024 00:07                9815
function.imagecopymergegray.php                    29-May-2024 00:07               10205
function.imagecopyresampled.php                    29-May-2024 00:07               19702
function.imagecopyresized.php                      29-May-2024 00:07               14639
function.imagecreate.php                           29-May-2024 00:07                8655
function.imagecreatefromavif.php                   29-May-2024 00:07                2993
function.imagecreatefrombmp.php                    29-May-2024 00:07                5780
function.imagecreatefromgd.php                     29-May-2024 00:07                6500
function.imagecreatefromgd2.php                    29-May-2024 00:07                6701
function.imagecreatefromgd2part.php                29-May-2024 00:07                9211
function.imagecreatefromgif.php                    29-May-2024 00:07                9986
function.imagecreatefromjpeg.php                   29-May-2024 00:07                9631
function.imagecreatefrompng.php                    29-May-2024 00:07                9606
function.imagecreatefromstring.php                 29-May-2024 00:07                8344
function.imagecreatefromtga.php                    29-May-2024 00:07                3648
function.imagecreatefromwbmp.php                   29-May-2024 00:07                9672
function.imagecreatefromwebp.php                   29-May-2024 00:07                5953
function.imagecreatefromxbm.php                    29-May-2024 00:07                5757
function.imagecreatefromxpm.php                    29-May-2024 00:07                6422
function.imagecreatetruecolor.php                  29-May-2024 00:07                7491
function.imagecrop.php                             29-May-2024 00:07                8267
function.imagecropauto.php                         29-May-2024 00:07               11238
function.imagedashedline.php                       29-May-2024 00:07               13075
function.imagedestroy.php                          29-May-2024 00:07                5449
function.imageellipse.php                          29-May-2024 00:07               10455
function.imagefill.php                             29-May-2024 00:07                7935
function.imagefilledarc.php                        29-May-2024 00:07               19348
function.imagefilledellipse.php                    29-May-2024 00:07               10166
function.imagefilledpolygon.php                    29-May-2024 00:07               12665
function.imagefilledrectangle.php                  29-May-2024 00:07                8732
function.imagefilltoborder.php                     29-May-2024 00:07               11722
function.imagefilter.php                           29-May-2024 00:07               34948
function.imageflip.php                             29-May-2024 00:07               10217
function.imagefontheight.php                       29-May-2024 00:07                6926
function.imagefontwidth.php                        29-May-2024 00:07                6925
function.imageftbbox.php                           29-May-2024 00:07               14306
function.imagefttext.php                           29-May-2024 00:07               16201
function.imagegammacorrect.php                     29-May-2024 00:07                6294
function.imagegd.php                               29-May-2024 00:07               11353
function.imagegd2.php                              29-May-2024 00:07               12545
function.imagegetclip.php                          29-May-2024 00:07                6236
function.imagegetinterpolation.php                 29-May-2024 00:07                3971
function.imagegif.php                              29-May-2024 00:07               17159
function.imagegrabscreen.php                       29-May-2024 00:07                4968
function.imagegrabwindow.php                       29-May-2024 00:07               10218
function.imageinterlace.php                        29-May-2024 00:07                7298
function.imageistruecolor.php                      29-May-2024 00:07                7779
function.imagejpeg.php                             29-May-2024 00:07               15602
function.imagelayereffect.php                      29-May-2024 00:07               12389
function.imageline.php                             29-May-2024 00:07               15937
function.imageloadfont.php                         29-May-2024 00:07                9829
function.imageopenpolygon.php                      29-May-2024 00:07               10901
function.imagepalettecopy.php                      29-May-2024 00:07                7581
function.imagepalettetotruecolor.php               29-May-2024 00:07               10195
function.imagepng.php                              29-May-2024 00:07                9532
function.imagepolygon.php                          29-May-2024 00:07               10824
function.imagerectangle.php                        29-May-2024 00:07               10924
function.imageresolution.php                       29-May-2024 00:07                8403
function.imagerotate.php                           29-May-2024 00:07                9436
function.imagesavealpha.php                        29-May-2024 00:07                8146
function.imagescale.php                            29-May-2024 00:07                7295
function.imagesetbrush.php                         29-May-2024 00:07                9639
function.imagesetclip.php                          29-May-2024 00:07                5443
function.imagesetinterpolation.php                 29-May-2024 00:07               11934
function.imagesetpixel.php                         29-May-2024 00:07               11859
function.imagesetstyle.php                         29-May-2024 00:07               12561
function.imagesetthickness.php                     29-May-2024 00:07                8736
function.imagesettile.php                          29-May-2024 00:07                8826
function.imagestring.php                           29-May-2024 00:07               10606
function.imagestringup.php                         29-May-2024 00:07                9692
function.imagesx.php                               29-May-2024 00:07                5462
function.imagesy.php                               29-May-2024 00:07                5446
function.imagetruecolortopalette.php               29-May-2024 00:07                7187
function.imagettfbbox.php                          29-May-2024 00:07               19636
function.imagettftext.php                          29-May-2024 00:07               18490
function.imagetypes.php                            29-May-2024 00:07                5204
function.imagewbmp.php                             29-May-2024 00:07               15744
function.imagewebp.php                             29-May-2024 00:07                7873
function.imagexbm.php                              29-May-2024 00:07               11969
function.imap-8bit.php                             29-May-2024 00:07                3322
function.imap-alerts.php                           29-May-2024 00:07                3288
function.imap-append.php                           29-May-2024 00:07                9853
function.imap-base64.php                           29-May-2024 00:07                3667
function.imap-binary.php                           29-May-2024 00:07                3275
function.imap-body.php                             29-May-2024 00:07                5696
function.imap-bodystruct.php                       29-May-2024 00:07                4907
function.imap-check.php                            29-May-2024 00:07                6212
function.imap-clearflag-full.php                   29-May-2024 00:07                5966
function.imap-close.php                            29-May-2024 00:07                4596
function.imap-create.php                           29-May-2024 00:07                1804
function.imap-createmailbox.php                    29-May-2024 00:07               14214
function.imap-delete.php                           29-May-2024 00:07                9925
function.imap-deletemailbox.php                    29-May-2024 00:07                5118
function.imap-errors.php                           29-May-2024 00:07                3562
function.imap-expunge.php                          29-May-2024 00:07                3778
function.imap-fetch-overview.php                   29-May-2024 00:07               11505
function.imap-fetchbody.php                        29-May-2024 00:07                6584
function.imap-fetchheader.php                      29-May-2024 00:07                6101
function.imap-fetchmime.php                        29-May-2024 00:07                6650
function.imap-fetchstructure.php                   29-May-2024 00:07               10144
function.imap-fetchtext.php                        29-May-2024 00:07                1785
function.imap-gc.php                               29-May-2024 00:07                5400
function.imap-get-quota.php                        29-May-2024 00:07               12440
function.imap-get-quotaroot.php                    29-May-2024 00:07                9407
function.imap-getacl.php                           29-May-2024 00:07                6201
function.imap-getmailboxes.php                     29-May-2024 00:07               12349
function.imap-getsubscribed.php                    29-May-2024 00:07                8023
function.imap-header.php                           29-May-2024 00:07                2003
function.imap-headerinfo.php                       29-May-2024 00:07               14586
function.imap-headers.php                          29-May-2024 00:07                3715
function.imap-is-open.php                          29-May-2024 00:07                4244
function.imap-last-error.php                       29-May-2024 00:07                3138
function.imap-list.php                             29-May-2024 00:07                8764
function.imap-listmailbox.php                      29-May-2024 00:07                1787
function.imap-listscan.php                         29-May-2024 00:07                6977
function.imap-listsubscribed.php                   29-May-2024 00:07                1808
function.imap-lsub.php                             29-May-2024 00:07                6095
function.imap-mail-compose.php                     29-May-2024 00:07               16315
function.imap-mail-copy.php                        29-May-2024 00:07                6586
function.imap-mail-move.php                        29-May-2024 00:07                6850
function.imap-mail.php                             29-May-2024 00:07                7604
function.imap-mailboxmsginfo.php                   29-May-2024 00:07                9374
function.imap-mime-header-decode.php               29-May-2024 00:07                6584
function.imap-msgno.php                            29-May-2024 00:07                4315
function.imap-mutf7-to-utf8.php                    29-May-2024 00:07                3480
function.imap-num-msg.php                          29-May-2024 00:07                4192
function.imap-num-recent.php                       29-May-2024 00:07                3998
function.imap-open.php                             29-May-2024 00:07               23093
function.imap-ping.php                             29-May-2024 00:07                5151
function.imap-qprint.php                           29-May-2024 00:07                3391
function.imap-rename.php                           29-May-2024 00:07                1807
function.imap-renamemailbox.php                    29-May-2024 00:07                5227
function.imap-reopen.php                           29-May-2024 00:07                9102
function.imap-rfc822-parse-adrlist.php             29-May-2024 00:07                8065
function.imap-rfc822-parse-headers.php             29-May-2024 00:07                3838
function.imap-rfc822-write-address.php             29-May-2024 00:07                5626
function.imap-savebody.php                         29-May-2024 00:07                6965
function.imap-scan.php                             29-May-2024 00:07                1772
function.imap-scanmailbox.php                      29-May-2024 00:07                1797
function.imap-search.php                           29-May-2024 00:07               13993
function.imap-set-quota.php                        29-May-2024 00:07                7046
function.imap-setacl.php                           29-May-2024 00:07                5865
function.imap-setflag-full.php                     29-May-2024 00:07                8160
function.imap-sort.php                             29-May-2024 00:07                8944
function.imap-status.php                           29-May-2024 00:07               11044
function.imap-subscribe.php                        29-May-2024 00:07                4724
function.imap-thread.php                           29-May-2024 00:07                8031
function.imap-timeout.php                          29-May-2024 00:07                4865
function.imap-uid.php                              29-May-2024 00:07                4773
function.imap-undelete.php                         29-May-2024 00:07                5069
function.imap-unsubscribe.php                      29-May-2024 00:07                4787
function.imap-utf7-decode.php                      29-May-2024 00:07                3802
function.imap-utf7-encode.php                      29-May-2024 00:07                3496
function.imap-utf8-to-mutf7.php                    29-May-2024 00:07                3492
function.imap-utf8.php                             29-May-2024 00:07                4408
function.implode.php                               29-May-2024 00:07                8089
function.in-array.php                              29-May-2024 00:07               11909
function.include-once.php                          29-May-2024 00:07                2397
function.include.php                               29-May-2024 00:07               20617
function.inet-ntop.php                             29-May-2024 00:07                6429
function.inet-pton.php                             29-May-2024 00:07                4944
function.inflate-add.php                           29-May-2024 00:07                6335
function.inflate-get-read-len.php                  29-May-2024 00:07                3517
function.inflate-get-status.php                    29-May-2024 00:07                3298
function.inflate-init.php                          29-May-2024 00:07                7154
function.ini-alter.php                             29-May-2024 00:07                1743
function.ini-get-all.php                           29-May-2024 00:07               10732
function.ini-get.php                               29-May-2024 00:07               11009
function.ini-parse-quantity.php                    29-May-2024 00:07                7690
function.ini-restore.php                           29-May-2024 00:07                6583
function.ini-set.php                               29-May-2024 00:07                7031
function.inotify-add-watch.php                     29-May-2024 00:07                4524
function.inotify-init.php                          29-May-2024 00:07                9020
function.inotify-queue-len.php                     29-May-2024 00:07                3924
function.inotify-read.php                          29-May-2024 00:07                4522
function.inotify-rm-watch.php                      29-May-2024 00:07                3761
function.intdiv.php                                29-May-2024 00:07                7629
function.interface-exists.php                      29-May-2024 00:07                5547
function.intl-error-name.php                       29-May-2024 00:07                5145
function.intl-get-error-code.php                   29-May-2024 00:07                4745
function.intl-get-error-message.php                29-May-2024 00:07                4779
function.intl-is-failure.php                       29-May-2024 00:07                5814
function.intval.php                                29-May-2024 00:07               13815
function.ip2long.php                               29-May-2024 00:07                9397
function.iptcembed.php                             29-May-2024 00:07               12092
function.iptcparse.php                             29-May-2024 00:07                4808
function.is-a.php                                  29-May-2024 00:07                7228
function.is-array.php                              29-May-2024 00:07                5928
function.is-bool.php                               29-May-2024 00:07                5829
function.is-callable.php                           29-May-2024 00:07               11213
function.is-countable.php                          29-May-2024 00:07                6434
function.is-dir.php                                29-May-2024 00:07                6874
function.is-double.php                             29-May-2024 00:07                1739
function.is-executable.php                         29-May-2024 00:07                6941
function.is-file.php                               29-May-2024 00:07                6295
function.is-finite.php                             29-May-2024 00:07                6254
function.is-float.php                              29-May-2024 00:07                6837
function.is-infinite.php                           29-May-2024 00:07                5444
function.is-int.php                                29-May-2024 00:07                6731
function.is-integer.php                            29-May-2024 00:07                1732
function.is-iterable.php                           29-May-2024 00:07                5879
function.is-link.php                               29-May-2024 00:07                5848
function.is-long.php                               29-May-2024 00:07                1713
function.is-nan.php                                29-May-2024 00:07                6544
function.is-null.php                               29-May-2024 00:07                6281
function.is-numeric.php                            29-May-2024 00:07               12128
function.is-object.php                             29-May-2024 00:07                7410
function.is-readable.php                           29-May-2024 00:07                6532
function.is-real.php                               29-May-2024 00:07                1946
function.is-resource.php                           29-May-2024 00:07                5374
function.is-scalar.php                             29-May-2024 00:07                8649
function.is-soap-fault.php                         29-May-2024 00:07                8190
function.is-string.php                             29-May-2024 00:07                6946
function.is-subclass-of.php                        29-May-2024 00:07               12931
function.is-tainted.php                            29-May-2024 00:07                2417
function.is-uploaded-file.php                      29-May-2024 00:07                7079
function.is-writable.php                           29-May-2024 00:07                6248
function.is-writeable.php                          29-May-2024 00:07                6143
function.isset.php                                 29-May-2024 00:07               15975
function.iterator-apply.php                        29-May-2024 00:07                6858
function.iterator-count.php                        29-May-2024 00:07                8771
function.iterator-to-array.php                     29-May-2024 00:07                8035
function.jddayofweek.php                           29-May-2024 00:07                3931
function.jdmonthname.php                           29-May-2024 00:07                5128
function.jdtofrench.php                            29-May-2024 00:07                3238
function.jdtogregorian.php                         29-May-2024 00:07                3257
function.jdtojewish.php                            29-May-2024 00:07                7680
function.jdtojulian.php                            29-May-2024 00:07                3236
function.jdtounix.php                              29-May-2024 00:07                4529
function.jewishtojd.php                            29-May-2024 00:07                4313
function.join.php                                  29-May-2024 00:07                1686
function.jpeg2wbmp.php                             29-May-2024 00:07                6905
function.json-decode.php                           29-May-2024 00:07               20133
function.json-encode.php                           29-May-2024 00:07               28490
function.json-last-error-msg.php                   29-May-2024 00:07                2989
function.json-last-error.php                       29-May-2024 00:07               13710
function.json-validate.php                         29-May-2024 00:07                8778
function.juliantojd.php                            29-May-2024 00:07                4646
function.key-exists.php                            29-May-2024 00:07                1768
function.key.php                                   29-May-2024 00:07                7803
function.krsort.php                                29-May-2024 00:07                9515
function.ksort.php                                 29-May-2024 00:07               11228
function.lcfirst.php                               29-May-2024 00:07                6275
function.lcg-value.php                             29-May-2024 00:07                5190
function.lchgrp.php                                29-May-2024 00:07                6091
function.lchown.php                                29-May-2024 00:07                5948
function.ldap-8859-to-t61.php                      29-May-2024 00:07                3449
function.ldap-add-ext.php                          29-May-2024 00:07                6004
function.ldap-add.php                              29-May-2024 00:07               10796
function.ldap-bind-ext.php                         29-May-2024 00:07                6251
function.ldap-bind.php                             29-May-2024 00:07                9852
function.ldap-close.php                            29-May-2024 00:07                1741
function.ldap-compare.php                          29-May-2024 00:07               10649
function.ldap-connect-wallet.php                   29-May-2024 00:07                4554
function.ldap-connect.php                          29-May-2024 00:07                9858
function.ldap-control-paged-result-response.php    29-May-2024 00:07                6040
function.ldap-control-paged-result.php             29-May-2024 00:07               14640
function.ldap-count-entries.php                    29-May-2024 00:07                6048
function.ldap-count-references.php                 29-May-2024 00:07                5064
function.ldap-delete-ext.php                       29-May-2024 00:07                5499
function.ldap-delete.php                           29-May-2024 00:07                5670
function.ldap-dn2ufn.php                           29-May-2024 00:07                2823
function.ldap-err2str.php                          29-May-2024 00:07                4698
function.ldap-errno.php                            29-May-2024 00:07                7782
function.ldap-error.php                            29-May-2024 00:07                4772
function.ldap-escape.php                           29-May-2024 00:07                6403
function.ldap-exop-passwd.php                      29-May-2024 00:07               10871
function.ldap-exop-refresh.php                     29-May-2024 00:07                5418
function.ldap-exop-sync.php                        29-May-2024 00:07                5793
function.ldap-exop-whoami.php                      29-May-2024 00:07                4192
function.ldap-exop.php                             29-May-2024 00:07               12745
function.ldap-explode-dn.php                       29-May-2024 00:07                3729
function.ldap-first-attribute.php                  29-May-2024 00:07                5782
function.ldap-first-entry.php                      29-May-2024 00:07                6078
function.ldap-first-reference.php                  29-May-2024 00:07                2400
function.ldap-free-result.php                      29-May-2024 00:07                4253
function.ldap-get-attributes.php                   29-May-2024 00:07                8548
function.ldap-get-dn.php                           29-May-2024 00:07                4633
function.ldap-get-entries.php                      29-May-2024 00:07                6460
function.ldap-get-option.php                       29-May-2024 00:07               16978
function.ldap-get-values-len.php                   29-May-2024 00:07                5841
function.ldap-get-values.php                       29-May-2024 00:07                8952
function.ldap-list.php                             29-May-2024 00:07               15793
function.ldap-mod-add.php                          29-May-2024 00:07                7204
function.ldap-mod-del.php                          29-May-2024 00:07                6718
function.ldap-mod-replace.php                      29-May-2024 00:07                7149
function.ldap-mod_add-ext.php                      29-May-2024 00:07                5968
function.ldap-mod_del-ext.php                      29-May-2024 00:07                5984
function.ldap-mod_replace-ext.php                  29-May-2024 00:07                6046
function.ldap-modify-batch.php                     29-May-2024 00:07               19204
function.ldap-modify.php                           29-May-2024 00:07                2152
function.ldap-next-attribute.php                   29-May-2024 00:07                5561
function.ldap-next-entry.php                       29-May-2024 00:07                6087
function.ldap-next-reference.php                   29-May-2024 00:07                2327
function.ldap-parse-exop.php                       29-May-2024 00:07                6313
function.ldap-parse-reference.php                  29-May-2024 00:07                2469
function.ldap-parse-result.php                     29-May-2024 00:07               10247
function.ldap-read.php                             29-May-2024 00:07               13144
function.ldap-rename-ext.php                       29-May-2024 00:07                6318
function.ldap-rename.php                           29-May-2024 00:07                7571
function.ldap-sasl-bind.php                        29-May-2024 00:07                7329
function.ldap-search.php                           29-May-2024 00:07               16027
function.ldap-set-option.php                       29-May-2024 00:07               19458
function.ldap-set-rebind-proc.php                  29-May-2024 00:07                3368
function.ldap-sort.php                             29-May-2024 00:07                7296
function.ldap-start-tls.php                        29-May-2024 00:07                2083
function.ldap-t61-to-8859.php                      29-May-2024 00:07                2235
function.ldap-unbind.php                           29-May-2024 00:07                4119
function.levenshtein.php                           29-May-2024 00:07               12493
function.libxml-clear-errors.php                   29-May-2024 00:07                2896
function.libxml-disable-entity-loader.php          29-May-2024 00:07                5205
function.libxml-get-errors.php                     29-May-2024 00:07               10818
function.libxml-get-external-entity-loader.php     29-May-2024 00:07                3573
function.libxml-get-last-error.php                 29-May-2024 00:07                3324
function.libxml-set-external-entity-loader.php     29-May-2024 00:07               10484
function.libxml-set-streams-context.php            29-May-2024 00:07                5168
function.libxml-use-internal-errors.php            29-May-2024 00:07                6911
function.link.php                                  29-May-2024 00:07                6027
function.linkinfo.php                              29-May-2024 00:07                4686
function.list.php                                  29-May-2024 00:07               16945
function.localeconv.php                            29-May-2024 00:07                9616
function.localtime.php                             29-May-2024 00:07                9539
function.log.php                                   29-May-2024 00:07                4092
function.log10.php                                 29-May-2024 00:07                2748
function.log1p.php                                 29-May-2024 00:07                3516
function.long2ip.php                               29-May-2024 00:07                4633
function.lstat.php                                 29-May-2024 00:07                6694
function.ltrim.php                                 29-May-2024 00:07                9678
function.lzf-compress.php                          29-May-2024 00:07                3118
function.lzf-decompress.php                        29-May-2024 00:07                3186
function.lzf-optimized-for.php                     29-May-2024 00:07                2391
function.mail.php                                  29-May-2024 00:07               26628
function.mailparse-determine-best-xfer-encoding..> 29-May-2024 00:07                4346
function.mailparse-msg-create.php                  29-May-2024 00:07                3457
function.mailparse-msg-extract-part-file.php       29-May-2024 00:07                5414
function.mailparse-msg-extract-part.php            29-May-2024 00:07                4183
function.mailparse-msg-extract-whole-part-file.php 29-May-2024 00:07                4208
function.mailparse-msg-free.php                    29-May-2024 00:07                3717
function.mailparse-msg-get-part-data.php           29-May-2024 00:07                2640
function.mailparse-msg-get-part.php                29-May-2024 00:07                2923
function.mailparse-msg-get-structure.php           29-May-2024 00:07                2660
function.mailparse-msg-parse-file.php              29-May-2024 00:07                4325
function.mailparse-msg-parse.php                   29-May-2024 00:07                3632
function.mailparse-rfc822-parse-addresses.php      29-May-2024 00:07                5741
function.mailparse-stream-encode.php               29-May-2024 00:07                5997
function.mailparse-uudecode-all.php                29-May-2024 00:07                6983
function.max.php                                   29-May-2024 00:07               12376
function.mb-check-encoding.php                     29-May-2024 00:07                5798
function.mb-chr.php                                29-May-2024 00:07                7450
function.mb-convert-case.php                       29-May-2024 00:07               12057
function.mb-convert-encoding.php                   29-May-2024 00:07               11171
function.mb-convert-kana.php                       29-May-2024 00:07               10704
function.mb-convert-variables.php                  29-May-2024 00:07                6532
function.mb-decode-mimeheader.php                  29-May-2024 00:07                3173
function.mb-decode-numericentity.php               29-May-2024 00:07               34732
function.mb-detect-encoding.php                    29-May-2024 00:07               15694
function.mb-detect-order.php                       29-May-2024 00:07                9350
function.mb-encode-mimeheader.php                  29-May-2024 00:07                9955
function.mb-encode-numericentity.php               29-May-2024 00:07               13078
function.mb-encoding-aliases.php                   29-May-2024 00:07                6607
function.mb-ereg-match.php                         29-May-2024 00:07                5942
function.mb-ereg-replace-callback.php              29-May-2024 00:07               11759
function.mb-ereg-replace.php                       29-May-2024 00:07                7650
function.mb-ereg-search-getpos.php                 29-May-2024 00:07                4272
function.mb-ereg-search-getregs.php                29-May-2024 00:07                4562
function.mb-ereg-search-init.php                   29-May-2024 00:07                6604
function.mb-ereg-search-pos.php                    29-May-2024 00:07                6488
function.mb-ereg-search-regs.php                   29-May-2024 00:07                6143
function.mb-ereg-search-setpos.php                 29-May-2024 00:07                4958
function.mb-ereg-search.php                        29-May-2024 00:07                6082
function.mb-ereg.php                               29-May-2024 00:07                6974
function.mb-eregi-replace.php                      29-May-2024 00:07                7631
function.mb-eregi.php                              29-May-2024 00:07                7043
function.mb-get-info.php                           29-May-2024 00:07                6435
function.mb-http-input.php                         29-May-2024 00:07                5252
function.mb-http-output.php                        29-May-2024 00:07                4939
function.mb-internal-encoding.php                  29-May-2024 00:07                7220
function.mb-language.php                           29-May-2024 00:07                6671
function.mb-list-encodings.php                     29-May-2024 00:07                5245
function.mb-ord.php                                29-May-2024 00:07                7158
function.mb-output-handler.php                     29-May-2024 00:07                5528
function.mb-parse-str.php                          29-May-2024 00:07                4796
function.mb-preferred-mime-name.php                29-May-2024 00:07                4533
function.mb-regex-encoding.php                     29-May-2024 00:07                5153
function.mb-regex-set-options.php                  29-May-2024 00:07                9181
function.mb-scrub.php                              29-May-2024 00:07                4258
function.mb-send-mail.php                          29-May-2024 00:07               10190
function.mb-split.php                              29-May-2024 00:07                4799
function.mb-str-pad.php                            29-May-2024 00:07                8798
function.mb-str-split.php                          29-May-2024 00:07                5508
function.mb-strcut.php                             29-May-2024 00:07                7841
function.mb-strimwidth.php                         29-May-2024 00:07                8115
function.mb-stripos.php                            29-May-2024 00:07                7025
function.mb-stristr.php                            29-May-2024 00:07                7805
function.mb-strlen.php                             29-May-2024 00:07                5297
function.mb-strpos.php                             29-May-2024 00:07                6854
function.mb-strrchr.php                            29-May-2024 00:07                7628
function.mb-strrichr.php                           29-May-2024 00:07                7567
function.mb-strripos.php                           29-May-2024 00:07                6866
function.mb-strrpos.php                            29-May-2024 00:07                6988
function.mb-strstr.php                             29-May-2024 00:07                7445
function.mb-strtolower.php                         29-May-2024 00:07                7632
function.mb-strtoupper.php                         29-May-2024 00:07                7632
function.mb-strwidth.php                           29-May-2024 00:07                9386
function.mb-substitute-character.php               29-May-2024 00:07                7655
function.mb-substr-count.php                       29-May-2024 00:07                6239
function.mb-substr.php                             29-May-2024 00:07                7039
function.mcrypt-create-iv.php                      29-May-2024 00:07                7403
function.mcrypt-decrypt.php                        29-May-2024 00:07                6207
function.mcrypt-enc-get-algorithms-name.php        29-May-2024 00:07                5582
function.mcrypt-enc-get-block-size.php             29-May-2024 00:07                3269
function.mcrypt-enc-get-iv-size.php                29-May-2024 00:07                3443
function.mcrypt-enc-get-key-size.php               29-May-2024 00:07                3300
function.mcrypt-enc-get-modes-name.php             29-May-2024 00:07                5485
function.mcrypt-enc-get-supported-key-sizes.php    29-May-2024 00:07                5333
function.mcrypt-enc-is-block-algorithm-mode.php    29-May-2024 00:07                3851
function.mcrypt-enc-is-block-algorithm.php         29-May-2024 00:07                3557
function.mcrypt-enc-is-block-mode.php              29-May-2024 00:07                3709
function.mcrypt-enc-self-test.php                  29-May-2024 00:07                3328
function.mcrypt-encrypt.php                        29-May-2024 00:07               14176
function.mcrypt-generic-deinit.php                 29-May-2024 00:07                4409
function.mcrypt-generic-init.php                   29-May-2024 00:07                5626
function.mcrypt-generic.php                        29-May-2024 00:07                6262
function.mcrypt-get-block-size.php                 29-May-2024 00:07                6826
function.mcrypt-get-cipher-name.php                29-May-2024 00:07                5160
function.mcrypt-get-iv-size.php                    29-May-2024 00:07                6576
function.mcrypt-get-key-size.php                   29-May-2024 00:07                6976
function.mcrypt-list-algorithms.php                29-May-2024 00:07                4977
function.mcrypt-list-modes.php                     29-May-2024 00:07                4829
function.mcrypt-module-close.php                   29-May-2024 00:07                3770
function.mcrypt-module-get-algo-block-size.php     29-May-2024 00:07                3807
function.mcrypt-module-get-algo-key-size.php       29-May-2024 00:07                3911
function.mcrypt-module-get-supported-key-sizes.php 29-May-2024 00:07                4957
function.mcrypt-module-is-block-algorithm-mode.php 29-May-2024 00:07                4776
function.mcrypt-module-is-block-algorithm.php      29-May-2024 00:07                4246
function.mcrypt-module-is-block-mode.php           29-May-2024 00:07                4792
function.mcrypt-module-open.php                    29-May-2024 00:07               14204
function.mcrypt-module-self-test.php               29-May-2024 00:07                5277
function.md5-file.php                              29-May-2024 00:07                5100
function.md5.php                                   29-May-2024 00:07                6102
function.mdecrypt-generic.php                      29-May-2024 00:07               11226
function.memcache-debug.php                        29-May-2024 00:07                3807
function.memory-get-peak-usage.php                 29-May-2024 00:07                3914
function.memory-get-usage.php                      29-May-2024 00:07                5781
function.memory-reset-peak-usage.php               29-May-2024 00:07                5089
function.metaphone.php                             29-May-2024 00:07                8585
function.method-exists.php                         29-May-2024 00:07                6739
function.mhash-count.php                           29-May-2024 00:07                4876
function.mhash-get-block-size.php                  29-May-2024 00:07                4714
function.mhash-get-hash-name.php                   29-May-2024 00:07                4686
function.mhash-keygen-s2k.php                      29-May-2024 00:07                5955
function.mhash.php                                 29-May-2024 00:07                5138
function.microtime.php                             29-May-2024 00:07                8048
function.mime-content-type.php                     29-May-2024 00:07                5286
function.min.php                                   29-May-2024 00:07               12920
function.mkdir.php                                 29-May-2024 00:07                9786
function.mktime.php                                29-May-2024 00:07               19824
function.money-format.php                          29-May-2024 00:07               18448
function.mongodb.bson-fromjson.php                 29-May-2024 00:07                5943
function.mongodb.bson-fromphp.php                  29-May-2024 00:07                6280
function.mongodb.bson-tocanonicalextendedjson.php  29-May-2024 00:07               13979
function.mongodb.bson-tojson.php                   29-May-2024 00:07               15057
function.mongodb.bson-tophp.php                    29-May-2024 00:07                9167
function.mongodb.bson-torelaxedextendedjson.php    29-May-2024 00:07               13676
function.mongodb.driver.monitoring.addsubscribe..> 29-May-2024 00:07                5139
function.mongodb.driver.monitoring.removesubscr..> 29-May-2024 00:07                4994
function.move-uploaded-file.php                    29-May-2024 00:07                8679
function.mqseries-back.php                         29-May-2024 00:07                6534
function.mqseries-begin.php                        29-May-2024 00:07                7494
function.mqseries-close.php                        29-May-2024 00:07                6709
function.mqseries-cmit.php                         29-May-2024 00:07                6459
function.mqseries-conn.php                         29-May-2024 00:07                6034
function.mqseries-connx.php                        29-May-2024 00:07               12734
function.mqseries-disc.php                         29-May-2024 00:07                5736
function.mqseries-get.php                          29-May-2024 00:07               12354
function.mqseries-inq.php                          29-May-2024 00:07                9412
function.mqseries-open.php                         29-May-2024 00:07                7345
function.mqseries-put.php                          29-May-2024 00:07               12633
function.mqseries-put1.php                         29-May-2024 00:07                6379
function.mqseries-set.php                          29-May-2024 00:07                6305
function.mqseries-strerror.php                     29-May-2024 00:07                4318
function.msg-get-queue.php                         29-May-2024 00:07                5732
function.msg-queue-exists.php                      29-May-2024 00:07                3493
function.msg-receive.php                           29-May-2024 00:07               11527
function.msg-remove-queue.php                      29-May-2024 00:07                4692
function.msg-send.php                              29-May-2024 00:07                9656
function.msg-set-queue.php                         29-May-2024 00:07                5350
function.msg-stat-queue.php                        29-May-2024 00:07                6715
function.mt-getrandmax.php                         29-May-2024 00:07                3355
function.mt-rand.php                               29-May-2024 00:07               10423
function.mt-srand.php                              29-May-2024 00:07                8532
function.mysql-affected-rows.php                   29-May-2024 00:07               12442
function.mysql-client-encoding.php                 29-May-2024 00:07                6459
function.mysql-close.php                           29-May-2024 00:07                7601
function.mysql-connect.php                         29-May-2024 00:07               17703
function.mysql-create-db.php                       29-May-2024 00:07                8795
function.mysql-data-seek.php                       29-May-2024 00:07               12031
function.mysql-db-name.php                         29-May-2024 00:07                7308
function.mysql-db-query.php                        29-May-2024 00:07               10347
function.mysql-drop-db.php                         29-May-2024 00:07                7886
function.mysql-errno.php                           29-May-2024 00:07                8340
function.mysql-error.php                           29-May-2024 00:07                8306
function.mysql-escape-string.php                   29-May-2024 00:07                6616
function.mysql-fetch-array.php                     29-May-2024 00:07               15752
function.mysql-fetch-assoc.php                     29-May-2024 00:07               11524
function.mysql-fetch-field.php                     29-May-2024 00:07               13111
function.mysql-fetch-lengths.php                   29-May-2024 00:07                7758
function.mysql-fetch-object.php                    29-May-2024 00:07               11983
function.mysql-fetch-row.php                       29-May-2024 00:07                7830
function.mysql-field-flags.php                     29-May-2024 00:07                8661
function.mysql-field-len.php                       29-May-2024 00:07                7107
function.mysql-field-name.php                      29-May-2024 00:07                9179
function.mysql-field-seek.php                      29-May-2024 00:07                5215
function.mysql-field-table.php                     29-May-2024 00:07                7775
function.mysql-field-type.php                      29-May-2024 00:07               11724
function.mysql-free-result.php                     29-May-2024 00:07                8133
function.mysql-get-client-info.php                 29-May-2024 00:07                5330
function.mysql-get-host-info.php                   29-May-2024 00:07                7368
function.mysql-get-proto-info.php                  29-May-2024 00:07                6876
function.mysql-get-server-info.php                 29-May-2024 00:07                7440
function.mysql-info.php                            29-May-2024 00:07                6593
function.mysql-insert-id.php                       29-May-2024 00:07                8407
function.mysql-list-dbs.php                        29-May-2024 00:07                9117
function.mysql-list-fields.php                     29-May-2024 00:07                9192
function.mysql-list-processes.php                  29-May-2024 00:07                7934
function.mysql-list-tables.php                     29-May-2024 00:07               10018
function.mysql-num-fields.php                      29-May-2024 00:07                6769
function.mysql-num-rows.php                        29-May-2024 00:07                8254
function.mysql-pconnect.php                        29-May-2024 00:07                8490
function.mysql-ping.php                            29-May-2024 00:07                8233
function.mysql-query.php                           29-May-2024 00:07               13957
function.mysql-real-escape-string.php              29-May-2024 00:07               15434
function.mysql-result.php                          29-May-2024 00:07                9665
function.mysql-select-db.php                       29-May-2024 00:07                8002
function.mysql-set-charset.php                     29-May-2024 00:07                6072
function.mysql-stat.php                            29-May-2024 00:07                9651
function.mysql-tablename.php                       29-May-2024 00:07                8380
function.mysql-thread-id.php                       29-May-2024 00:07                6907
function.mysql-unbuffered-query.php                29-May-2024 00:07                7387
function.mysql-xdevapi-expression.php              29-May-2024 00:07                4883
function.mysql-xdevapi-getsession.php              29-May-2024 00:07               13139
function.mysqli-connect.php                        29-May-2024 00:07                2392
function.mysqli-escape-string.php                  29-May-2024 00:07                1984
function.mysqli-execute.php                        29-May-2024 00:07                2549
function.mysqli-get-client-stats.php               29-May-2024 00:07                8480
function.mysqli-get-links-stats.php                29-May-2024 00:07                3451
function.mysqli-report.php                         29-May-2024 00:07                1786
function.mysqli-set-opt.php                        29-May-2024 00:07                1887
function.natcasesort.php                           29-May-2024 00:07                8025
function.natsort.php                               29-May-2024 00:07               11168
function.net-get-interfaces.php                    29-May-2024 00:07                4825
function.next.php                                  29-May-2024 00:07                9809
function.ngettext.php                              29-May-2024 00:07                5831
function.nl-langinfo.php                           29-May-2024 00:07               18815
function.nl2br.php                                 29-May-2024 00:07                7058
function.number-format.php                         29-May-2024 00:07                8960
function.oauth-get-sbs.php                         29-May-2024 00:07                3207
function.oauth-urlencode.php                       29-May-2024 00:07                2646
function.ob-clean.php                              29-May-2024 00:07                3752
function.ob-end-clean.php                          29-May-2024 00:07                5524
function.ob-end-flush.php                          29-May-2024 00:07                6260
function.ob-flush.php                              29-May-2024 00:07                3992
function.ob-get-clean.php                          29-May-2024 00:07                5537
function.ob-get-contents.php                       29-May-2024 00:07                4923
function.ob-get-flush.php                          29-May-2024 00:07                5991
function.ob-get-length.php                         29-May-2024 00:07                4886
function.ob-get-level.php                          29-May-2024 00:07                2995
function.ob-get-status.php                         29-May-2024 00:07                7832
function.ob-gzhandler.php                          29-May-2024 00:07                5971
function.ob-iconv-handler.php                      29-May-2024 00:07                5373
function.ob-implicit-flush.php                     29-May-2024 00:07                4666
function.ob-list-handlers.php                      29-May-2024 00:07                6081
function.ob-start.php                              29-May-2024 00:07               17942
function.ob-tidyhandler.php                        29-May-2024 00:07                4588
function.oci-bind-array-by-name.php                29-May-2024 00:07               13980
function.oci-bind-by-name.php                      29-May-2024 00:07               79376
function.oci-cancel.php                            29-May-2024 00:07                2770
function.oci-client-version.php                    29-May-2024 00:07                4081
function.oci-close.php                             29-May-2024 00:07               18645
function.oci-commit.php                            29-May-2024 00:07               11094
function.oci-connect.php                           29-May-2024 00:07               35547
function.oci-define-by-name.php                    29-May-2024 00:07               24022
function.oci-error.php                             29-May-2024 00:07               12039
function.oci-execute.php                           29-May-2024 00:07               21474
function.oci-fetch-all.php                         29-May-2024 00:07               24813
function.oci-fetch-array.php                       29-May-2024 00:07               64661
function.oci-fetch-assoc.php                       29-May-2024 00:07                8952
function.oci-fetch-object.php                      29-May-2024 00:07               18354
function.oci-fetch-row.php                         29-May-2024 00:07                8893
function.oci-fetch.php                             29-May-2024 00:07               13589
function.oci-field-is-null.php                     29-May-2024 00:07                7949
function.oci-field-name.php                        29-May-2024 00:07                9891
function.oci-field-precision.php                   29-May-2024 00:07                8749
function.oci-field-scale.php                       29-May-2024 00:07                8727
function.oci-field-size.php                        29-May-2024 00:07               10343
function.oci-field-type-raw.php                    29-May-2024 00:07                7999
function.oci-field-type.php                        29-May-2024 00:07               10745
function.oci-free-descriptor.php                   29-May-2024 00:07                3610
function.oci-free-statement.php                    29-May-2024 00:07                3050
function.oci-get-implicit-resultset.php            29-May-2024 00:07               28258
function.oci-internal-debug.php                    29-May-2024 00:07                3144
function.oci-lob-copy.php                          29-May-2024 00:07                4672
function.oci-lob-is-equal.php                      29-May-2024 00:07                3348
function.oci-new-collection.php                    29-May-2024 00:07                5180
function.oci-new-connect.php                       29-May-2024 00:07               16803
function.oci-new-cursor.php                        29-May-2024 00:07                7822
function.oci-new-descriptor.php                    29-May-2024 00:07               18315
function.oci-num-fields.php                        29-May-2024 00:07                7016
function.oci-num-rows.php                          29-May-2024 00:07                8041
function.oci-parse.php                             29-May-2024 00:07               12649
function.oci-password-change.php                   29-May-2024 00:07               13655
function.oci-pconnect.php                          29-May-2024 00:07               15215
function.oci-register-taf-callback.php             29-May-2024 00:07                5865
function.oci-result.php                            29-May-2024 00:07                8731
function.oci-rollback.php                          29-May-2024 00:07               14417
function.oci-server-version.php                    29-May-2024 00:07                4836
function.oci-set-action.php                        29-May-2024 00:07                8514
function.oci-set-call-timout.php                   29-May-2024 00:07                6042
function.oci-set-client-identifier.php             29-May-2024 00:07                8219
function.oci-set-client-info.php                   29-May-2024 00:07                8436
function.oci-set-db-operation.php                  29-May-2024 00:07                7878
function.oci-set-edition.php                       29-May-2024 00:07                9809
function.oci-set-module-name.php                   29-May-2024 00:07                8618
function.oci-set-prefetch-lob.php                  29-May-2024 00:07                8930
function.oci-set-prefetch.php                      29-May-2024 00:07               20761
function.oci-statement-type.php                    29-May-2024 00:07                7111
function.oci-unregister-taf-callback.php           29-May-2024 00:07                3716
function.ocibindbyname.php                         29-May-2024 00:07                2024
function.ocicancel.php                             29-May-2024 00:07                1966
function.ocicloselob.php                           29-May-2024 00:07                1965
function.ocicollappend.php                         29-May-2024 00:07                2030
function.ocicollassign.php                         29-May-2024 00:07                2035
function.ocicollassignelem.php                     29-May-2024 00:07                2080
function.ocicollgetelem.php                        29-May-2024 00:07                2047
function.ocicollmax.php                            29-May-2024 00:07                1999
function.ocicollsize.php                           29-May-2024 00:07                2002
function.ocicolltrim.php                           29-May-2024 00:07                2012
function.ocicolumnisnull.php                       29-May-2024 00:07                2036
function.ocicolumnname.php                         29-May-2024 00:07                2028
function.ocicolumnprecision.php                    29-May-2024 00:07                2071
function.ocicolumnscale.php                        29-May-2024 00:07                2035
function.ocicolumnsize.php                         29-May-2024 00:07                2016
function.ocicolumntype.php                         29-May-2024 00:07                2020
function.ocicolumntyperaw.php                      29-May-2024 00:07                2043
function.ocicommit.php                             29-May-2024 00:07                1980
function.ocidefinebyname.php                       29-May-2024 00:07                2026
function.ocierror.php                              29-May-2024 00:07                1957
function.ociexecute.php                            29-May-2024 00:07                1961
function.ocifetch.php                              29-May-2024 00:07                1951
function.ocifetchinto.php                          29-May-2024 00:07                2692
function.ocifetchstatement.php                     29-May-2024 00:07                2044
function.ocifreecollection.php                     29-May-2024 00:07                2062
function.ocifreecursor.php                         29-May-2024 00:07                2034
function.ocifreedesc.php                           29-May-2024 00:07                1978
function.ocifreestatement.php                      29-May-2024 00:07                2053
function.ociinternaldebug.php                      29-May-2024 00:07                2067
function.ociloadlob.php                            29-May-2024 00:07                1963
function.ocilogoff.php                             29-May-2024 00:07                1950
function.ocilogon.php                              29-May-2024 00:07                1965
function.ocinewcollection.php                      29-May-2024 00:07                2051
function.ocinewcursor.php                          29-May-2024 00:07                2019
function.ocinewdescriptor.php                      29-May-2024 00:07                2041
function.ocinlogon.php                             29-May-2024 00:07                1990
function.ocinumcols.php                            29-May-2024 00:07                1975
function.ociparse.php                              29-May-2024 00:07                1945
function.ociplogon.php                             29-May-2024 00:07                1960
function.ociresult.php                             29-May-2024 00:07                1958
function.ocirollback.php                           29-May-2024 00:07                1980
function.ocirowcount.php                           29-May-2024 00:07                1982
function.ocisavelob.php                            29-May-2024 00:07                1963
function.ocisavelobfile.php                        29-May-2024 00:07                2001
function.ociserverversion.php                      29-May-2024 00:07                2055
function.ocisetprefetch.php                        29-May-2024 00:07                2041
function.ocistatementtype.php                      29-May-2024 00:07                2061
function.ociwritelobtofile.php                     29-May-2024 00:07                2042
function.ociwritetemporarylob.php                  29-May-2024 00:07                2065
function.octdec.php                                29-May-2024 00:07                5931
function.odbc-autocommit.php                       29-May-2024 00:07                4750
function.odbc-binmode.php                          29-May-2024 00:07                7988
function.odbc-close-all.php                        29-May-2024 00:07                2705
function.odbc-close.php                            29-May-2024 00:07                3007
function.odbc-columnprivileges.php                 29-May-2024 00:07                8713
function.odbc-columns.php                          29-May-2024 00:07               11435
function.odbc-commit.php                           29-May-2024 00:07                2835
function.odbc-connect.php                          29-May-2024 00:07                9280
function.odbc-connection-string-is-quoted.php      29-May-2024 00:07                3762
function.odbc-connection-string-quote.php          29-May-2024 00:07                5818
function.odbc-connection-string-should-quote.php   29-May-2024 00:07                4026
function.odbc-cursor.php                           29-May-2024 00:07                2797
function.odbc-data-source.php                      29-May-2024 00:07                5967
function.odbc-do.php                               29-May-2024 00:07                1731
function.odbc-error.php                            29-May-2024 00:07                4398
function.odbc-errormsg.php                         29-May-2024 00:07                4506
function.odbc-exec.php                             29-May-2024 00:07                4224
function.odbc-execute.php                          29-May-2024 00:07                7240
function.odbc-fetch-array.php                      29-May-2024 00:07                4467
function.odbc-fetch-into.php                       29-May-2024 00:07                5357
function.odbc-fetch-object.php                     29-May-2024 00:07                4604
function.odbc-fetch-row.php                        29-May-2024 00:07                4817
function.odbc-field-len.php                        29-May-2024 00:07                3661
function.odbc-field-name.php                       29-May-2024 00:07                3287
function.odbc-field-num.php                        29-May-2024 00:07                3289
function.odbc-field-precision.php                  29-May-2024 00:07                2239
function.odbc-field-scale.php                      29-May-2024 00:07                3301
function.odbc-field-type.php                       29-May-2024 00:07                3283
function.odbc-foreignkeys.php                      29-May-2024 00:07                9042
function.odbc-free-result.php                      29-May-2024 00:07                3579
function.odbc-gettypeinfo.php                      29-May-2024 00:07                4769
function.odbc-longreadlen.php                      29-May-2024 00:07                4174
function.odbc-next-result.php                      29-May-2024 00:07                9370
function.odbc-num-fields.php                       29-May-2024 00:07                2793
function.odbc-num-rows.php                         29-May-2024 00:07                3390
function.odbc-pconnect.php                         29-May-2024 00:07                4981
function.odbc-prepare.php                          29-May-2024 00:07                6672
function.odbc-primarykeys.php                      29-May-2024 00:07                8023
function.odbc-procedurecolumns.php                 29-May-2024 00:07               11962
function.odbc-procedures.php                       29-May-2024 00:07                9735
function.odbc-result-all.php                       29-May-2024 00:07                4256
function.odbc-result.php                           29-May-2024 00:07                5717
function.odbc-rollback.php                         29-May-2024 00:07                2876
function.odbc-setoption.php                        29-May-2024 00:07                7293
function.odbc-specialcolumns.php                   29-May-2024 00:07                7914
function.odbc-statistics.php                       29-May-2024 00:07               10140
function.odbc-tableprivileges.php                  29-May-2024 00:07                8299
function.odbc-tables.php                           29-May-2024 00:07               12832
function.opcache-compile-file.php                  29-May-2024 00:07                3946
function.opcache-get-configuration.php             29-May-2024 00:07                3364
function.opcache-get-status.php                    29-May-2024 00:07                3920
function.opcache-invalidate.php                    29-May-2024 00:07                4449
function.opcache-is-script-cached.php              29-May-2024 00:07                3503
function.opcache-reset.php                         29-May-2024 00:07                3448
function.openal-buffer-create.php                  29-May-2024 00:07                2945
function.openal-buffer-data.php                    29-May-2024 00:07                5075
function.openal-buffer-destroy.php                 29-May-2024 00:07                3269
function.openal-buffer-get.php                     29-May-2024 00:07                4070
function.openal-buffer-loadwav.php                 29-May-2024 00:07                3810
function.openal-context-create.php                 29-May-2024 00:07                3455
function.openal-context-current.php                29-May-2024 00:07                3324
function.openal-context-destroy.php                29-May-2024 00:07                3310
function.openal-context-process.php                29-May-2024 00:07                3698
function.openal-context-suspend.php                29-May-2024 00:07                3692
function.openal-device-close.php                   29-May-2024 00:07                3276
function.openal-device-open.php                    29-May-2024 00:07                3448
function.openal-listener-get.php                   29-May-2024 00:07                3506
function.openal-listener-set.php                   29-May-2024 00:07                3906
function.openal-source-create.php                  29-May-2024 00:07                3136
function.openal-source-destroy.php                 29-May-2024 00:07                3277
function.openal-source-get.php                     29-May-2024 00:07                5696
function.openal-source-pause.php                   29-May-2024 00:07                3578
function.openal-source-play.php                    29-May-2024 00:07                3577
function.openal-source-rewind.php                  29-May-2024 00:07                3587
function.openal-source-set.php                     29-May-2024 00:07                6436
function.openal-source-stop.php                    29-May-2024 00:07                3559
function.openal-stream.php                         29-May-2024 00:07                4504
function.opendir.php                               29-May-2024 00:07                8621
function.openlog.php                               29-May-2024 00:07               10248
function.openssl-cipher-iv-length.php              29-May-2024 00:07                4584
function.openssl-cipher-key-length.php             29-May-2024 00:07                4513
function.openssl-cms-decrypt.php                   29-May-2024 00:07                5792
function.openssl-cms-encrypt.php                   29-May-2024 00:07                6778
function.openssl-cms-read.php                      29-May-2024 00:07                3354
function.openssl-cms-sign.php                      29-May-2024 00:07                8228
function.openssl-cms-verify.php                    29-May-2024 00:07                7375
function.openssl-csr-export-to-file.php            29-May-2024 00:07                8658
function.openssl-csr-export.php                    29-May-2024 00:07                8632
function.openssl-csr-get-public-key.php            29-May-2024 00:07                9070
function.openssl-csr-get-subject.php               29-May-2024 00:07                9784
function.openssl-csr-new.php                       29-May-2024 00:07               22012
function.openssl-csr-sign.php                      29-May-2024 00:07               13054
function.openssl-decrypt.php                       29-May-2024 00:07                8590
function.openssl-dh-compute-key.php                29-May-2024 00:07               16821
function.openssl-digest.php                        29-May-2024 00:07                4850
function.openssl-encrypt.php                       29-May-2024 00:07               18748
function.openssl-error-string.php                  29-May-2024 00:07                3838
function.openssl-free-key.php                      29-May-2024 00:07                3784
function.openssl-get-cert-locations.php            29-May-2024 00:07                4135
function.openssl-get-cipher-methods.php            29-May-2024 00:07               14045
function.openssl-get-curve-names.php               29-May-2024 00:07                7266
function.openssl-get-md-methods.php                29-May-2024 00:07                7045
function.openssl-get-privatekey.php                29-May-2024 00:07                1958
function.openssl-get-publickey.php                 29-May-2024 00:07                1929
function.openssl-open.php                          29-May-2024 00:07               10380
function.openssl-pbkdf2.php                        29-May-2024 00:07                7781
function.openssl-pkcs12-export-to-file.php         29-May-2024 00:07                7510
function.openssl-pkcs12-export.php                 29-May-2024 00:07                7558
function.openssl-pkcs12-read.php                   29-May-2024 00:07                5733
function.openssl-pkcs7-decrypt.php                 29-May-2024 00:07                7716
function.openssl-pkcs7-encrypt.php                 29-May-2024 00:07               10848
function.openssl-pkcs7-read.php                    29-May-2024 00:07                7053
function.openssl-pkcs7-sign.php                    29-May-2024 00:07               11903
function.openssl-pkcs7-verify.php                  29-May-2024 00:07                8387
function.openssl-pkey-derive.php                   29-May-2024 00:07                8298
function.openssl-pkey-export-to-file.php           29-May-2024 00:07                6531
function.openssl-pkey-export.php                   29-May-2024 00:07                6482
function.openssl-pkey-free.php                     29-May-2024 00:07                4274
function.openssl-pkey-get-details.php              29-May-2024 00:07                9836
function.openssl-pkey-get-private.php              29-May-2024 00:07                6168
function.openssl-pkey-get-public.php               29-May-2024 00:07                5414
function.openssl-pkey-new.php                      29-May-2024 00:07                6876
function.openssl-private-decrypt.php               29-May-2024 00:07                6954
function.openssl-private-encrypt.php               29-May-2024 00:07                6745
function.openssl-public-decrypt.php                29-May-2024 00:07                6726
function.openssl-public-encrypt.php                29-May-2024 00:07                7092
function.openssl-random-pseudo-bytes.php           29-May-2024 00:07                9373
function.openssl-seal.php                          29-May-2024 00:07               11995
function.openssl-sign.php                          29-May-2024 00:07               12757
function.openssl-spki-export-challenge.php         29-May-2024 00:07                7762
function.openssl-spki-export.php                   29-May-2024 00:07                8571
function.openssl-spki-new.php                      29-May-2024 00:07                9474
function.openssl-spki-verify.php                   29-May-2024 00:07                7950
function.openssl-verify.php                        29-May-2024 00:07               13209
function.openssl-x509-check-private-key.php        29-May-2024 00:07                5886
function.openssl-x509-checkpurpose.php             29-May-2024 00:07                7722
function.openssl-x509-export-to-file.php           29-May-2024 00:07                5224
function.openssl-x509-export.php                   29-May-2024 00:07                5200
function.openssl-x509-fingerprint.php              29-May-2024 00:07                5526
function.openssl-x509-free.php                     29-May-2024 00:07                4280
function.openssl-x509-parse.php                    29-May-2024 00:07                4657
function.openssl-x509-read.php                     29-May-2024 00:07                4547
function.openssl-x509-verify.php                   29-May-2024 00:07               12625
function.ord.php                                   29-May-2024 00:07                7100
function.output-add-rewrite-var.php                29-May-2024 00:07                8629
function.output-reset-rewrite-vars.php             29-May-2024 00:07                6836
function.pack.php                                  29-May-2024 00:07               14027
function.parse-ini-file.php                        29-May-2024 00:07               21123
function.parse-ini-string.php                      29-May-2024 00:07                7678
function.parse-str.php                             29-May-2024 00:07               10015
function.parse-url.php                             29-May-2024 00:07               16674
function.passthru.php                              29-May-2024 00:07                7777
function.password-algos.php                        29-May-2024 00:07                3352
function.password-get-info.php                     29-May-2024 00:07                3553
function.password-hash.php                         29-May-2024 00:07               23371
function.password-needs-rehash.php                 29-May-2024 00:07                8112
function.password-verify.php                       29-May-2024 00:07                6909
function.pathinfo.php                              29-May-2024 00:07               14667
function.pclose.php                                29-May-2024 00:07                4974
function.pcntl-alarm.php                           29-May-2024 00:07                3086
function.pcntl-async-signals.php                   29-May-2024 00:07                4436
function.pcntl-errno.php                           29-May-2024 00:07                1842
function.pcntl-exec.php                            29-May-2024 00:07                3869
function.pcntl-fork.php                            29-May-2024 00:07                4961
function.pcntl-get-last-error.php                  29-May-2024 00:07                2891
function.pcntl-getpriority.php                     29-May-2024 00:07                6086
function.pcntl-rfork.php                           29-May-2024 00:07                7852
function.pcntl-setpriority.php                     29-May-2024 00:07                5865
function.pcntl-signal-dispatch.php                 29-May-2024 00:07                5767
function.pcntl-signal-get-handler.php              29-May-2024 00:07                6930
function.pcntl-signal.php                          29-May-2024 00:07               11351
function.pcntl-sigprocmask.php                     29-May-2024 00:07                6154
function.pcntl-sigtimedwait.php                    29-May-2024 00:07                5024
function.pcntl-sigwaitinfo.php                     29-May-2024 00:07                7617
function.pcntl-strerror.php                        29-May-2024 00:07                3123
function.pcntl-unshare.php                         29-May-2024 00:07                4742
function.pcntl-wait.php                            29-May-2024 00:07                8274
function.pcntl-waitpid.php                         29-May-2024 00:07                9518
function.pcntl-wexitstatus.php                     29-May-2024 00:07                4016
function.pcntl-wifexited.php                       29-May-2024 00:07                3756
function.pcntl-wifsignaled.php                     29-May-2024 00:07                3704
function.pcntl-wifstopped.php                      29-May-2024 00:07                3702
function.pcntl-wstopsig.php                        29-May-2024 00:07                3973
function.pcntl-wtermsig.php                        29-May-2024 00:07                4171
function.pfsockopen.php                            29-May-2024 00:07                5855
function.pg-affected-rows.php                      29-May-2024 00:07                6836
function.pg-cancel-query.php                       29-May-2024 00:07                7451
function.pg-client-encoding.php                    29-May-2024 00:07                6925
function.pg-close.php                              29-May-2024 00:07                7011
function.pg-connect-poll.php                       29-May-2024 00:07                4099
function.pg-connect.php                            29-May-2024 00:07               11143
function.pg-connection-busy.php                    29-May-2024 00:07                5727
function.pg-connection-reset.php                   29-May-2024 00:07                5737
function.pg-connection-status.php                  29-May-2024 00:07                5541
function.pg-consume-input.php                      29-May-2024 00:07                3639
function.pg-convert.php                            29-May-2024 00:07                9860
function.pg-copy-from.php                          29-May-2024 00:07                8111
function.pg-copy-to.php                            29-May-2024 00:07                7465
function.pg-dbname.php                             29-May-2024 00:07                5439
function.pg-delete.php                             29-May-2024 00:07                9836
function.pg-end-copy.php                           29-May-2024 00:07                7464
function.pg-escape-bytea.php                       29-May-2024 00:07                7911
function.pg-escape-identifier.php                  29-May-2024 00:07                7905
function.pg-escape-literal.php                     29-May-2024 00:07                8270
function.pg-escape-string.php                      29-May-2024 00:07                7785
function.pg-execute.php                            29-May-2024 00:07               10398
function.pg-fetch-all-columns.php                  29-May-2024 00:07                7121
function.pg-fetch-all.php                          29-May-2024 00:07                9206
function.pg-fetch-array.php                        29-May-2024 00:07               12769
function.pg-fetch-assoc.php                        29-May-2024 00:07                9517
function.pg-fetch-object.php                       29-May-2024 00:07               11917
function.pg-fetch-result.php                       29-May-2024 00:07                9434
function.pg-fetch-row.php                          29-May-2024 00:07                9881
function.pg-field-is-null.php                      29-May-2024 00:07                8557
function.pg-field-name.php                         29-May-2024 00:07                9005
function.pg-field-num.php                          29-May-2024 00:07                6595
function.pg-field-prtlen.php                       29-May-2024 00:07               10932
function.pg-field-size.php                         29-May-2024 00:07                9235
function.pg-field-table.php                        29-May-2024 00:07                8755
function.pg-field-type-oid.php                     29-May-2024 00:07                7509
function.pg-field-type.php                         29-May-2024 00:07                7306
function.pg-flush.php                              29-May-2024 00:07                3661
function.pg-free-result.php                        29-May-2024 00:07                7396
function.pg-get-notify.php                         29-May-2024 00:07                7440
function.pg-get-pid.php                            29-May-2024 00:07                5099
function.pg-get-result.php                         29-May-2024 00:07                8602
function.pg-host.php                               29-May-2024 00:07                6457
function.pg-insert.php                             29-May-2024 00:07               11692
function.pg-last-error.php                         29-May-2024 00:07                7519
function.pg-last-notice.php                        29-May-2024 00:07                8403
function.pg-last-oid.php                           29-May-2024 00:07                7629
function.pg-lo-close.php                           29-May-2024 00:07                7213
function.pg-lo-create.php                          29-May-2024 00:07                8744
function.pg-lo-export.php                          29-May-2024 00:07                8305
function.pg-lo-import.php                          29-May-2024 00:07                7553
function.pg-lo-open.php                            29-May-2024 00:07                9123
function.pg-lo-read-all.php                        29-May-2024 00:07                6427
function.pg-lo-read.php                            29-May-2024 00:07                7200
function.pg-lo-seek.php                            29-May-2024 00:07                8016
function.pg-lo-tell.php                            29-May-2024 00:07                6967
function.pg-lo-truncate.php                        29-May-2024 00:07                6701
function.pg-lo-unlink.php                          29-May-2024 00:07                7306
function.pg-lo-write.php                           29-May-2024 00:07                8297
function.pg-meta-data.php                          29-May-2024 00:07                7556
function.pg-num-fields.php                         29-May-2024 00:07                6023
function.pg-num-rows.php                           29-May-2024 00:07                5996
function.pg-options.php                            29-May-2024 00:07                5786
function.pg-parameter-status.php                   29-May-2024 00:07                8568
function.pg-pconnect.php                           29-May-2024 00:07                9848
function.pg-ping.php                               29-May-2024 00:07                6204
function.pg-port.php                               29-May-2024 00:07                5954
function.pg-prepare.php                            29-May-2024 00:07               10361
function.pg-put-line.php                           29-May-2024 00:07                8820
function.pg-query-params.php                       29-May-2024 00:07               10846
function.pg-query.php                              29-May-2024 00:07               12321
function.pg-result-error-field.php                 29-May-2024 00:07                9756
function.pg-result-error.php                       29-May-2024 00:07                8156
function.pg-result-seek.php                        29-May-2024 00:07                7356
function.pg-result-status.php                      29-May-2024 00:07                8733
function.pg-select.php                             29-May-2024 00:07               12240
function.pg-send-execute.php                       29-May-2024 00:07               10403
function.pg-send-prepare.php                       29-May-2024 00:07               10851
function.pg-send-query-params.php                  29-May-2024 00:07                8080
function.pg-send-query.php                         29-May-2024 00:07                9794
function.pg-set-client-encoding.php                29-May-2024 00:07                8909
function.pg-set-error-context-visibility.php       29-May-2024 00:07                7026
function.pg-set-error-verbosity.php                29-May-2024 00:07                9054
function.pg-socket.php                             29-May-2024 00:07                3803
function.pg-trace.php                              29-May-2024 00:07                9330
function.pg-transaction-status.php                 29-May-2024 00:07                6618
function.pg-tty.php                                29-May-2024 00:07                6246
function.pg-unescape-bytea.php                     29-May-2024 00:07                6374
function.pg-untrace.php                            29-May-2024 00:07                6875
function.pg-update.php                             29-May-2024 00:07               10802
function.pg-version.php                            29-May-2024 00:07                6642
function.php-ini-loaded-file.php                   29-May-2024 00:07                4764
function.php-ini-scanned-files.php                 29-May-2024 00:07                6522
function.php-sapi-name.php                         29-May-2024 00:07                6030
function.php-strip-whitespace.php                  29-May-2024 00:07                4896
function.php-uname.php                             29-May-2024 00:07                9372
function.phpcredits.php                            29-May-2024 00:07                9031
function.phpdbg-break-file.php                     29-May-2024 00:07                3798
function.phpdbg-break-function.php                 29-May-2024 00:07                3532
function.phpdbg-break-method.php                   29-May-2024 00:07                3866
function.phpdbg-break-next.php                     29-May-2024 00:07                3180
function.phpdbg-clear.php                          29-May-2024 00:07                3446
function.phpdbg-color.php                          29-May-2024 00:07                3732
function.phpdbg-end-oplog.php                      29-May-2024 00:07                2679
function.phpdbg-exec.php                           29-May-2024 00:07                3169
function.phpdbg-get-executable.php                 29-May-2024 00:07                2622
function.phpdbg-prompt.php                         29-May-2024 00:07                2875
function.phpdbg-start-oplog.php                    29-May-2024 00:07                2333
function.phpinfo.php                               29-May-2024 00:07                9786
function.phpversion.php                            29-May-2024 00:07               10939
function.pi.php                                    29-May-2024 00:07                3092
function.png2wbmp.php                              29-May-2024 00:07                6883
function.popen.php                                 29-May-2024 00:07                8676
function.pos.php                                   29-May-2024 00:07                1659
function.posix-access.php                          29-May-2024 00:07                6888
function.posix-ctermid.php                         29-May-2024 00:07                4408
function.posix-eaccess.php                         29-May-2024 00:07                7533
function.posix-errno.php                           29-May-2024 00:07                1828
function.posix-fpathconf.php                       29-May-2024 00:07                6310
function.posix-get-last-error.php                  29-May-2024 00:07                4181
function.posix-getcwd.php                          29-May-2024 00:07                4300
function.posix-getegid.php                         29-May-2024 00:07                5345
function.posix-geteuid.php                         29-May-2024 00:07                5370
function.posix-getgid.php                          29-May-2024 00:07                4746
function.posix-getgrgid.php                        29-May-2024 00:07                6325
function.posix-getgrnam.php                        29-May-2024 00:07                6108
function.posix-getgroups.php                       29-May-2024 00:07                4292
function.posix-getlogin.php                        29-May-2024 00:07                3730
function.posix-getpgid.php                         29-May-2024 00:07                4612
function.posix-getpgrp.php                         29-May-2024 00:07                2580
function.posix-getpid.php                          29-May-2024 00:07                3365
function.posix-getppid.php                         29-May-2024 00:07                2969
function.posix-getpwnam.php                        29-May-2024 00:07                6786
function.posix-getpwuid.php                        29-May-2024 00:07                6816
function.posix-getrlimit.php                       29-May-2024 00:07                7239
function.posix-getsid.php                          29-May-2024 00:07                4874
function.posix-getuid.php                          29-May-2024 00:07                3446
function.posix-initgroups.php                      29-May-2024 00:07                3387
function.posix-isatty.php                          29-May-2024 00:07                3943
function.posix-kill.php                            29-May-2024 00:07                3486
function.posix-mkfifo.php                          29-May-2024 00:07                3475
function.posix-mknod.php                           29-May-2024 00:07                7565
function.posix-pathconf.php                        29-May-2024 00:07                5691
function.posix-setegid.php                         29-May-2024 00:07                5205
function.posix-seteuid.php                         29-May-2024 00:07                3655
function.posix-setgid.php                          29-May-2024 00:07                5433
function.posix-setpgid.php                         29-May-2024 00:07                3560
function.posix-setrlimit.php                       29-May-2024 00:07                4694
function.posix-setsid.php                          29-May-2024 00:07                2641
function.posix-setuid.php                          29-May-2024 00:07                5677
function.posix-strerror.php                        29-May-2024 00:07                4889
function.posix-sysconf.php                         29-May-2024 00:07                3800
function.posix-times.php                           29-May-2024 00:07                5044
function.posix-ttyname.php                         29-May-2024 00:07                3464
function.posix-uname.php                           29-May-2024 00:07                5221
function.pow.php                                   29-May-2024 00:07                6840
function.preg-filter.php                           29-May-2024 00:07               10152
function.preg-grep.php                             29-May-2024 00:07                6159
function.preg-last-error-msg.php                   29-May-2024 00:07                4153
function.preg-last-error.php                       29-May-2024 00:07                5339
function.preg-match-all.php                        29-May-2024 00:07               25946
function.preg-match.php                            29-May-2024 00:07               23603
function.preg-quote.php                            29-May-2024 00:07                9181
function.preg-replace-callback-array.php           29-May-2024 00:07               10808
function.preg-replace-callback.php                 29-May-2024 00:07               17777
function.preg-replace.php                          29-May-2024 00:07               25240
function.preg-split.php                            29-May-2024 00:07               12916
function.prev.php                                  29-May-2024 00:07                9118
function.print-r.php                               29-May-2024 00:07                9745
function.print.php                                 29-May-2024 00:07               17715
function.printf.php                                29-May-2024 00:07               28563
function.proc-close.php                            29-May-2024 00:07                3475
function.proc-get-status.php                       29-May-2024 00:07                6774
function.proc-nice.php                             29-May-2024 00:07                7869
function.proc-open.php                             29-May-2024 00:07               22889
function.proc-terminate.php                        29-May-2024 00:07                4842
function.property-exists.php                       29-May-2024 00:07                8777
function.ps-add-bookmark.php                       29-May-2024 00:07                5170
function.ps-add-launchlink.php                     29-May-2024 00:07                5888
function.ps-add-locallink.php                      29-May-2024 00:07                6672
function.ps-add-note.php                           29-May-2024 00:07                7398
function.ps-add-pdflink.php                        29-May-2024 00:07                7045
function.ps-add-weblink.php                        29-May-2024 00:07                5974
function.ps-arc.php                                29-May-2024 00:07                5392
function.ps-arcn.php                               29-May-2024 00:07                5398
function.ps-begin-page.php                         29-May-2024 00:07                7058
function.ps-begin-pattern.php                      29-May-2024 00:07               13487
function.ps-begin-template.php                     29-May-2024 00:07               11470
function.ps-circle.php                             29-May-2024 00:07                4911
function.ps-clip.php                               29-May-2024 00:07                3190
function.ps-close-image.php                        29-May-2024 00:07                4086
function.ps-close.php                              29-May-2024 00:07                3828
function.ps-closepath-stroke.php                   29-May-2024 00:07                3263
function.ps-closepath.php                          29-May-2024 00:07                3424
function.ps-continue-text.php                      29-May-2024 00:07                4236
function.ps-curveto.php                            29-May-2024 00:07                5267
function.ps-delete.php                             29-May-2024 00:07                3707
function.ps-end-page.php                           29-May-2024 00:07                3433
function.ps-end-pattern.php                        29-May-2024 00:07                3364
function.ps-end-template.php                       29-May-2024 00:07                3371
function.ps-fill-stroke.php                        29-May-2024 00:07                3469
function.ps-fill.php                               29-May-2024 00:07                3402
function.ps-findfont.php                           29-May-2024 00:07                7272
function.ps-get-buffer.php                         29-May-2024 00:07                3315
function.ps-get-parameter.php                      29-May-2024 00:07                8054
function.ps-get-value.php                          29-May-2024 00:07                9555
function.ps-hyphenate.php                          29-May-2024 00:07                7438
function.ps-include-file.php                       29-May-2024 00:07                3269
function.ps-lineto.php                             29-May-2024 00:07                8386
function.ps-makespotcolor.php                      29-May-2024 00:07               10289
function.ps-moveto.php                             29-May-2024 00:07                4001
function.ps-new.php                                29-May-2024 00:07                3134
function.ps-open-file.php                          29-May-2024 00:07                3842
function.ps-open-image-file.php                    29-May-2024 00:07                5047
function.ps-open-image.php                         29-May-2024 00:07                7134
function.ps-open-memory-image.php                  29-May-2024 00:07                2938
function.ps-place-image.php                        29-May-2024 00:07                5402
function.ps-rect.php                               29-May-2024 00:07                5122
function.ps-restore.php                            29-May-2024 00:07                3546
function.ps-rotate.php                             29-May-2024 00:07               12257
function.ps-save.php                               29-May-2024 00:07                3293
function.ps-scale.php                              29-May-2024 00:07                3910
function.ps-set-border-color.php                   29-May-2024 00:07                5028
function.ps-set-border-dash.php                    29-May-2024 00:07                4616
function.ps-set-border-style.php                   29-May-2024 00:07                4680
function.ps-set-info.php                           29-May-2024 00:07                6157
function.ps-set-parameter.php                      29-May-2024 00:07                4090
function.ps-set-text-pos.php                       29-May-2024 00:07                9463
function.ps-set-value.php                          29-May-2024 00:07                4902
function.ps-setcolor.php                           29-May-2024 00:07                6098
function.ps-setdash.php                            29-May-2024 00:07                3797
function.ps-setflat.php                            29-May-2024 00:07                3256
function.ps-setfont.php                            29-May-2024 00:07                4215
function.ps-setgray.php                            29-May-2024 00:07                3470
function.ps-setlinecap.php                         29-May-2024 00:07                3996
function.ps-setlinejoin.php                        29-May-2024 00:07                4014
function.ps-setlinewidth.php                       29-May-2024 00:07                3878
function.ps-setmiterlimit.php                      29-May-2024 00:07                4298
function.ps-setoverprintmode.php                   29-May-2024 00:07                3293
function.ps-setpolydash.php                        29-May-2024 00:07                7882
function.ps-shading-pattern.php                    29-May-2024 00:07                4405
function.ps-shading.php                            29-May-2024 00:07                7340
function.ps-shfill.php                             29-May-2024 00:07                4119
function.ps-show-boxed.php                         29-May-2024 00:07               12875
function.ps-show-xy.php                            29-May-2024 00:07                4398
function.ps-show-xy2.php                           29-May-2024 00:07                3251
function.ps-show.php                               29-May-2024 00:07                5903
function.ps-show2.php                              29-May-2024 00:07                3458
function.ps-string-geometry.php                    29-May-2024 00:07                4994
function.ps-stringwidth.php                        29-May-2024 00:07                4471
function.ps-stroke.php                             29-May-2024 00:07                3599
function.ps-symbol-name.php                        29-May-2024 00:07                3999
function.ps-symbol-width.php                       29-May-2024 00:07                4543
function.ps-symbol.php                             29-May-2024 00:07                3865
function.ps-translate.php                          29-May-2024 00:07               14276
function.pspell-add-to-personal.php                29-May-2024 00:07                6520
function.pspell-add-to-session.php                 29-May-2024 00:07                4167
function.pspell-check.php                          29-May-2024 00:07                5076
function.pspell-clear-session.php                  29-May-2024 00:07                5924
function.pspell-config-create.php                  29-May-2024 00:07                8088
function.pspell-config-data-dir.php                29-May-2024 00:07                3466
function.pspell-config-dict-dir.php                29-May-2024 00:07                3465
function.pspell-config-ignore.php                  29-May-2024 00:07                5808
function.pspell-config-mode.php                    29-May-2024 00:07                6652
function.pspell-config-personal.php                29-May-2024 00:07                6601
function.pspell-config-repl.php                    29-May-2024 00:07                6904
function.pspell-config-runtogether.php             29-May-2024 00:07                6461
function.pspell-config-save-repl.php               29-May-2024 00:07                5406
function.pspell-new-config.php                     29-May-2024 00:07                6447
function.pspell-new-personal.php                   29-May-2024 00:07               11041
function.pspell-new.php                            29-May-2024 00:07                9574
function.pspell-save-wordlist.php                  29-May-2024 00:07                6123
function.pspell-store-replacement.php              29-May-2024 00:07                7798
function.pspell-suggest.php                        29-May-2024 00:07                5612
function.putenv.php                                29-May-2024 00:07                4192
function.quoted-printable-decode.php               29-May-2024 00:07                5342
function.quoted-printable-encode.php               29-May-2024 00:07                5309
function.quotemeta.php                             29-May-2024 00:07                6087
function.rad2deg.php                               29-May-2024 00:07                3636
function.radius-acct-open.php                      29-May-2024 00:07                3291
function.radius-add-server.php                     29-May-2024 00:07                7855
function.radius-auth-open.php                      29-May-2024 00:07                3299
function.radius-close.php                          29-May-2024 00:07                2737
function.radius-config.php                         29-May-2024 00:07                4159
function.radius-create-request.php                 29-May-2024 00:07                5411
function.radius-cvt-addr.php                       29-May-2024 00:07                6263
function.radius-cvt-int.php                        29-May-2024 00:07                5663
function.radius-cvt-string.php                     29-May-2024 00:07                5717
function.radius-demangle-mppe-key.php              29-May-2024 00:07                3292
function.radius-demangle.php                       29-May-2024 00:07                3023
function.radius-get-attr.php                       29-May-2024 00:07                6517
function.radius-get-tagged-attr-data.php           29-May-2024 00:07                6624
function.radius-get-tagged-attr-tag.php            29-May-2024 00:07                6677
function.radius-get-vendor-attr.php                29-May-2024 00:07                8258
function.radius-put-addr.php                       29-May-2024 00:07                5696
function.radius-put-attr.php                       29-May-2024 00:07                8936
function.radius-put-int.php                        29-May-2024 00:07                7673
function.radius-put-string.php                     29-May-2024 00:07                8053
function.radius-put-vendor-addr.php                29-May-2024 00:07                5645
function.radius-put-vendor-attr.php                29-May-2024 00:07                7915
function.radius-put-vendor-int.php                 29-May-2024 00:07                6428
function.radius-put-vendor-string.php              29-May-2024 00:07                6821
function.radius-request-authenticator.php          29-May-2024 00:07                3225
function.radius-salt-encrypt-attr.php              29-May-2024 00:07                4332
function.radius-send-request.php                   29-May-2024 00:07                4065
function.radius-server-secret.php                  29-May-2024 00:07                2751
function.radius-strerror.php                       29-May-2024 00:07                2654
function.rand.php                                  29-May-2024 00:07               10314
function.random-bytes.php                          29-May-2024 00:07                9676
function.random-int.php                            29-May-2024 00:07                9547
function.range.php                                 29-May-2024 00:07                8017
function.rar-wrapper-cache-stats.php               29-May-2024 00:07                2410
function.rawurldecode.php                          29-May-2024 00:07                4844
function.rawurlencode.php                          29-May-2024 00:07                6503
function.read-exif-data.php                        29-May-2024 00:07                2562
function.readdir.php                               29-May-2024 00:07               10326
function.readfile.php                              29-May-2024 00:07               10208
function.readgzfile.php                            29-May-2024 00:07                4718
function.readline-add-history.php                  29-May-2024 00:07                2852
function.readline-callback-handler-install.php     29-May-2024 00:07                9535
function.readline-callback-handler-remove.php      29-May-2024 00:07                3957
function.readline-callback-read-char.php           29-May-2024 00:07                3874
function.readline-clear-history.php                29-May-2024 00:07                2582
function.readline-completion-function.php          29-May-2024 00:07                3117
function.readline-info.php                         29-May-2024 00:07                4972
function.readline-list-history.php                 29-May-2024 00:07                2395
function.readline-on-new-line.php                  29-May-2024 00:07                2731
function.readline-read-history.php                 29-May-2024 00:07                3556
function.readline-redisplay.php                    29-May-2024 00:07                2302
function.readline-write-history.php                29-May-2024 00:07                3512
function.readline.php                              29-May-2024 00:07                5202
function.readlink.php                              29-May-2024 00:07                4573
function.realpath-cache-get.php                    29-May-2024 00:07                4439
function.realpath-cache-size.php                   29-May-2024 00:07                3826
function.realpath.php                              29-May-2024 00:07                8778
function.recode-file.php                           29-May-2024 00:07                5702
function.recode-string.php                         29-May-2024 00:07                5039
function.recode.php                                29-May-2024 00:07                1773
function.register-shutdown-function.php            29-May-2024 00:07                7792
function.register-tick-function.php                29-May-2024 00:07                5573
function.rename.php                                29-May-2024 00:07                6235
function.require-once.php                          29-May-2024 00:07                1799
function.require.php                               29-May-2024 00:07                2134
function.reset.php                                 29-May-2024 00:07                9816
function.restore-error-handler.php                 29-May-2024 00:07                5879
function.restore-exception-handler.php             29-May-2024 00:07                6544
function.restore-include-path.php                  29-May-2024 00:07                5354
function.return.php                                29-May-2024 00:07                4978
function.rewind.php                                29-May-2024 00:07                6467
function.rewinddir.php                             29-May-2024 00:07                3647
function.rmdir.php                                 29-May-2024 00:07                5206
function.rnp-backend-string.php                    29-May-2024 00:07                2301
function.rnp-backend-version.php                   29-May-2024 00:07                2232
function.rnp-decrypt.php                           29-May-2024 00:07                3292
function.rnp-dump-packets-to-json.php              29-May-2024 00:07                3195
function.rnp-dump-packets.php                      29-May-2024 00:07                3149
function.rnp-ffi-create.php                        29-May-2024 00:07                3244
function.rnp-ffi-destroy.php                       29-May-2024 00:07                2482
function.rnp-ffi-set-pass-provider.php             29-May-2024 00:07                6797
function.rnp-import-keys.php                       29-May-2024 00:07                3544
function.rnp-import-signatures.php                 29-May-2024 00:07                3534
function.rnp-key-export-autocrypt.php              29-May-2024 00:07                4595
function.rnp-key-export-revocation.php             29-May-2024 00:07                5244
function.rnp-key-export.php                        29-May-2024 00:07                3514
function.rnp-key-get-info.php                      29-May-2024 00:07                8031
function.rnp-key-remove.php                        29-May-2024 00:07                3654
function.rnp-key-revoke.php                        29-May-2024 00:07                4890
function.rnp-list-keys.php                         29-May-2024 00:07                3197
function.rnp-load-keys-from-path.php               29-May-2024 00:07                3918
function.rnp-load-keys.php                         29-May-2024 00:07                3874
function.rnp-locate-key.php                        29-May-2024 00:07                3617
function.rnp-op-encrypt.php                        29-May-2024 00:07                7983
function.rnp-op-generate-key.php                   29-May-2024 00:07                7602
function.rnp-op-sign-cleartext.php                 29-May-2024 00:07                5252
function.rnp-op-sign-detached.php                  29-May-2024 00:07                5131
function.rnp-op-sign.php                           29-May-2024 00:07                6212
function.rnp-op-verify-detached.php                29-May-2024 00:07                7140
function.rnp-op-verify.php                         29-May-2024 00:07                6879
function.rnp-save-keys-to-path.php                 29-May-2024 00:07                3932
function.rnp-save-keys.php                         29-May-2024 00:07                3905
function.rnp-supported-features.php                29-May-2024 00:07                2963
function.rnp-version-string-full.php               29-May-2024 00:07                2317
function.rnp-version-string.php                    29-May-2024 00:07                2214
function.round.php                                 29-May-2024 00:07               24002
function.rpmaddtag.php                             29-May-2024 00:07                3377
function.rpmdbinfo.php                             29-May-2024 00:07                5259
function.rpmdbsearch.php                           29-May-2024 00:07                6159
function.rpmgetsymlink.php                         29-May-2024 00:07                2998
function.rpminfo.php                               29-May-2024 00:07                5441
function.rpmvercmp.php                             29-May-2024 00:07                4930
function.rrd-create.php                            29-May-2024 00:07                2993
function.rrd-error.php                             29-May-2024 00:07                2144
function.rrd-fetch.php                             29-May-2024 00:07                2976
function.rrd-first.php                             29-May-2024 00:07                2967
function.rrd-graph.php                             29-May-2024 00:07                3219
function.rrd-info.php                              29-May-2024 00:07                2552
function.rrd-last.php                              29-May-2024 00:07                2489
function.rrd-lastupdate.php                        29-May-2024 00:07                2682
function.rrd-restore.php                           29-May-2024 00:07                3377
function.rrd-tune.php                              29-May-2024 00:07                3059
function.rrd-update.php                            29-May-2024 00:07                3132
function.rrd-version.php                           29-May-2024 00:07                2238
function.rrd-xport.php                             29-May-2024 00:07                2726
function.rrdc-disconnect.php                       29-May-2024 00:07                2590
function.rsort.php                                 29-May-2024 00:07                9239
function.rtrim.php                                 29-May-2024 00:07                9659
function.runkit7-constant-add.php                  29-May-2024 00:07                4476
function.runkit7-constant-redefine.php             29-May-2024 00:07                4363
function.runkit7-constant-remove.php               29-May-2024 00:07                3681
function.runkit7-function-add.php                  29-May-2024 00:07                9786
function.runkit7-function-copy.php                 29-May-2024 00:07                5546
function.runkit7-function-redefine.php             29-May-2024 00:07               10246
function.runkit7-function-remove.php               29-May-2024 00:07                4195
function.runkit7-function-rename.php               29-May-2024 00:07                4472
function.runkit7-import.php                        29-May-2024 00:07                3869
function.runkit7-method-add.php                    29-May-2024 00:07               11805
function.runkit7-method-copy.php                   29-May-2024 00:07                7098
function.runkit7-method-redefine.php               29-May-2024 00:07               12241
function.runkit7-method-remove.php                 29-May-2024 00:07                6465
function.runkit7-method-rename.php                 29-May-2024 00:07                6627
function.runkit7-object-id.php                     29-May-2024 00:07                3794
function.runkit7-superglobals.php                  29-May-2024 00:07                2678
function.runkit7-zval-inspect.php                  29-May-2024 00:07                5145
function.sapi-windows-cp-conv.php                  29-May-2024 00:07                4928
function.sapi-windows-cp-get.php                   29-May-2024 00:07                3630
function.sapi-windows-cp-is-utf8.php               29-May-2024 00:07                3059
function.sapi-windows-cp-set.php                   29-May-2024 00:07                3200
function.sapi-windows-generate-ctrl-event.php      29-May-2024 00:07                7879
function.sapi-windows-set-ctrl-handler.php         29-May-2024 00:07                7751
function.sapi-windows-vt100-support.php            29-May-2024 00:07               11110
function.scandir.php                               29-May-2024 00:07                9114
function.scoutapm-get-calls.php                    29-May-2024 00:07                4501
function.scoutapm-list-instrumented-functions.php  29-May-2024 00:07                3836
function.seaslog-get-author.php                    29-May-2024 00:07                3158
function.seaslog-get-version.php                   29-May-2024 00:07                3154
function.sem-acquire.php                           29-May-2024 00:07                5336
function.sem-get.php                               29-May-2024 00:07                7175
function.sem-release.php                           29-May-2024 00:07                4350
function.sem-remove.php                            29-May-2024 00:07                4316
function.serialize.php                             29-May-2024 00:07               10800
function.session-abort.php                         29-May-2024 00:07                4298
function.session-cache-expire.php                  29-May-2024 00:07                8068
function.session-cache-limiter.php                 29-May-2024 00:07                9412
function.session-commit.php                        29-May-2024 00:07                1865
function.session-create-id.php                     29-May-2024 00:07               10217
function.session-decode.php                        29-May-2024 00:07                3892
function.session-destroy.php                       29-May-2024 00:07                9129
function.session-encode.php                        29-May-2024 00:07                4026
function.session-gc.php                            29-May-2024 00:07                7959
function.session-get-cookie-params.php             29-May-2024 00:07                5794
function.session-id.php                            29-May-2024 00:07                6495
function.session-module-name.php                   29-May-2024 00:07                4574
function.session-name.php                          29-May-2024 00:07                8206
function.session-regenerate-id.php                 29-May-2024 00:07               16202
function.session-register-shutdown.php             29-May-2024 00:07                2843
function.session-reset.php                         29-May-2024 00:07                4386
function.session-save-path.php                     29-May-2024 00:07                5093
function.session-set-cookie-params.php             29-May-2024 00:07               10856
function.session-set-save-handler.php              29-May-2024 00:07               24706
function.session-start.php                         29-May-2024 00:07               14840
function.session-status.php                        29-May-2024 00:07                3377
function.session-unset.php                         29-May-2024 00:07                4993
function.session-write-close.php                   29-May-2024 00:07                4314
function.set-error-handler.php                     29-May-2024 00:07               27592
function.set-exception-handler.php                 29-May-2024 00:07                8007
function.set-file-buffer.php                       29-May-2024 00:07                1840
function.set-include-path.php                      29-May-2024 00:07                6393
function.set-time-limit.php                        29-May-2024 00:07                4886
function.setcookie.php                             29-May-2024 00:07               27209
function.setlocale.php                             29-May-2024 00:07               15600
function.setrawcookie.php                          29-May-2024 00:07                6470
function.settype.php                               29-May-2024 00:07                6178
function.sha1-file.php                             29-May-2024 00:07                5757
function.sha1.php                                  29-May-2024 00:07                5979
function.shell-exec.php                            29-May-2024 00:07                5780
function.shm-attach.php                            29-May-2024 00:07                6066
function.shm-detach.php                            29-May-2024 00:07                4577
function.shm-get-var.php                           29-May-2024 00:07                4398
function.shm-has-var.php                           29-May-2024 00:07                4421
function.shm-put-var.php                           29-May-2024 00:07                5482
function.shm-remove-var.php                        29-May-2024 00:07                4320
function.shm-remove.php                            29-May-2024 00:07                4047
function.shmop-close.php                           29-May-2024 00:07                4907
function.shmop-delete.php                          29-May-2024 00:07                4295
function.shmop-open.php                            29-May-2024 00:07                9577
function.shmop-read.php                            29-May-2024 00:07                6772
function.shmop-size.php                            29-May-2024 00:07                4302
function.shmop-write.php                           29-May-2024 00:07                6233
function.show-source.php                           29-May-2024 00:07                1801
function.shuffle.php                               29-May-2024 00:07                6971
function.simdjson-decode.php                       29-May-2024 00:07               17065
function.simdjson-is-valid.php                     29-May-2024 00:07               10535
function.simdjson-key-count.php                    29-May-2024 00:07                4839
function.simdjson-key-exists.php                   29-May-2024 00:07                4634
function.simdjson-key-value.php                    29-May-2024 00:07                7389
function.similar-text.php                          29-May-2024 00:07                7286
function.simplexml-import-dom.php                  29-May-2024 00:07                6720
function.simplexml-load-file.php                   29-May-2024 00:07               10193
function.simplexml-load-string.php                 29-May-2024 00:07                9194
function.sin.php                                   29-May-2024 00:07                4572
function.sinh.php                                  29-May-2024 00:07                3216
function.sizeof.php                                29-May-2024 00:07                1678
function.sleep.php                                 29-May-2024 00:07                7481
function.snmp-get-quick-print.php                  29-May-2024 00:07                3741
function.snmp-get-valueretrieval.php               29-May-2024 00:07                4490
function.snmp-read-mib.php                         29-May-2024 00:07                4919
function.snmp-set-enum-print.php                   29-May-2024 00:07                5395
function.snmp-set-oid-numeric-print.php            29-May-2024 00:07                2363
function.snmp-set-oid-output-format.php            29-May-2024 00:07                7825
function.snmp-set-quick-print.php                  29-May-2024 00:07                7259
function.snmp-set-valueretrieval.php               29-May-2024 00:07                9544
function.snmp2-get.php                             29-May-2024 00:07                5833
function.snmp2-getnext.php                         29-May-2024 00:07                6201
function.snmp2-real-walk.php                       29-May-2024 00:07                6640
function.snmp2-set.php                             29-May-2024 00:07               11013
function.snmp2-walk.php                            29-May-2024 00:07                7125
function.snmp3-get.php                             29-May-2024 00:07                8936
function.snmp3-getnext.php                         29-May-2024 00:07                9264
function.snmp3-real-walk.php                       29-May-2024 00:07                9949
function.snmp3-set.php                             29-May-2024 00:07               13783
function.snmp3-walk.php                            29-May-2024 00:07               10409
function.snmpget.php                               29-May-2024 00:07                5827
function.snmpgetnext.php                           29-May-2024 00:07                6076
function.snmprealwalk.php                          29-May-2024 00:07                6510
function.snmpset.php                               29-May-2024 00:07               11044
function.snmpwalk.php                              29-May-2024 00:07                7146
function.snmpwalkoid.php                           29-May-2024 00:07                7806
function.socket-accept.php                         29-May-2024 00:07                6935
function.socket-addrinfo-bind.php                  29-May-2024 00:07                5486
function.socket-addrinfo-connect.php               29-May-2024 00:07                5278
function.socket-addrinfo-explain.php               29-May-2024 00:07                4518
function.socket-addrinfo-lookup.php                29-May-2024 00:07                6115
function.socket-atmark.php                         29-May-2024 00:07                5042
function.socket-bind.php                           29-May-2024 00:07               11627
function.socket-clear-error.php                    29-May-2024 00:07                4866
function.socket-close.php                          29-May-2024 00:07                4491
function.socket-cmsg-space.php                     29-May-2024 00:07                3805
function.socket-connect.php                        29-May-2024 00:07                7556
function.socket-create-listen.php                  29-May-2024 00:07                7217
function.socket-create-pair.php                    29-May-2024 00:07               20078
function.socket-create.php                         29-May-2024 00:07               12433
function.socket-export-stream.php                  29-May-2024 00:07                3576
function.socket-get-option.php                     29-May-2024 00:07               32779
function.socket-get-status.php                     29-May-2024 00:07                1850
function.socket-getopt.php                         29-May-2024 00:07                1837
function.socket-getpeername.php                    29-May-2024 00:07                8215
function.socket-getsockname.php                    29-May-2024 00:07                7668
function.socket-import-stream.php                  29-May-2024 00:07                5207
function.socket-last-error.php                     29-May-2024 00:07                7486
function.socket-listen.php                         29-May-2024 00:07                7300
function.socket-read.php                           29-May-2024 00:07                7890
function.socket-recv.php                           29-May-2024 00:07               16366
function.socket-recvfrom.php                       29-May-2024 00:07               13380
function.socket-recvmsg.php                        29-May-2024 00:07                4473
function.socket-select.php                         29-May-2024 00:07               16221
function.socket-send.php                           29-May-2024 00:07                6790
function.socket-sendmsg.php                        29-May-2024 00:07                4615
function.socket-sendto.php                         29-May-2024 00:07                9862
function.socket-set-block.php                      29-May-2024 00:07                6235
function.socket-set-blocking.php                   29-May-2024 00:07                1868
function.socket-set-nonblock.php                   29-May-2024 00:07                6720
function.socket-set-option.php                     29-May-2024 00:07               12113
function.socket-set-timeout.php                    29-May-2024 00:07                1837
function.socket-setopt.php                         29-May-2024 00:07                1831
function.socket-shutdown.php                       29-May-2024 00:07                4915
function.socket-strerror.php                       29-May-2024 00:07                7275
function.socket-write.php                          29-May-2024 00:07                7482
function.socket-wsaprotocol-info-export.php        29-May-2024 00:07                5129
function.socket-wsaprotocol-info-import.php        29-May-2024 00:07                4519
function.socket-wsaprotocol-info-release.php       29-May-2024 00:07                3695
function.sodium-add.php                            29-May-2024 00:07                3223
function.sodium-base642bin.php                     29-May-2024 00:07                4600
function.sodium-bin2base64.php                     29-May-2024 00:07                4130
function.sodium-bin2hex.php                        29-May-2024 00:07                2827
function.sodium-compare.php                        29-May-2024 00:07                3451
function.sodium-crypto-aead-aes256gcm-decrypt.php  29-May-2024 00:07                4839
function.sodium-crypto-aead-aes256gcm-encrypt.php  29-May-2024 00:07                4631
function.sodium-crypto-aead-aes256gcm-is-availa..> 29-May-2024 00:07                2880
function.sodium-crypto-aead-aes256gcm-keygen.php   29-May-2024 00:07                2870
function.sodium-crypto-aead-chacha20poly1305-de..> 29-May-2024 00:07                4704
function.sodium-crypto-aead-chacha20poly1305-en..> 29-May-2024 00:07                4520
function.sodium-crypto-aead-chacha20poly1305-ie..> 29-May-2024 00:07                4934
function.sodium-crypto-aead-chacha20poly1305-ie..> 29-May-2024 00:07                4686
function.sodium-crypto-aead-chacha20poly1305-ie..> 29-May-2024 00:07                3064
function.sodium-crypto-aead-chacha20poly1305-ke..> 29-May-2024 00:07                2999
function.sodium-crypto-aead-xchacha20poly1305-i..> 29-May-2024 00:07                5112
function.sodium-crypto-aead-xchacha20poly1305-i..> 29-May-2024 00:07                4904
function.sodium-crypto-aead-xchacha20poly1305-i..> 29-May-2024 00:07                3040
function.sodium-crypto-auth-keygen.php             29-May-2024 00:07                2691
function.sodium-crypto-auth-verify.php             29-May-2024 00:07                4024
function.sodium-crypto-auth.php                    29-May-2024 00:07                3483
function.sodium-crypto-box-keypair-from-secretk..> 29-May-2024 00:07                3562
function.sodium-crypto-box-keypair.php             29-May-2024 00:07                2972
function.sodium-crypto-box-open.php                29-May-2024 00:07                4139
function.sodium-crypto-box-publickey-from-secre..> 29-May-2024 00:07                3393
function.sodium-crypto-box-publickey.php           29-May-2024 00:07                3106
function.sodium-crypto-box-seal-open.php           29-May-2024 00:07                6189
function.sodium-crypto-box-seal.php                29-May-2024 00:07                7307
function.sodium-crypto-box-secretkey.php           29-May-2024 00:07                3073
function.sodium-crypto-box-seed-keypair.php        29-May-2024 00:07                3132
function.sodium-crypto-box.php                     29-May-2024 00:07                4449
function.sodium-crypto-core-ristretto255-add.php   29-May-2024 00:07                6177
function.sodium-crypto-core-ristretto255-from-h..> 29-May-2024 00:07                5537
function.sodium-crypto-core-ristretto255-is-val..> 29-May-2024 00:07                5702
function.sodium-crypto-core-ristretto255-random..> 29-May-2024 00:07                5693
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 00:07                6444
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 00:07                3681
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 00:07                5536
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 00:07                3940
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 00:07                5520
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 00:07                5852
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 00:07                3625
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 00:07                6435
function.sodium-crypto-core-ristretto255-sub.php   29-May-2024 00:07                6214
function.sodium-crypto-generichash-final.php       29-May-2024 00:07                6923
function.sodium-crypto-generichash-init.php        29-May-2024 00:07                6970
function.sodium-crypto-generichash-keygen.php      29-May-2024 00:07                2501
function.sodium-crypto-generichash-update.php      29-May-2024 00:07                6606
function.sodium-crypto-generichash.php             29-May-2024 00:07                3888
function.sodium-crypto-kdf-derive-from-key.php     29-May-2024 00:07                4099
function.sodium-crypto-kdf-keygen.php              29-May-2024 00:07                2603
function.sodium-crypto-kx-client-session-keys.php  29-May-2024 00:07                3515
function.sodium-crypto-kx-keypair.php              29-May-2024 00:07                5053
function.sodium-crypto-kx-publickey.php            29-May-2024 00:07                2925
function.sodium-crypto-kx-secretkey.php            29-May-2024 00:07                2936
function.sodium-crypto-kx-seed-keypair.php         29-May-2024 00:07                2873
function.sodium-crypto-kx-server-session-keys.php  29-May-2024 00:07                3581
function.sodium-crypto-pwhash-scryptsalsa208sha..> 29-May-2024 00:07                3478
function.sodium-crypto-pwhash-scryptsalsa208sha..> 29-May-2024 00:07                3681
function.sodium-crypto-pwhash-scryptsalsa208sha..> 29-May-2024 00:07                6581
function.sodium-crypto-pwhash-str-needs-rehash.php 29-May-2024 00:07                4058
function.sodium-crypto-pwhash-str-verify.php       29-May-2024 00:07                4885
function.sodium-crypto-pwhash-str.php              29-May-2024 00:07                8762
function.sodium-crypto-pwhash.php                  29-May-2024 00:07               10575
function.sodium-crypto-scalarmult-base.php         29-May-2024 00:07                2085
function.sodium-crypto-scalarmult-ristretto255-..> 29-May-2024 00:07                3594
function.sodium-crypto-scalarmult-ristretto255.php 29-May-2024 00:07                3943
function.sodium-crypto-scalarmult.php              29-May-2024 00:07                3107
function.sodium-crypto-secretbox-keygen.php        29-May-2024 00:07                6330
function.sodium-crypto-secretbox-open.php          29-May-2024 00:07                8944
function.sodium-crypto-secretbox.php               29-May-2024 00:07                8937
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 00:07               11049
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 00:07               10361
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 00:07                2767
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 00:07                5865
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 00:07                5973
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 00:07                3016
function.sodium-crypto-shorthash-keygen.php        29-May-2024 00:07                2750
function.sodium-crypto-shorthash.php               29-May-2024 00:07                3316
function.sodium-crypto-sign-detached.php           29-May-2024 00:07                3309
function.sodium-crypto-sign-ed25519-pk-to-curve..> 29-May-2024 00:07                2996
function.sodium-crypto-sign-ed25519-sk-to-curve..> 29-May-2024 00:07                3149
function.sodium-crypto-sign-keypair-from-secret..> 29-May-2024 00:07                3388
function.sodium-crypto-sign-keypair.php            29-May-2024 00:07                2489
function.sodium-crypto-sign-open.php               29-May-2024 00:07                3408
function.sodium-crypto-sign-publickey-from-secr..> 29-May-2024 00:07                2951
function.sodium-crypto-sign-publickey.php          29-May-2024 00:07                2961
function.sodium-crypto-sign-secretkey.php          29-May-2024 00:07                2937
function.sodium-crypto-sign-seed-keypair.php       29-May-2024 00:07                3170
function.sodium-crypto-sign-verify-detached.php    29-May-2024 00:07                3704
function.sodium-crypto-sign.php                    29-May-2024 00:07                3387
function.sodium-crypto-stream-keygen.php           29-May-2024 00:07                2672
function.sodium-crypto-stream-xchacha20-keygen.php 29-May-2024 00:07                2830
function.sodium-crypto-stream-xchacha20-xor-ic.php 29-May-2024 00:07                9883
function.sodium-crypto-stream-xchacha20-xor.php    29-May-2024 00:07                4934
function.sodium-crypto-stream-xchacha20.php        29-May-2024 00:07                3843
function.sodium-crypto-stream-xor.php              29-May-2024 00:07                3726
function.sodium-crypto-stream.php                  29-May-2024 00:07                3562
function.sodium-hex2bin.php                        29-May-2024 00:07                3435
function.sodium-increment.php                      29-May-2024 00:07                2556
function.sodium-memcmp.php                         29-May-2024 00:07                3755
function.sodium-memzero.php                        29-May-2024 00:07                2648
function.sodium-pad.php                            29-May-2024 00:07                2884
function.sodium-unpad.php                          29-May-2024 00:07                2839
function.solr-get-version.php                      29-May-2024 00:07                4008
function.sort.php                                  29-May-2024 00:07               12593
function.soundex.php                               29-May-2024 00:07                7338
function.spl-autoload-call.php                     29-May-2024 00:07                2685
function.spl-autoload-extensions.php               29-May-2024 00:07                5034
function.spl-autoload-functions.php                29-May-2024 00:07                3304
function.spl-autoload-register.php                 29-May-2024 00:07               13560
function.spl-autoload-unregister.php               29-May-2024 00:07                3146
function.spl-autoload.php                          29-May-2024 00:07                4742
function.spl-classes.php                           29-May-2024 00:07                3850
function.spl-object-hash.php                       29-May-2024 00:07                5087
function.spl-object-id.php                         29-May-2024 00:07                4177
function.sprintf.php                               29-May-2024 00:07               29355
function.sqlsrv-begin-transaction.php              29-May-2024 00:07               11322
function.sqlsrv-cancel.php                         29-May-2024 00:07               10392
function.sqlsrv-client-info.php                    29-May-2024 00:07                6803
function.sqlsrv-close.php                          29-May-2024 00:07                5661
function.sqlsrv-commit.php                         29-May-2024 00:07               11176
function.sqlsrv-configure.php                      29-May-2024 00:07                4795
function.sqlsrv-connect.php                        29-May-2024 00:07               12248
function.sqlsrv-errors.php                         29-May-2024 00:07               10092
function.sqlsrv-execute.php                        29-May-2024 00:07               10215
function.sqlsrv-fetch-array.php                    29-May-2024 00:07               15670
function.sqlsrv-fetch-object.php                   29-May-2024 00:07               12429
function.sqlsrv-fetch.php                          29-May-2024 00:07               10876
function.sqlsrv-field-metadata.php                 29-May-2024 00:07                8914
function.sqlsrv-free-stmt.php                      29-May-2024 00:07                7793
function.sqlsrv-get-config.php                     29-May-2024 00:07                3390
function.sqlsrv-get-field.php                      29-May-2024 00:07               10248
function.sqlsrv-has-rows.php                       29-May-2024 00:07                6407
function.sqlsrv-next-result.php                    29-May-2024 00:07                9321
function.sqlsrv-num-fields.php                     29-May-2024 00:07                8241
function.sqlsrv-num-rows.php                       29-May-2024 00:07                7968
function.sqlsrv-prepare.php                        29-May-2024 00:07               14586
function.sqlsrv-query.php                          29-May-2024 00:07               11939
function.sqlsrv-rollback.php                       29-May-2024 00:07               10646
function.sqlsrv-rows-affected.php                  29-May-2024 00:07                8018
function.sqlsrv-send-stream-data.php               29-May-2024 00:07                8587
function.sqlsrv-server-info.php                    29-May-2024 00:07                6212
function.sqrt.php                                  29-May-2024 00:07                4624
function.srand.php                                 29-May-2024 00:07                7223
function.sscanf.php                                29-May-2024 00:07               11989
function.ssdeep-fuzzy-compare.php                  29-May-2024 00:07                3326
function.ssdeep-fuzzy-hash-filename.php            29-May-2024 00:07                3046
function.ssdeep-fuzzy-hash.php                     29-May-2024 00:07                2888
function.ssh2-auth-agent.php                       29-May-2024 00:07                4823
function.ssh2-auth-hostbased-file.php              29-May-2024 00:07                7887
function.ssh2-auth-none.php                        29-May-2024 00:07                4991
function.ssh2-auth-password.php                    29-May-2024 00:07                5122
function.ssh2-auth-pubkey-file.php                 29-May-2024 00:07                7524
function.ssh2-connect.php                          29-May-2024 00:07               16125
function.ssh2-disconnect.php                       29-May-2024 00:07                3171
function.ssh2-exec.php                             29-May-2024 00:07                7668
function.ssh2-fetch-stream.php                     29-May-2024 00:07                5574
function.ssh2-fingerprint.php                      29-May-2024 00:07                5471
function.ssh2-forward-accept.php                   29-May-2024 00:07                3135
function.ssh2-forward-listen.php                   29-May-2024 00:07                4585
function.ssh2-methods-negotiated.php               29-May-2024 00:07                8119
function.ssh2-poll.php                             29-May-2024 00:07                3606
function.ssh2-publickey-add.php                    29-May-2024 00:07                8760
function.ssh2-publickey-init.php                   29-May-2024 00:07                4795
function.ssh2-publickey-list.php                   29-May-2024 00:07                9180
function.ssh2-publickey-remove.php                 29-May-2024 00:07                4997
function.ssh2-scp-recv.php                         29-May-2024 00:07                5558
function.ssh2-scp-send.php                         29-May-2024 00:07                6088
function.ssh2-send-eof.php                         29-May-2024 00:07                3537
function.ssh2-sftp-chmod.php                       29-May-2024 00:07                6058
function.ssh2-sftp-lstat.php                       29-May-2024 00:07                7525
function.ssh2-sftp-mkdir.php                       29-May-2024 00:07                6877
function.ssh2-sftp-readlink.php                    29-May-2024 00:07                5445
function.ssh2-sftp-realpath.php                    29-May-2024 00:07                5715
function.ssh2-sftp-rename.php                      29-May-2024 00:07                5603
function.ssh2-sftp-rmdir.php                       29-May-2024 00:07                5693
function.ssh2-sftp-stat.php                        29-May-2024 00:07                7493
function.ssh2-sftp-symlink.php                     29-May-2024 00:07                5932
function.ssh2-sftp-unlink.php                      29-May-2024 00:07                5164
function.ssh2-sftp.php                             29-May-2024 00:07                5568
function.ssh2-shell.php                            29-May-2024 00:07                8021
function.ssh2-tunnel.php                           29-May-2024 00:07                5385
function.stat.php                                  29-May-2024 00:07               16488
function.stats-absolute-deviation.php              29-May-2024 00:07                2884
function.stats-cdf-beta.php                        29-May-2024 00:07                5246
function.stats-cdf-binomial.php                    29-May-2024 00:07                5231
function.stats-cdf-cauchy.php                      29-May-2024 00:07                5266
function.stats-cdf-chisquare.php                   29-May-2024 00:07                4585
function.stats-cdf-exponential.php                 29-May-2024 00:07                4616
function.stats-cdf-f.php                           29-May-2024 00:07                5171
function.stats-cdf-gamma.php                       29-May-2024 00:07                5230
function.stats-cdf-laplace.php                     29-May-2024 00:07                5251
function.stats-cdf-logistic.php                    29-May-2024 00:07                5286
function.stats-cdf-negative-binomial.php           29-May-2024 00:07                5374
function.stats-cdf-noncentral-chisquare.php        29-May-2024 00:07                5476
function.stats-cdf-noncentral-f.php                29-May-2024 00:07                6050
function.stats-cdf-noncentral-t.php                29-May-2024 00:07                5336
function.stats-cdf-normal.php                      29-May-2024 00:07                5268
function.stats-cdf-poisson.php                     29-May-2024 00:07                4550
function.stats-cdf-t.php                           29-May-2024 00:07                4478
function.stats-cdf-uniform.php                     29-May-2024 00:07                5231
function.stats-cdf-weibull.php                     29-May-2024 00:07                5268
function.stats-covariance.php                      29-May-2024 00:07                3079
function.stats-dens-beta.php                       29-May-2024 00:07                3565
function.stats-dens-cauchy.php                     29-May-2024 00:07                3623
function.stats-dens-chisquare.php                  29-May-2024 00:07                3293
function.stats-dens-exponential.php                29-May-2024 00:07                3283
function.stats-dens-f.php                          29-May-2024 00:07                3563
function.stats-dens-gamma.php                      29-May-2024 00:07                3616
function.stats-dens-laplace.php                    29-May-2024 00:07                3650
function.stats-dens-logistic.php                   29-May-2024 00:07                3662
function.stats-dens-normal.php                     29-May-2024 00:07                3633
function.stats-dens-pmf-binomial.php               29-May-2024 00:07                3687
function.stats-dens-pmf-hypergeometric.php         29-May-2024 00:07                4339
function.stats-dens-pmf-negative-binomial.php      29-May-2024 00:07                3816
function.stats-dens-pmf-poisson.php                29-May-2024 00:07                3284
function.stats-dens-t.php                          29-May-2024 00:07                3197
function.stats-dens-uniform.php                    29-May-2024 00:07                3598
function.stats-dens-weibull.php                    29-May-2024 00:07                3630
function.stats-harmonic-mean.php                   29-May-2024 00:07                2778
function.stats-kurtosis.php                        29-May-2024 00:07                2786
function.stats-rand-gen-beta.php                   29-May-2024 00:07                3092
function.stats-rand-gen-chisquare.php              29-May-2024 00:07                2765
function.stats-rand-gen-exponential.php            29-May-2024 00:07                2763
function.stats-rand-gen-f.php                      29-May-2024 00:07                3146
function.stats-rand-gen-funiform.php               29-May-2024 00:07                3073
function.stats-rand-gen-gamma.php                  29-May-2024 00:07                3159
function.stats-rand-gen-ibinomial-negative.php     29-May-2024 00:07                3239
function.stats-rand-gen-ibinomial.php              29-May-2024 00:07                3163
function.stats-rand-gen-int.php                    29-May-2024 00:07                2342
function.stats-rand-gen-ipoisson.php               29-May-2024 00:07                2738
function.stats-rand-gen-iuniform.php               29-May-2024 00:07                3140
function.stats-rand-gen-noncentral-chisquare.php   29-May-2024 00:07                3281
function.stats-rand-gen-noncentral-f.php           29-May-2024 00:07                3634
function.stats-rand-gen-noncentral-t.php           29-May-2024 00:07                3194
function.stats-rand-gen-normal.php                 29-May-2024 00:07                3107
function.stats-rand-gen-t.php                      29-May-2024 00:07                2657
function.stats-rand-get-seeds.php                  29-May-2024 00:07                2385
function.stats-rand-phrase-to-seeds.php            29-May-2024 00:07                2746
function.stats-rand-ranf.php                       29-May-2024 00:07                2386
function.stats-rand-setall.php                     29-May-2024 00:07                3015
function.stats-skew.php                            29-May-2024 00:07                2752
function.stats-standard-deviation.php              29-May-2024 00:07                3924
function.stats-stat-binomial-coef.php              29-May-2024 00:07                3052
function.stats-stat-correlation.php                29-May-2024 00:07                3259
function.stats-stat-factorial.php                  29-May-2024 00:07                2625
function.stats-stat-independent-t.php              29-May-2024 00:07                3376
function.stats-stat-innerproduct.php               29-May-2024 00:07                3201
function.stats-stat-paired-t.php                   29-May-2024 00:07                3138
function.stats-stat-percentile.php                 29-May-2024 00:07                3004
function.stats-stat-powersum.php                   29-May-2024 00:07                2996
function.stats-variance.php                        29-May-2024 00:07                3423
function.stomp-connect-error.php                   29-May-2024 00:07                3762
function.stomp-version.php                         29-May-2024 00:07                3188
function.str-contains.php                          29-May-2024 00:07                8336
function.str-decrement.php                         29-May-2024 00:07                6575
function.str-ends-with.php                         29-May-2024 00:07                8406
function.str-getcsv.php                            29-May-2024 00:07                9230
function.str-increment.php                         29-May-2024 00:07                6262
function.str-ireplace.php                          29-May-2024 00:07                9682
function.str-pad.php                               29-May-2024 00:07                8362
function.str-repeat.php                            29-May-2024 00:07                4753
function.str-replace.php                           29-May-2024 00:07               17154
function.str-rot13.php                             29-May-2024 00:07                3767
function.str-shuffle.php                           29-May-2024 00:07                6198
function.str-split.php                             29-May-2024 00:07                9058
function.str-starts-with.php                       29-May-2024 00:07                8456
function.str-word-count.php                        29-May-2024 00:07                9421
function.strcasecmp.php                            29-May-2024 00:07                6632
function.strchr.php                                29-May-2024 00:07                1701
function.strcmp.php                                29-May-2024 00:07                6362
function.strcoll.php                               29-May-2024 00:07                5560
function.strcspn.php                               29-May-2024 00:07               11607
function.stream-bucket-append.php                  29-May-2024 00:07                2321
function.stream-bucket-make-writeable.php          29-May-2024 00:07                4460
function.stream-bucket-new.php                     29-May-2024 00:07                2354
function.stream-bucket-prepend.php                 29-May-2024 00:07                6319
function.stream-context-create.php                 29-May-2024 00:07                8182
function.stream-context-get-default.php            29-May-2024 00:07                9042
function.stream-context-get-options.php            29-May-2024 00:07                4589
function.stream-context-get-params.php             29-May-2024 00:07                5797
function.stream-context-set-default.php            29-May-2024 00:07                6384
function.stream-context-set-option.php             29-May-2024 00:07                5693
function.stream-context-set-options.php            29-May-2024 00:07                6525
function.stream-context-set-params.php             29-May-2024 00:07                5084
function.stream-copy-to-stream.php                 29-May-2024 00:07                7978
function.stream-filter-append.php                  29-May-2024 00:07               11177
function.stream-filter-prepend.php                 29-May-2024 00:07                8607
function.stream-filter-register.php                29-May-2024 00:07               18583
function.stream-filter-remove.php                  29-May-2024 00:07                6807
function.stream-get-contents.php                   29-May-2024 00:07                9191
function.stream-get-filters.php                    29-May-2024 00:07                4273
function.stream-get-line.php                       29-May-2024 00:07                5071
function.stream-get-meta-data.php                  29-May-2024 00:07               16033
function.stream-get-transports.php                 29-May-2024 00:07                4270
function.stream-get-wrappers.php                   29-May-2024 00:07                5019
function.stream-is-local.php                       29-May-2024 00:07                4470
function.stream-isatty.php                         29-May-2024 00:07                4111
function.stream-notification-callback.php          29-May-2024 00:07               22503
function.stream-register-wrapper.php               29-May-2024 00:07                1971
function.stream-resolve-include-path.php           29-May-2024 00:07                4255
function.stream-select.php                         29-May-2024 00:07               16181
function.stream-set-blocking.php                   29-May-2024 00:07                4833
function.stream-set-chunk-size.php                 29-May-2024 00:07                4389
function.stream-set-read-buffer.php                29-May-2024 00:07                3859
function.stream-set-timeout.php                    29-May-2024 00:07                8320
function.stream-set-write-buffer.php               29-May-2024 00:07                6007
function.stream-socket-accept.php                  29-May-2024 00:07                7884
function.stream-socket-client.php                  29-May-2024 00:07               18204
function.stream-socket-enable-crypto.php           29-May-2024 00:07               12508
function.stream-socket-get-name.php                29-May-2024 00:07                3959
function.stream-socket-pair.php                    29-May-2024 00:07                9915
function.stream-socket-recvfrom.php                29-May-2024 00:07               10801
function.stream-socket-sendto.php                  29-May-2024 00:07                7589
function.stream-socket-server.php                  29-May-2024 00:07               16101
function.stream-socket-shutdown.php                29-May-2024 00:07                6684
function.stream-supports-lock.php                  29-May-2024 00:07                3348
function.stream-wrapper-register.php               29-May-2024 00:07                9461
function.stream-wrapper-restore.php                29-May-2024 00:07                3076
function.stream-wrapper-unregister.php             29-May-2024 00:07                3281
function.strftime.php                              29-May-2024 00:07               55711
function.strip-tags.php                            29-May-2024 00:07                9708
function.stripcslashes.php                         29-May-2024 00:07                4080
function.stripos.php                               29-May-2024 00:07               12465
function.stripslashes.php                          29-May-2024 00:07                7709
function.stristr.php                               29-May-2024 00:07               10524
function.strlen.php                                29-May-2024 00:07                5513
function.strnatcasecmp.php                         29-May-2024 00:07                7914
function.strnatcmp.php                             29-May-2024 00:07                9330
function.strncasecmp.php                           29-May-2024 00:07                7175
function.strncmp.php                               29-May-2024 00:07                7101
function.strpbrk.php                               29-May-2024 00:07                5436
function.strpos.php                                29-May-2024 00:07               14189
function.strptime.php                              29-May-2024 00:07               11946
function.strrchr.php                               29-May-2024 00:07                8239
function.strrev.php                                29-May-2024 00:07                3229
function.strripos.php                              29-May-2024 00:07               11001
function.strrpos.php                               29-May-2024 00:07               13475
function.strspn.php                                29-May-2024 00:07               10284
function.strstr.php                                29-May-2024 00:07                8804
function.strtok.php                                29-May-2024 00:07               12722
function.strtolower.php                            29-May-2024 00:07                6247
function.strtotime.php                             29-May-2024 00:07               12929
function.strtoupper.php                            29-May-2024 00:07                6208
function.strtr.php                                 29-May-2024 00:07               11293
function.strval.php                                29-May-2024 00:07                6540
function.substr-compare.php                        29-May-2024 00:07               11238
function.substr-count.php                          29-May-2024 00:07                9839
function.substr-replace.php                        29-May-2024 00:07               16279
function.substr.php                                29-May-2024 00:07               23272
function.svn-add.php                               29-May-2024 00:07                6544
function.svn-auth-get-parameter.php                29-May-2024 00:07                4046
function.svn-auth-set-parameter.php                29-May-2024 00:07                5486
function.svn-blame.php                             29-May-2024 00:07                5051
function.svn-cat.php                               29-May-2024 00:07                4909
function.svn-checkout.php                          29-May-2024 00:07                7543
function.svn-cleanup.php                           29-May-2024 00:07                5313
function.svn-client-version.php                    29-May-2024 00:07                3569
function.svn-commit.php                            29-May-2024 00:07                8232
function.svn-delete.php                            29-May-2024 00:07                4874
function.svn-diff.php                              29-May-2024 00:07               13523
function.svn-export.php                            29-May-2024 00:07                5433
function.svn-fs-abort-txn.php                      29-May-2024 00:07                3290
function.svn-fs-apply-text.php                     29-May-2024 00:07                2846
function.svn-fs-begin-txn2.php                     29-May-2024 00:07                2789
function.svn-fs-change-node-prop.php               29-May-2024 00:07                3317
function.svn-fs-check-path.php                     29-May-2024 00:07                2891
function.svn-fs-contents-changed.php               29-May-2024 00:07                3322
function.svn-fs-copy.php                           29-May-2024 00:07                4283
function.svn-fs-delete.php                         29-May-2024 00:07                3568
function.svn-fs-dir-entries.php                    29-May-2024 00:07                2904
function.svn-fs-file-contents.php                  29-May-2024 00:07                2927
function.svn-fs-file-length.php                    29-May-2024 00:07                2850
function.svn-fs-is-dir.php                         29-May-2024 00:07                3607
function.svn-fs-is-file.php                        29-May-2024 00:07                3595
function.svn-fs-make-dir.php                       29-May-2024 00:07                3592
function.svn-fs-make-file.php                      29-May-2024 00:07                3609
function.svn-fs-node-created-rev.php               29-May-2024 00:07                2893
function.svn-fs-node-prop.php                      29-May-2024 00:07                2991
function.svn-fs-props-changed.php                  29-May-2024 00:07                3309
function.svn-fs-revision-prop.php                  29-May-2024 00:07                3004
function.svn-fs-revision-root.php                  29-May-2024 00:07                2872
function.svn-fs-txn-root.php                       29-May-2024 00:07                2637
function.svn-fs-youngest-rev.php                   29-May-2024 00:07                2679
function.svn-import.php                            29-May-2024 00:07                6203
function.svn-log.php                               29-May-2024 00:07                9179
function.svn-ls.php                                29-May-2024 00:07                7433
function.svn-mkdir.php                             29-May-2024 00:07                3348
function.svn-repos-create.php                      29-May-2024 00:07                3057
function.svn-repos-fs-begin-txn-for-commit.php     29-May-2024 00:07                3377
function.svn-repos-fs-commit-txn.php               29-May-2024 00:07                2734
function.svn-repos-fs.php                          29-May-2024 00:07                2634
function.svn-repos-hotcopy.php                     29-May-2024 00:07                3003
function.svn-repos-open.php                        29-May-2024 00:07                2606
function.svn-repos-recover.php                     29-May-2024 00:07                2650
function.svn-revert.php                            29-May-2024 00:07                3685
function.svn-status.php                            29-May-2024 00:07               14867
function.svn-update.php                            29-May-2024 00:07                6342
function.swoole-async-dns-lookup.php               29-May-2024 00:07                3926
function.swoole-async-read.php                     29-May-2024 00:07                4524
function.swoole-async-readfile.php                 29-May-2024 00:07                3946
function.swoole-async-set.php                      29-May-2024 00:07                2473
function.swoole-async-write.php                    29-May-2024 00:07                3826
function.swoole-async-writefile.php                29-May-2024 00:07                3854
function.swoole-clear-error.php                    29-May-2024 00:07                2342
function.swoole-client-select.php                  29-May-2024 00:07                3556
function.swoole-cpu-num.php                        29-May-2024 00:07                2194
function.swoole-errno.php                          29-May-2024 00:07                2171
function.swoole-error-log.php                      29-May-2024 00:07                3624
function.swoole-event-add.php                      29-May-2024 00:07                3563
function.swoole-event-defer.php                    29-May-2024 00:07                2709
function.swoole-event-del.php                      29-May-2024 00:07                2675
function.swoole-event-exit.php                     29-May-2024 00:07                2237
function.swoole-event-set.php                      29-May-2024 00:07                3551
function.swoole-event-wait.php                     29-May-2024 00:07                2208
function.swoole-event-write.php                    29-May-2024 00:07                2947
function.swoole-get-local-ip.php                   29-May-2024 00:07                2265
function.swoole-last-error.php                     29-May-2024 00:07                2220
function.swoole-load-module.php                    29-May-2024 00:07                2378
function.swoole-select.php                         29-May-2024 00:07                3523
function.swoole-set-process-name.php               29-May-2024 00:07                2696
function.swoole-strerror.php                       29-May-2024 00:07                2650
function.swoole-timer-after.php                    29-May-2024 00:07                3074
function.swoole-timer-exists.php                   29-May-2024 00:07                2487
function.swoole-timer-tick.php                     29-May-2024 00:07                2951
function.swoole-version.php                        29-May-2024 00:07                2199
function.symlink.php                               29-May-2024 00:07                5762
function.sys-get-temp-dir.php                      29-May-2024 00:07                4233
function.sys-getloadavg.php                        29-May-2024 00:07                4160
function.syslog.php                                29-May-2024 00:07                9667
function.system.php                                29-May-2024 00:07                7777
function.taint.php                                 29-May-2024 00:07                2731
function.tan.php                                   29-May-2024 00:07                4302
function.tanh.php                                  29-May-2024 00:07                3226
function.tcpwrap-check.php                         29-May-2024 00:07                6012
function.tempnam.php                               29-May-2024 00:07                7269
function.textdomain.php                            29-May-2024 00:07                3367
function.tidy-access-count.php                     29-May-2024 00:07                6510
function.tidy-config-count.php                     29-May-2024 00:07                4312
function.tidy-error-count.php                      29-May-2024 00:07                5369
function.tidy-get-output.php                       29-May-2024 00:07                4382
function.tidy-warning-count.php                    29-May-2024 00:07                4921
function.time-nanosleep.php                        29-May-2024 00:07                8711
function.time-sleep-until.php                      29-May-2024 00:07                5874
function.time.php                                  29-May-2024 00:07                4745
function.timezone-abbreviations-list.php           29-May-2024 00:07                1976
function.timezone-identifiers-list.php             29-May-2024 00:07                1992
function.timezone-location-get.php                 29-May-2024 00:07                1948
function.timezone-name-from-abbr.php               29-May-2024 00:07                6612
function.timezone-name-get.php                     29-May-2024 00:07                1893
function.timezone-offset-get.php                   29-May-2024 00:07                1890
function.timezone-open.php                         29-May-2024 00:07                1862
function.timezone-transitions-get.php              29-May-2024 00:07                1954
function.timezone-version-get.php                  29-May-2024 00:07                4370
function.tmpfile.php                               29-May-2024 00:07                5603
function.token-get-all.php                         29-May-2024 00:07               11968
function.token-name.php                            29-May-2024 00:07                4349
function.touch.php                                 29-May-2024 00:07                8063
function.trader-acos.php                           29-May-2024 00:07                2532
function.trader-ad.php                             29-May-2024 00:07                3444
function.trader-add.php                            29-May-2024 00:07                2861
function.trader-adosc.php                          29-May-2024 00:07                4304
function.trader-adx.php                            29-May-2024 00:07                3530
function.trader-adxr.php                           29-May-2024 00:07                3541
function.trader-apo.php                            29-May-2024 00:07                3730
function.trader-aroon.php                          29-May-2024 00:07                3098
function.trader-aroonosc.php                       29-May-2024 00:07                3135
function.trader-asin.php                           29-May-2024 00:07                2545
function.trader-atan.php                           29-May-2024 00:07                2538
function.trader-atr.php                            29-May-2024 00:07                3520
function.trader-avgprice.php                       29-May-2024 00:07                3501
function.trader-bbands.php                         29-May-2024 00:07                4489
function.trader-beta.php                           29-May-2024 00:07                3066
function.trader-bop.php                            29-May-2024 00:07                3450
function.trader-cci.php                            29-May-2024 00:07                3525
function.trader-cdl2crows.php                      29-May-2024 00:07                3523
function.trader-cdl3blackcrows.php                 29-May-2024 00:07                3585
function.trader-cdl3inside.php                     29-May-2024 00:07                3566
function.trader-cdl3linestrike.php                 29-May-2024 00:07                3589
function.trader-cdl3outside.php                    29-May-2024 00:07                3581
function.trader-cdl3starsinsouth.php               29-May-2024 00:07                3630
function.trader-cdl3whitesoldiers.php              29-May-2024 00:07                3654
function.trader-cdlabandonedbaby.php               29-May-2024 00:07                4042
function.trader-cdladvanceblock.php                29-May-2024 00:07                3607
function.trader-cdlbelthold.php                    29-May-2024 00:07                3563
function.trader-cdlbreakaway.php                   29-May-2024 00:07                3577
function.trader-cdlclosingmarubozu.php             29-May-2024 00:07                3648
function.trader-cdlconcealbabyswall.php            29-May-2024 00:07                3671
function.trader-cdlcounterattack.php               29-May-2024 00:07                3635
function.trader-cdldarkcloudcover.php              29-May-2024 00:07                4036
function.trader-cdldoji.php                        29-May-2024 00:07                3520
function.trader-cdldojistar.php                    29-May-2024 00:07                3555
function.trader-cdldragonflydoji.php               29-May-2024 00:07                3610
function.trader-cdlengulfing.php                   29-May-2024 00:07                3595
function.trader-cdleveningdojistar.php             29-May-2024 00:07                4053
function.trader-cdleveningstar.php                 29-May-2024 00:07                4030
function.trader-cdlgapsidesidewhite.php            29-May-2024 00:07                3678
function.trader-cdlgravestonedoji.php              29-May-2024 00:07                3631
function.trader-cdlhammer.php                      29-May-2024 00:07                3546
function.trader-cdlhangingman.php                  29-May-2024 00:07                3567
function.trader-cdlharami.php                      29-May-2024 00:07                3548
function.trader-cdlharamicross.php                 29-May-2024 00:07                3590
function.trader-cdlhighwave.php                    29-May-2024 00:07                3564
function.trader-cdlhikkake.php                     29-May-2024 00:07                3553
function.trader-cdlhikkakemod.php                  29-May-2024 00:07                3594
function.trader-cdlhomingpigeon.php                29-May-2024 00:07                3615
function.trader-cdlidentical3crows.php             29-May-2024 00:07                3639
function.trader-cdlinneck.php                      29-May-2024 00:07                3565
function.trader-cdlinvertedhammer.php              29-May-2024 00:07                3613
function.trader-cdlkicking.php                     29-May-2024 00:07                3567
function.trader-cdlkickingbylength.php             29-May-2024 00:07                3673
function.trader-cdlladderbottom.php                29-May-2024 00:07                3623
function.trader-cdllongleggeddoji.php              29-May-2024 00:07                3628
function.trader-cdllongline.php                    29-May-2024 00:07                3572
function.trader-cdlmarubozu.php                    29-May-2024 00:07                3558
function.trader-cdlmatchinglow.php                 29-May-2024 00:07                3584
function.trader-cdlmathold.php                     29-May-2024 00:07                3976
function.trader-cdlmorningdojistar.php             29-May-2024 00:07                4049
function.trader-cdlmorningstar.php                 29-May-2024 00:07                4010
function.trader-cdlonneck.php                      29-May-2024 00:07                3545
function.trader-cdlpiercing.php                    29-May-2024 00:07                3562
function.trader-cdlrickshawman.php                 29-May-2024 00:07                3602
function.trader-cdlrisefall3methods.php            29-May-2024 00:07                3672
function.trader-cdlseparatinglines.php             29-May-2024 00:07                3654
function.trader-cdlshootingstar.php                29-May-2024 00:07                3613
function.trader-cdlshortline.php                   29-May-2024 00:07                3585
function.trader-cdlspinningtop.php                 29-May-2024 00:07                3600
function.trader-cdlstalledpattern.php              29-May-2024 00:07                3635
function.trader-cdlsticksandwich.php               29-May-2024 00:07                3616
function.trader-cdltakuri.php                      29-May-2024 00:07                3587
function.trader-cdltasukigap.php                   29-May-2024 00:07                3562
function.trader-cdlthrusting.php                   29-May-2024 00:07                3571
function.trader-cdltristar.php                     29-May-2024 00:07                3559
function.trader-cdlunique3river.php                29-May-2024 00:07                3610
function.trader-cdlupsidegap2crows.php             29-May-2024 00:07                3658
function.trader-cdlxsidegap3methods.php            29-May-2024 00:07                3657
function.trader-ceil.php                           29-May-2024 00:07                2562
function.trader-cmo.php                            29-May-2024 00:07                2779
function.trader-correl.php                         29-May-2024 00:07                3118
function.trader-cos.php                            29-May-2024 00:07                2528
function.trader-cosh.php                           29-May-2024 00:07                2544
function.trader-dema.php                           29-May-2024 00:07                2790
function.trader-div.php                            29-May-2024 00:07                2877
function.trader-dx.php                             29-May-2024 00:07                3506
function.trader-ema.php                            29-May-2024 00:07                2773
function.trader-errno.php                          29-May-2024 00:07                2264
function.trader-exp.php                            29-May-2024 00:07                2572
function.trader-floor.php                          29-May-2024 00:07                2554
function.trader-get-compat.php                     29-May-2024 00:07                2454
function.trader-get-unstable-period.php            29-May-2024 00:07                2776
function.trader-ht-dcperiod.php                    29-May-2024 00:07                2542
function.trader-ht-dcphase.php                     29-May-2024 00:07                2513
function.trader-ht-phasor.php                      29-May-2024 00:07                2494
function.trader-ht-sine.php                        29-May-2024 00:07                2473
function.trader-ht-trendline.php                   29-May-2024 00:07                2534
function.trader-ht-trendmode.php                   29-May-2024 00:07                2524
function.trader-kama.php                           29-May-2024 00:07                2828
function.trader-linearreg-angle.php                29-May-2024 00:07                2922
function.trader-linearreg-intercept.php            29-May-2024 00:07                2980
function.trader-linearreg-slope.php                29-May-2024 00:07                2932
function.trader-linearreg.php                      29-May-2024 00:07                2844
function.trader-ln.php                             29-May-2024 00:07                2530
function.trader-log10.php                          29-May-2024 00:07                2534
function.trader-ma.php                             29-May-2024 00:07                3194
function.trader-macd.php                           29-May-2024 00:07                3715
function.trader-macdext.php                        29-May-2024 00:07                5208
function.trader-macdfix.php                        29-May-2024 00:07                2874
function.trader-mama.php                           29-May-2024 00:07                3215
function.trader-mavp.php                           29-May-2024 00:07                4122
function.trader-max.php                            29-May-2024 00:07                2794
function.trader-maxindex.php                       29-May-2024 00:07                2851
function.trader-medprice.php                       29-May-2024 00:07                2765
function.trader-mfi.php                            29-May-2024 00:07                3869
function.trader-midpoint.php                       29-May-2024 00:07                2825
function.trader-midprice.php                       29-May-2024 00:07                3149
function.trader-min.php                            29-May-2024 00:07                2801
function.trader-minindex.php                       29-May-2024 00:07                2846
function.trader-minmax.php                         29-May-2024 00:07                2850
function.trader-minmaxindex.php                    29-May-2024 00:07                2901
function.trader-minus-di.php                       29-May-2024 00:07                3593
function.trader-minus-dm.php                       29-May-2024 00:07                3149
function.trader-mom.php                            29-May-2024 00:07                2765
function.trader-mult.php                           29-May-2024 00:07                2877
function.trader-natr.php                           29-May-2024 00:07                3531
function.trader-obv.php                            29-May-2024 00:07                2718
function.trader-plus-di.php                        29-May-2024 00:07                3564
function.trader-plus-dm.php                        29-May-2024 00:07                3136
function.trader-ppo.php                            29-May-2024 00:07                3734
function.trader-roc.php                            29-May-2024 00:07                2789
function.trader-rocp.php                           29-May-2024 00:07                2817
function.trader-rocr.php                           29-May-2024 00:07                2802
function.trader-rocr100.php                        29-May-2024 00:07                2842
function.trader-rsi.php                            29-May-2024 00:07                2770
function.trader-sar.php                            29-May-2024 00:07                3780
function.trader-sarext.php                         29-May-2024 00:07                7192
function.trader-set-compat.php                     29-May-2024 00:07                2682
function.trader-set-unstable-period.php            29-May-2024 00:07                3270
function.trader-sin.php                            29-May-2024 00:07                2552
function.trader-sinh.php                           29-May-2024 00:07                2540
function.trader-sma.php                            29-May-2024 00:07                2770
function.trader-sqrt.php                           29-May-2024 00:07                2533
function.trader-stddev.php                         29-May-2024 00:07                3114
function.trader-stoch.php                          29-May-2024 00:07                5398
function.trader-stochf.php                         29-May-2024 00:07                4505
function.trader-stochrsi.php                       29-May-2024 00:07                4247
function.trader-sub.php                            29-May-2024 00:07                2882
function.trader-sum.php                            29-May-2024 00:07                2752
function.trader-t3.php                             29-May-2024 00:07                3131
function.trader-tan.php                            29-May-2024 00:07                2521
function.trader-tanh.php                           29-May-2024 00:07                2545
function.trader-tema.php                           29-May-2024 00:07                2796
function.trader-trange.php                         29-May-2024 00:07                3053
function.trader-trima.php                          29-May-2024 00:07                2798
function.trader-trix.php                           29-May-2024 00:07                2808
function.trader-tsf.php                            29-May-2024 00:07                2777
function.trader-typprice.php                       29-May-2024 00:07                3076
function.trader-ultosc.php                         29-May-2024 00:07                4388
function.trader-var.php                            29-May-2024 00:07                3084
function.trader-wclprice.php                       29-May-2024 00:07                3081
function.trader-willr.php                          29-May-2024 00:07                3537
function.trader-wma.php                            29-May-2024 00:07                2806
function.trait-exists.php                          29-May-2024 00:07                3311
function.trigger-error.php                         29-May-2024 00:07                6709
function.trim.php                                  29-May-2024 00:07               13028
function.uasort.php                                29-May-2024 00:07               10295
function.ucfirst.php                               29-May-2024 00:07                6307
function.ucwords.php                               29-May-2024 00:07               10047
function.ui-draw-text-font-fontfamilies.php        29-May-2024 00:07                2469
function.ui-quit.php                               29-May-2024 00:07                2104
function.ui-run.php                                29-May-2024 00:07                2476
function.uksort.php                                29-May-2024 00:07               10028
function.umask.php                                 29-May-2024 00:07                5928
function.uniqid.php                                29-May-2024 00:07                8665
function.unixtojd.php                              29-May-2024 00:07                4220
function.unlink.php                                29-May-2024 00:07                6211
function.unpack.php                                29-May-2024 00:07               10919
function.unregister-tick-function.php              29-May-2024 00:07                3333
function.unserialize.php                           29-May-2024 00:07               17333
function.unset.php                                 29-May-2024 00:07               15195
function.untaint.php                               29-May-2024 00:07                2587
function.uopz-add-function.php                     29-May-2024 00:07                7215
function.uopz-allow-exit.php                       29-May-2024 00:07                4682
function.uopz-backup.php                           29-May-2024 00:07                4645
function.uopz-compose.php                          29-May-2024 00:07                6917
function.uopz-copy.php                             29-May-2024 00:07                5232
function.uopz-del-function.php                     29-May-2024 00:07                6650
function.uopz-delete.php                           29-May-2024 00:07                6056
function.uopz-extend.php                           29-May-2024 00:07                5097
function.uopz-flags.php                            29-May-2024 00:07               11017
function.uopz-function.php                         29-May-2024 00:07                7386
function.uopz-get-exit-status.php                  29-May-2024 00:07                4245
function.uopz-get-hook.php                         29-May-2024 00:07                5399
function.uopz-get-mock.php                         29-May-2024 00:07                5016
function.uopz-get-property.php                     29-May-2024 00:07                6262
function.uopz-get-return.php                       29-May-2024 00:07                4498
function.uopz-get-static.php                       29-May-2024 00:07                5216
function.uopz-implement.php                        29-May-2024 00:07                5122
function.uopz-overload.php                         29-May-2024 00:07                3998
function.uopz-redefine.php                         29-May-2024 00:07                5204
function.uopz-rename.php                           29-May-2024 00:07                6844
function.uopz-restore.php                          29-May-2024 00:07                5013
function.uopz-set-hook.php                         29-May-2024 00:07                5731
function.uopz-set-mock.php                         29-May-2024 00:07               10874
function.uopz-set-property.php                     29-May-2024 00:07                7561
function.uopz-set-return.php                       29-May-2024 00:07                9699
function.uopz-set-static.php                       29-May-2024 00:07                5814
function.uopz-undefine.php                         29-May-2024 00:07                4762
function.uopz-unset-hook.php                       29-May-2024 00:07                5622
function.uopz-unset-mock.php                       29-May-2024 00:07                5376
function.uopz-unset-return.php                     29-May-2024 00:07                4974
function.urldecode.php                             29-May-2024 00:07                6559
function.urlencode.php                             29-May-2024 00:07               10187
function.use-soap-error-handler.php                29-May-2024 00:07                3986
function.user-error.php                            29-May-2024 00:07                1766
function.usleep.php                                29-May-2024 00:07                7087
function.usort.php                                 29-May-2024 00:07               27262
function.utf8-decode.php                           29-May-2024 00:07               18752
function.utf8-encode.php                           29-May-2024 00:07               15422
function.var-dump.php                              29-May-2024 00:07                7071
function.var-export.php                            29-May-2024 00:07               17239
function.var-representation.php                    29-May-2024 00:07               13443
function.variant-abs.php                           29-May-2024 00:07                4311
function.variant-add.php                           29-May-2024 00:07                5541
function.variant-and.php                           29-May-2024 00:07                7663
function.variant-cast.php                          29-May-2024 00:07                3626
function.variant-cat.php                           29-May-2024 00:07                4829
function.variant-cmp.php                           29-May-2024 00:07                8206
function.variant-date-from-timestamp.php           29-May-2024 00:07                3816
function.variant-date-to-timestamp.php             29-May-2024 00:07                3895
function.variant-div.php                           29-May-2024 00:07                6579
function.variant-eqv.php                           29-May-2024 00:07                4548
function.variant-fix.php                           29-May-2024 00:07                5529
function.variant-get-type.php                      29-May-2024 00:07                3605
function.variant-idiv.php                          29-May-2024 00:07                5857
function.variant-imp.php                           29-May-2024 00:07                7190
function.variant-int.php                           29-May-2024 00:07                5080
function.variant-mod.php                           29-May-2024 00:07                4945
function.variant-mul.php                           29-May-2024 00:07                5949
function.variant-neg.php                           29-May-2024 00:07                3966
function.variant-not.php                           29-May-2024 00:07                4227
function.variant-or.php                            29-May-2024 00:07                7826
function.variant-pow.php                           29-May-2024 00:07                4698
function.variant-round.php                         29-May-2024 00:07                4609
function.variant-set-type.php                      29-May-2024 00:07                3747
function.variant-set.php                           29-May-2024 00:07                2942
function.variant-sub.php                           29-May-2024 00:07                5503
function.variant-xor.php                           29-May-2024 00:07                6584
function.version-compare.php                       29-May-2024 00:07               11809
function.vfprintf.php                              29-May-2024 00:07               21079
function.virtual.php                               29-May-2024 00:07                5542
function.vprintf.php                               29-May-2024 00:07               20258
function.vsprintf.php                              29-May-2024 00:07               20323
function.wddx-add-vars.php                         29-May-2024 00:07                3930
function.wddx-deserialize.php                      29-May-2024 00:07                3739
function.wddx-packet-end.php                       29-May-2024 00:07                2955
function.wddx-packet-start.php                     29-May-2024 00:07                3155
function.wddx-serialize-value.php                  29-May-2024 00:07                3381
function.wddx-serialize-vars.php                   29-May-2024 00:07                6118
function.win32-continue-service.php                29-May-2024 00:07                6839
function.win32-create-service.php                  29-May-2024 00:07               29245
function.win32-delete-service.php                  29-May-2024 00:07                7281
function.win32-get-last-control-message.php        29-May-2024 00:07                8599
function.win32-pause-service.php                   29-May-2024 00:07                6835
function.win32-query-service-status.php            29-May-2024 00:07                8895
function.win32-send-custom-control.php             29-May-2024 00:07                7499
function.win32-set-service-exit-code.php           29-May-2024 00:07                5939
function.win32-set-service-exit-mode.php           29-May-2024 00:07                6087
function.win32-set-service-status.php              29-May-2024 00:07                9571
function.win32-start-service-ctrl-dispatcher.php   29-May-2024 00:07               11341
function.win32-start-service.php                   29-May-2024 00:07                7009
function.win32-stop-service.php                    29-May-2024 00:07                7254
function.wincache-fcache-fileinfo.php              29-May-2024 00:07                9352
function.wincache-fcache-meminfo.php               29-May-2024 00:07                7181
function.wincache-lock.php                         29-May-2024 00:07                8603
function.wincache-ocache-fileinfo.php              29-May-2024 00:07               10024
function.wincache-ocache-meminfo.php               29-May-2024 00:07                7380
function.wincache-refresh-if-changed.php           29-May-2024 00:07                7906
function.wincache-rplist-fileinfo.php              29-May-2024 00:07                7717
function.wincache-rplist-meminfo.php               29-May-2024 00:07                7296
function.wincache-scache-info.php                  29-May-2024 00:07                9635
function.wincache-scache-meminfo.php               29-May-2024 00:07                6783
function.wincache-ucache-add.php                   29-May-2024 00:07               13649
function.wincache-ucache-cas.php                   29-May-2024 00:07                6569
function.wincache-ucache-clear.php                 29-May-2024 00:07                7674
function.wincache-ucache-dec.php                   29-May-2024 00:07                6500
function.wincache-ucache-delete.php                29-May-2024 00:07               11508
function.wincache-ucache-exists.php                29-May-2024 00:07                6254
function.wincache-ucache-get.php                   29-May-2024 00:07               10652
function.wincache-ucache-inc.php                   29-May-2024 00:07                6492
function.wincache-ucache-info.php                  29-May-2024 00:07               11456
function.wincache-ucache-meminfo.php               29-May-2024 00:07                6972
function.wincache-ucache-set.php                   29-May-2024 00:07               13715
function.wincache-unlock.php                       29-May-2024 00:07                7865
function.wordwrap.php                              29-May-2024 00:07                9431
function.xattr-get.php                             29-May-2024 00:07                6266
function.xattr-list.php                            29-May-2024 00:07                6704
function.xattr-remove.php                          29-May-2024 00:07                6555
function.xattr-set.php                             29-May-2024 00:07                8278
function.xattr-supported.php                       29-May-2024 00:07                5570
function.xdiff-file-bdiff-size.php                 29-May-2024 00:07                4970
function.xdiff-file-bdiff.php                      29-May-2024 00:07                6243
function.xdiff-file-bpatch.php                     29-May-2024 00:07                6768
function.xdiff-file-diff-binary.php                29-May-2024 00:07                6691
function.xdiff-file-diff.php                       29-May-2024 00:07                7795
function.xdiff-file-merge3.php                     29-May-2024 00:07                6996
function.xdiff-file-patch-binary.php               29-May-2024 00:07                6954
function.xdiff-file-patch.php                      29-May-2024 00:07                9225
function.xdiff-file-rabdiff.php                    29-May-2024 00:07                6672
function.xdiff-string-bdiff-size.php               29-May-2024 00:07                5310
function.xdiff-string-bdiff.php                    29-May-2024 00:07                3982
function.xdiff-string-bpatch.php                   29-May-2024 00:07                4108
function.xdiff-string-diff-binary.php              29-May-2024 00:07                4582
function.xdiff-string-diff.php                     29-May-2024 00:07                6849
function.xdiff-string-merge3.php                   29-May-2024 00:07                5092
function.xdiff-string-patch-binary.php             29-May-2024 00:07                4671
function.xdiff-string-patch.php                    29-May-2024 00:07                8488
function.xdiff-string-rabdiff.php                  29-May-2024 00:07                4557
function.xhprof-disable.php                        29-May-2024 00:07                4052
function.xhprof-enable.php                         29-May-2024 00:07                7235
function.xhprof-sample-disable.php                 29-May-2024 00:07                4732
function.xhprof-sample-enable.php                  29-May-2024 00:07                3601
function.xml-error-string.php                      29-May-2024 00:07                3520
function.xml-get-current-byte-index.php            29-May-2024 00:07                5005
function.xml-get-current-column-number.php         29-May-2024 00:07                4904
function.xml-get-current-line-number.php           29-May-2024 00:07                4691
function.xml-get-error-code.php                    29-May-2024 00:07                4184
function.xml-parse-into-struct.php                 29-May-2024 00:07               19376
function.xml-parse.php                             29-May-2024 00:07                8594
function.xml-parser-create-ns.php                  29-May-2024 00:07                5592
function.xml-parser-create.php                     29-May-2024 00:07                5425
function.xml-parser-free.php                       29-May-2024 00:07                4273
function.xml-parser-get-option.php                 29-May-2024 00:07                6203
function.xml-parser-set-option.php                 29-May-2024 00:07                8192
function.xml-set-character-data-handler.php        29-May-2024 00:07                5965
function.xml-set-default-handler.php               29-May-2024 00:07                5877
function.xml-set-element-handler.php               29-May-2024 00:07                8520
function.xml-set-end-namespace-decl-handler.php    29-May-2024 00:07                6677
function.xml-set-external-entity-ref-handler.php   29-May-2024 00:07                8740
function.xml-set-notation-decl-handler.php         29-May-2024 00:07                8269
function.xml-set-object.php                        29-May-2024 00:07                9709
function.xml-set-processing-instruction-handler..> 29-May-2024 00:07                6892
function.xml-set-start-namespace-decl-handler.php  29-May-2024 00:07                6946
function.xml-set-unparsed-entity-decl-handler.php  29-May-2024 00:07                9463
function.xmlrpc-decode-request.php                 29-May-2024 00:07                2855
function.xmlrpc-decode.php                         29-May-2024 00:07                4321
function.xmlrpc-encode-request.php                 29-May-2024 00:07                9348
function.xmlrpc-encode.php                         29-May-2024 00:07                2423
function.xmlrpc-get-type.php                       29-May-2024 00:07                6453
function.xmlrpc-is-fault.php                       29-May-2024 00:07                4068
function.xmlrpc-parse-method-descriptions.php      29-May-2024 00:07                2633
function.xmlrpc-server-add-introspection-data.php  29-May-2024 00:07                2827
function.xmlrpc-server-call-method.php             29-May-2024 00:07                3256
function.xmlrpc-server-create.php                  29-May-2024 00:07                2341
function.xmlrpc-server-destroy.php                 29-May-2024 00:07                2568
function.xmlrpc-server-register-introspection-c..> 29-May-2024 00:07                2887
function.xmlrpc-server-register-method.php         29-May-2024 00:07                2975
function.xmlrpc-set-type.php                       29-May-2024 00:07                5752
function.xmlwriter-writeattribute.php              29-May-2024 00:07                9364
function.yaml-emit-file.php                        29-May-2024 00:07                6802
function.yaml-emit.php                             29-May-2024 00:07               12390
function.yaml-parse-file.php                       29-May-2024 00:07                6137
function.yaml-parse-url.php                        29-May-2024 00:07                6462
function.yaml-parse.php                            29-May-2024 00:07                9994
function.yaz-addinfo.php                           29-May-2024 00:07                3495
function.yaz-ccl-conf.php                          29-May-2024 00:07                5868
function.yaz-ccl-parse.php                         29-May-2024 00:07                7093
function.yaz-close.php                             29-May-2024 00:07                3664
function.yaz-connect.php                           29-May-2024 00:07                9624
function.yaz-database.php                          29-May-2024 00:07                3587
function.yaz-element.php                           29-May-2024 00:07                4002
function.yaz-errno.php                             29-May-2024 00:07                3821
function.yaz-error.php                             29-May-2024 00:07                3475
function.yaz-es-result.php                         29-May-2024 00:07                3390
function.yaz-es.php                                29-May-2024 00:07                7429
function.yaz-get-option.php                        29-May-2024 00:07                3497
function.yaz-hits.php                              29-May-2024 00:07                5782
function.yaz-itemorder.php                         29-May-2024 00:07                7594
function.yaz-present.php                           29-May-2024 00:07                3114
function.yaz-range.php                             29-May-2024 00:07                3719
function.yaz-record.php                            29-May-2024 00:07               14509
function.yaz-scan-result.php                       29-May-2024 00:07                4112
function.yaz-scan.php                              29-May-2024 00:07                9605
function.yaz-schema.php                            29-May-2024 00:07                3503
function.yaz-search.php                            29-May-2024 00:07                9566
function.yaz-set-option.php                        29-May-2024 00:07                7566
function.yaz-sort.php                              29-May-2024 00:07                5884
function.yaz-syntax.php                            29-May-2024 00:07                3523
function.yaz-wait.php                              29-May-2024 00:07                4370
function.zend-thread-id.php                        29-May-2024 00:07                3821
function.zend-version.php                          29-May-2024 00:07                4059
function.zip-close.php                             29-May-2024 00:07                4034
function.zip-entry-close.php                       29-May-2024 00:07                4269
function.zip-entry-compressedsize.php              29-May-2024 00:07                4608
function.zip-entry-compressionmethod.php           29-May-2024 00:07                4683
function.zip-entry-filesize.php                    29-May-2024 00:07                4494
function.zip-entry-name.php                        29-May-2024 00:07                4405
function.zip-entry-open.php                        29-May-2024 00:07                5971
function.zip-entry-read.php                        29-May-2024 00:07                5194
function.zip-open.php                              29-May-2024 00:07                4639
function.zip-read.php                              29-May-2024 00:07                4803
function.zlib-decode.php                           29-May-2024 00:07                3517
function.zlib-encode.php                           29-May-2024 00:07                5432
function.zlib-get-coding-type.php                  29-May-2024 00:07                3016
function.zookeeper-dispatch.php                    29-May-2024 00:07                8376
functional.parallel.php                            29-May-2024 00:07                2607
functions.anonymous.php                            29-May-2024 00:07               23896
functions.arguments.php                            29-May-2024 00:07               44718
functions.arrow.php                                29-May-2024 00:07               10427
functions.first_class_callable_syntax.php          29-May-2024 00:07               11581
functions.internal.php                             29-May-2024 00:07                8369
functions.returning-values.php                     29-May-2024 00:07                5986
functions.user-defined.php                         29-May-2024 00:07                9442
functions.variable-functions.php                   29-May-2024 00:07               11627
gearman.configuration.php                          29-May-2024 00:07                1324
gearman.constants.php                              29-May-2024 00:07               23908
gearman.examples-reverse-bg.php                    29-May-2024 00:07               10724
gearman.examples-reverse-task.php                  29-May-2024 00:07               17373
gearman.examples-reverse.php                       29-May-2024 00:07               12804
gearman.examples.php                               29-May-2024 00:07                1636
gearman.installation.php                           29-May-2024 00:07                1602
gearman.requirements.php                           29-May-2024 00:07                1528
gearman.resources.php                              29-May-2024 00:07                1305
gearman.setup.php                                  29-May-2024 00:07                1653
gearmanclient.addoptions.php                       29-May-2024 00:07                3386
gearmanclient.addserver.php                        29-May-2024 00:07                5518
gearmanclient.addservers.php                       29-May-2024 00:07                4970
gearmanclient.addtask.php                          29-May-2024 00:07               15205
gearmanclient.addtaskbackground.php                29-May-2024 00:07               20965
gearmanclient.addtaskhigh.php                      29-May-2024 00:07               11713
gearmanclient.addtaskhighbackground.php            29-May-2024 00:07                6626
gearmanclient.addtasklow.php                       29-May-2024 00:07               11695
gearmanclient.addtasklowbackground.php             29-May-2024 00:07                6619
gearmanclient.addtaskstatus.php                    29-May-2024 00:07                9868
gearmanclient.clearcallbacks.php                   29-May-2024 00:07                4412
gearmanclient.clone.php                            29-May-2024 00:07                2704
gearmanclient.construct.php                        29-May-2024 00:07                2886
gearmanclient.context.php                          29-May-2024 00:07                2954
gearmanclient.data.php                             29-May-2024 00:07                3224
gearmanclient.do.php                               29-May-2024 00:07               22224
gearmanclient.dobackground.php                     29-May-2024 00:07                9714
gearmanclient.dohigh.php                           29-May-2024 00:07                5170
gearmanclient.dohighbackground.php                 29-May-2024 00:07                4997
gearmanclient.dojobhandle.php                      29-May-2024 00:07                3011
gearmanclient.dolow.php                            29-May-2024 00:07                5156
gearmanclient.dolowbackground.php                  29-May-2024 00:07                4979
gearmanclient.donormal.php                         29-May-2024 00:07               22792
gearmanclient.dostatus.php                         29-May-2024 00:07                8190
gearmanclient.echo.php                             29-May-2024 00:07                3041
gearmanclient.error.php                            29-May-2024 00:07                2946
gearmanclient.geterrno.php                         29-May-2024 00:07                2721
gearmanclient.jobstatus.php                        29-May-2024 00:07                8379
gearmanclient.ping.php                             29-May-2024 00:07                3014
gearmanclient.removeoptions.php                    29-May-2024 00:07                2734
gearmanclient.returncode.php                       29-May-2024 00:07                2360
gearmanclient.runtasks.php                         29-May-2024 00:07                3780
gearmanclient.setclientcallback.php                29-May-2024 00:07                5426
gearmanclient.setcompletecallback.php              29-May-2024 00:07                5307
gearmanclient.setcontext.php                       29-May-2024 00:07                3283
gearmanclient.setcreatedcallback.php               29-May-2024 00:07                4846
gearmanclient.setdata.php                          29-May-2024 00:07                3486
gearmanclient.setdatacallback.php                  29-May-2024 00:07                4831
gearmanclient.setexceptioncallback.php             29-May-2024 00:07                4751
gearmanclient.setfailcallback.php                  29-May-2024 00:07                4837
gearmanclient.setoptions.php                       29-May-2024 00:07                2720
gearmanclient.setstatuscallback.php                29-May-2024 00:07                4837
gearmanclient.settimeout.php                       29-May-2024 00:07                2764
gearmanclient.setwarningcallback.php               29-May-2024 00:07                4840
gearmanclient.setworkloadcallback.php              29-May-2024 00:07                4994
gearmanclient.timeout.php                          29-May-2024 00:07                2816
gearmanclient.wait.php                             29-May-2024 00:07                2863
gearmanjob.complete.php                            29-May-2024 00:07                3649
gearmanjob.construct.php                           29-May-2024 00:07                2394
gearmanjob.data.php                                29-May-2024 00:07                3609
gearmanjob.exception.php                           29-May-2024 00:07                3816
gearmanjob.fail.php                                29-May-2024 00:07                3746
gearmanjob.functionname.php                        29-May-2024 00:07                2992
gearmanjob.handle.php                              29-May-2024 00:07                2879
gearmanjob.returncode.php                          29-May-2024 00:07                2676
gearmanjob.sendcomplete.php                        29-May-2024 00:07                3365
gearmanjob.senddata.php                            29-May-2024 00:07                3332
gearmanjob.sendexception.php                       29-May-2024 00:07                3545
gearmanjob.sendfail.php                            29-May-2024 00:07                3460
gearmanjob.sendstatus.php                          29-May-2024 00:07                4060
gearmanjob.sendwarning.php                         29-May-2024 00:07                3541
gearmanjob.setreturn.php                           29-May-2024 00:07                2606
gearmanjob.status.php                              29-May-2024 00:07                4346
gearmanjob.unique.php                              29-May-2024 00:07                3116
gearmanjob.warning.php                             29-May-2024 00:07                3827
gearmanjob.workload.php                            29-May-2024 00:07                2874
gearmanjob.workloadsize.php                        29-May-2024 00:07                2692
gearmantask.construct.php                          29-May-2024 00:07                2419
gearmantask.create.php                             29-May-2024 00:07                2868
gearmantask.data.php                               29-May-2024 00:07                2853
gearmantask.datasize.php                           29-May-2024 00:07                2876
gearmantask.function.php                           29-May-2024 00:07                2709
gearmantask.functionname.php                       29-May-2024 00:07                2641
gearmantask.isknown.php                            29-May-2024 00:07                2517
gearmantask.isrunning.php                          29-May-2024 00:07                2517
gearmantask.jobhandle.php                          29-May-2024 00:07                3025
gearmantask.recvdata.php                           29-May-2024 00:07                3558
gearmantask.returncode.php                         29-May-2024 00:07                2703
gearmantask.senddata.php                           29-May-2024 00:07                3371
gearmantask.sendworkload.php                       29-May-2024 00:07                3520
gearmantask.taskdenominator.php                    29-May-2024 00:07                3069
gearmantask.tasknumerator.php                      29-May-2024 00:07                3041
gearmantask.unique.php                             29-May-2024 00:07                3286
gearmantask.uuid.php                               29-May-2024 00:07                3464
gearmanworker.addfunction.php                      29-May-2024 00:07                7956
gearmanworker.addoptions.php                       29-May-2024 00:07                3444
gearmanworker.addserver.php                        29-May-2024 00:07                5245
gearmanworker.addservers.php                       29-May-2024 00:07                4692
gearmanworker.clone.php                            29-May-2024 00:07                2375
gearmanworker.construct.php                        29-May-2024 00:07                2859
gearmanworker.echo.php                             29-May-2024 00:07                3077
gearmanworker.error.php                            29-May-2024 00:07                2913
gearmanworker.geterrno.php                         29-May-2024 00:07                2688
gearmanworker.options.php                          29-May-2024 00:07                2695
gearmanworker.register.php                         29-May-2024 00:07                3834
gearmanworker.removeoptions.php                    29-May-2024 00:07                3466
gearmanworker.returncode.php                       29-May-2024 00:07                2883
gearmanworker.setid.php                            29-May-2024 00:07                4142
gearmanworker.setoptions.php                       29-May-2024 00:07                3599
gearmanworker.settimeout.php                       29-May-2024 00:07                7845
gearmanworker.timeout.php                          29-May-2024 00:07                2795
gearmanworker.unregister.php                       29-May-2024 00:07                3398
gearmanworker.unregisterall.php                    29-May-2024 00:07                3059
gearmanworker.wait.php                             29-May-2024 00:07                7938
gearmanworker.work.php                             29-May-2024 00:07                5640
gender-gender.connect.php                          29-May-2024 00:07                2604
gender-gender.construct.php                        29-May-2024 00:07                2456
gender-gender.country.php                          29-May-2024 00:07                3866
gender-gender.get.php                              29-May-2024 00:07                2920
gender-gender.isnick.php                           29-May-2024 00:07                3532
gender-gender.similarnames.php                     29-May-2024 00:07                3033
gender.example.admin.php                           29-May-2024 00:07                8109
gender.examples.php                                29-May-2024 00:07                1403
gender.installation.php                            29-May-2024 00:07                1961
gender.setup.php                                   29-May-2024 00:07                1400
generator.current.php                              29-May-2024 00:07                2172
generator.getreturn.php                            29-May-2024 00:07                3892
generator.key.php                                  29-May-2024 00:07                3984
generator.next.php                                 29-May-2024 00:07                2531
generator.rewind.php                               29-May-2024 00:07                2239
generator.send.php                                 29-May-2024 00:07                5661
generator.throw.php                                29-May-2024 00:07                5085
generator.valid.php                                29-May-2024 00:07                2346
generator.wakeup.php                               29-May-2024 00:07                2246
geoip.configuration.php                            29-May-2024 00:07                2567
geoip.constants.php                                29-May-2024 00:07                6355
geoip.installation.php                             29-May-2024 00:07                1719
geoip.requirements.php                             29-May-2024 00:07                1731
geoip.resources.php                                29-May-2024 00:07                1261
geoip.setup.php                                    29-May-2024 00:07                1614
gettext.configuration.php                          29-May-2024 00:07                1324
gettext.constants.php                              29-May-2024 00:07                1225
gettext.installation.php                           29-May-2024 00:07                1470
gettext.requirements.php                           29-May-2024 00:07                1419
gettext.resources.php                              29-May-2024 00:07                1275
gettext.setup.php                                  29-May-2024 00:07                1658
getting-started.php                                29-May-2024 00:07                1949
globiterator.construct.php                         29-May-2024 00:07                7753
globiterator.count.php                             29-May-2024 00:07                4531
gmagick.addimage.php                               29-May-2024 00:07                2919
gmagick.addnoiseimage.php                          29-May-2024 00:07                2974
gmagick.annotateimage.php                          29-May-2024 00:07                4509
gmagick.blurimage.php                              29-May-2024 00:07                3370
gmagick.borderimage.php                            29-May-2024 00:07                3819
gmagick.charcoalimage.php                          29-May-2024 00:07                3320
gmagick.chopimage.php                              29-May-2024 00:07                3972
gmagick.clear.php                                  29-May-2024 00:07                2672
gmagick.commentimage.php                           29-May-2024 00:07                2921
gmagick.compositeimage.php                         29-May-2024 00:07                4135
gmagick.configuration.php                          29-May-2024 00:07                1323
gmagick.constants.php                              29-May-2024 00:07              103224
gmagick.construct.php                              29-May-2024 00:07                2676
gmagick.cropimage.php                              29-May-2024 00:07                4107
gmagick.cropthumbnailimage.php                     29-May-2024 00:07                3357
gmagick.current.php                                29-May-2024 00:07                2573
gmagick.cyclecolormapimage.php                     29-May-2024 00:07                3047
gmagick.deconstructimages.php                      29-May-2024 00:07                2821
gmagick.despeckleimage.php                         29-May-2024 00:07                3515
gmagick.destroy.php                                29-May-2024 00:07                2812
gmagick.drawimage.php                              29-May-2024 00:07                3043
gmagick.edgeimage.php                              29-May-2024 00:07                2990
gmagick.embossimage.php                            29-May-2024 00:07                3498
gmagick.enhanceimage.php                           29-May-2024 00:07                2683
gmagick.equalizeimage.php                          29-May-2024 00:07                2642
gmagick.examples.php                               29-May-2024 00:07                3448
gmagick.flipimage.php                              29-May-2024 00:07                2985
gmagick.flopimage.php                              29-May-2024 00:07                2982
gmagick.frameimage.php                             29-May-2024 00:07                4644
gmagick.gammaimage.php                             29-May-2024 00:07                3201
gmagick.getcopyright.php                           29-May-2024 00:07                2664
gmagick.getfilename.php                            29-May-2024 00:07                2614
gmagick.getimagebackgroundcolor.php                29-May-2024 00:07                2751
gmagick.getimageblueprimary.php                    29-May-2024 00:07                3049
gmagick.getimagebordercolor.php                    29-May-2024 00:07                2795
gmagick.getimagechanneldepth.php                   29-May-2024 00:07                2856
gmagick.getimagecolors.php                         29-May-2024 00:07                2650
gmagick.getimagecolorspace.php                     29-May-2024 00:07                2608
gmagick.getimagecompose.php                        29-May-2024 00:07                2688
gmagick.getimagedelay.php                          29-May-2024 00:07                2585
gmagick.getimagedepth.php                          29-May-2024 00:07                2555
gmagick.getimagedispose.php                        29-May-2024 00:07                2609
gmagick.getimageextrema.php                        29-May-2024 00:07                2834
gmagick.getimagefilename.php                       29-May-2024 00:07                2693
gmagick.getimageformat.php                         29-May-2024 00:07                2676
gmagick.getimagegamma.php                          29-May-2024 00:07                2576
gmagick.getimagegreenprimary.php                   29-May-2024 00:07                2795
gmagick.getimageheight.php                         29-May-2024 00:07                2607
gmagick.getimagehistogram.php                      29-May-2024 00:07                2968
gmagick.getimageindex.php                          29-May-2024 00:07                2738
gmagick.getimageinterlacescheme.php                29-May-2024 00:07                2726
gmagick.getimageiterations.php                     29-May-2024 00:07                2653
gmagick.getimagematte.php                          29-May-2024 00:07                2993
gmagick.getimagemattecolor.php                     29-May-2024 00:07                2701
gmagick.getimageprofile.php                        29-May-2024 00:07                2808
gmagick.getimageredprimary.php                     29-May-2024 00:07                2816
gmagick.getimagerenderingintent.php                29-May-2024 00:07                2737
gmagick.getimageresolution.php                     29-May-2024 00:07                2669
gmagick.getimagescene.php                          29-May-2024 00:07                2572
gmagick.getimagesignature.php                      29-May-2024 00:07                2687
gmagick.getimagetype.php                           29-May-2024 00:07                2579
gmagick.getimageunits.php                          29-May-2024 00:07                2325
gmagick.getimagewhitepoint.php                     29-May-2024 00:07                2792
gmagick.getimagewidth.php                          29-May-2024 00:07                2586
gmagick.getpackagename.php                         29-May-2024 00:07                2640
gmagick.getquantumdepth.php                        29-May-2024 00:07                2817
gmagick.getreleasedate.php                         29-May-2024 00:07                2674
gmagick.getsamplingfactors.php                     29-May-2024 00:07                2727
gmagick.getsize.php                                29-May-2024 00:07                2876
gmagick.getversion.php                             29-May-2024 00:07                2617
gmagick.hasnextimage.php                           29-May-2024 00:07                2974
gmagick.haspreviousimage.php                       29-May-2024 00:07                3018
gmagick.implodeimage.php                           29-May-2024 00:07                3030
gmagick.installation.php                           29-May-2024 00:07                1962
gmagick.labelimage.php                             29-May-2024 00:07                2799
gmagick.levelimage.php                             29-May-2024 00:07                4750
gmagick.magnifyimage.php                           29-May-2024 00:07                2668
gmagick.mapimage.php                               29-May-2024 00:07                3335
gmagick.medianfilterimage.php                      29-May-2024 00:07                3119
gmagick.minifyimage.php                            29-May-2024 00:07                2702
gmagick.modulateimage.php                          29-May-2024 00:07                3948
gmagick.motionblurimage.php                        29-May-2024 00:07                3973
gmagick.newimage.php                               29-May-2024 00:07                3995
gmagick.nextimage.php                              29-May-2024 00:07                2833
gmagick.normalizeimage.php                         29-May-2024 00:07                3075
gmagick.oilpaintimage.php                          29-May-2024 00:07                3091
gmagick.previousimage.php                          29-May-2024 00:07                2828
gmagick.profileimage.php                           29-May-2024 00:07                3649
gmagick.quantizeimage.php                          29-May-2024 00:07                5418
gmagick.quantizeimages.php                         29-May-2024 00:07                5421
gmagick.queryfontmetrics.php                       29-May-2024 00:07                2995
gmagick.queryfonts.php                             29-May-2024 00:07                2771
gmagick.queryformats.php                           29-May-2024 00:07                3169
gmagick.radialblurimage.php                        29-May-2024 00:07                3295
gmagick.raiseimage.php                             29-May-2024 00:07                4486
gmagick.read.php                                   29-May-2024 00:07                2814
gmagick.readimage.php                              29-May-2024 00:07                2864
gmagick.readimageblob.php                          29-May-2024 00:07                3287
gmagick.readimagefile.php                          29-May-2024 00:07                3164
gmagick.reducenoiseimage.php                       29-May-2024 00:07                3269
gmagick.removeimage.php                            29-May-2024 00:07                2650
gmagick.removeimageprofile.php                     29-May-2024 00:07                2976
gmagick.requirements.php                           29-May-2024 00:07                1691
gmagick.resampleimage.php                          29-May-2024 00:07                3998
gmagick.resizeimage.php                            29-May-2024 00:07                4335
gmagick.rollimage.php                              29-May-2024 00:07                3074
gmagick.rotateimage.php                            29-May-2024 00:07                3249
gmagick.scaleimage.php                             29-May-2024 00:07                3617
gmagick.separateimagechannel.php                   29-May-2024 00:07                3261
gmagick.setcompressionquality.php                  29-May-2024 00:07                4267
gmagick.setfilename.php                            29-May-2024 00:07                2994
gmagick.setimagebackgroundcolor.php                29-May-2024 00:07                3063
gmagick.setimageblueprimary.php                    29-May-2024 00:07                3357
gmagick.setimagebordercolor.php                    29-May-2024 00:07                3025
gmagick.setimagechanneldepth.php                   29-May-2024 00:07                3504
gmagick.setimagecolorspace.php                     29-May-2024 00:07                3146
gmagick.setimagecompose.php                        29-May-2024 00:07                2912
gmagick.setimagedelay.php                          29-May-2024 00:07                2926
gmagick.setimagedepth.php                          29-May-2024 00:07                2924
gmagick.setimagedispose.php                        29-May-2024 00:07                2968
gmagick.setimagefilename.php                       29-May-2024 00:07                3018
gmagick.setimageformat.php                         29-May-2024 00:07                2981
gmagick.setimagegamma.php                          29-May-2024 00:07                2918
gmagick.setimagegreenprimary.php                   29-May-2024 00:07                3365
gmagick.setimageindex.php                          29-May-2024 00:07                3065
gmagick.setimageinterlacescheme.php                29-May-2024 00:07                3212
gmagick.setimageiterations.php                     29-May-2024 00:07                3021
gmagick.setimageprofile.php                        29-May-2024 00:07                3454
gmagick.setimageredprimary.php                     29-May-2024 00:07                3268
gmagick.setimagerenderingintent.php                29-May-2024 00:07                3243
gmagick.setimageresolution.php                     29-May-2024 00:07                3262
gmagick.setimagescene.php                          29-May-2024 00:07                2914
gmagick.setimagetype.php                           29-May-2024 00:07                3039
gmagick.setimageunits.php                          29-May-2024 00:07                3098
gmagick.setimagewhitepoint.php                     29-May-2024 00:07                3294
gmagick.setsamplingfactors.php                     29-May-2024 00:07                3140
gmagick.setsize.php                                29-May-2024 00:07                3610
gmagick.setup.php                                  29-May-2024 00:07                1569
gmagick.shearimage.php                             29-May-2024 00:07                3992
gmagick.solarizeimage.php                          29-May-2024 00:07                3172
gmagick.spreadimage.php                            29-May-2024 00:07                3016
gmagick.stripimage.php                             29-May-2024 00:07                2630
gmagick.swirlimage.php                             29-May-2024 00:07                3097
gmagick.thumbnailimage.php                         29-May-2024 00:07                3928
gmagick.trimimage.php                              29-May-2024 00:07                3161
gmagick.write.php                                  29-May-2024 00:07                1765
gmagick.writeimage.php                             29-May-2024 00:07                3573
gmagickdraw.annotate.php                           29-May-2024 00:07                3234
gmagickdraw.arc.php                                29-May-2024 00:07                4394
gmagickdraw.bezier.php                             29-May-2024 00:07                2673
gmagickdraw.ellipse.php                            29-May-2024 00:07                4315
gmagickdraw.getfillcolor.php                       29-May-2024 00:07                2495
gmagickdraw.getfillopacity.php                     29-May-2024 00:07                2446
gmagickdraw.getfont.php                            29-May-2024 00:07                2437
gmagickdraw.getfontsize.php                        29-May-2024 00:07                2488
gmagickdraw.getfontstyle.php                       29-May-2024 00:07                2564
gmagickdraw.getfontweight.php                      29-May-2024 00:07                2409
gmagickdraw.getstrokecolor.php                     29-May-2024 00:07                2550
gmagickdraw.getstrokeopacity.php                   29-May-2024 00:07                2523
gmagickdraw.getstrokewidth.php                     29-May-2024 00:07                2542
gmagickdraw.gettextdecoration.php                  29-May-2024 00:07                2476
gmagickdraw.gettextencoding.php                    29-May-2024 00:07                2565
gmagickdraw.line.php                               29-May-2024 00:07                3678
gmagickdraw.point.php                              29-May-2024 00:07                2965
gmagickdraw.polygon.php                            29-May-2024 00:07                2740
gmagickdraw.polyline.php                           29-May-2024 00:07                2775
gmagickdraw.rectangle.php                          29-May-2024 00:07                3782
gmagickdraw.rotate.php                             29-May-2024 00:07                2731
gmagickdraw.roundrectangle.php                     29-May-2024 00:07                4559
gmagickdraw.scale.php                              29-May-2024 00:07                3029
gmagickdraw.setfillcolor.php                       29-May-2024 00:07                2991
gmagickdraw.setfillopacity.php                     29-May-2024 00:07                2829
gmagickdraw.setfont.php                            29-May-2024 00:07                2729
gmagickdraw.setfontsize.php                        29-May-2024 00:07                2759
gmagickdraw.setfontstyle.php                       29-May-2024 00:07                2890
gmagickdraw.setfontweight.php                      29-May-2024 00:07                2761
gmagickdraw.setstrokecolor.php                     29-May-2024 00:07                3015
gmagickdraw.setstrokeopacity.php                   29-May-2024 00:07                2847
gmagickdraw.setstrokewidth.php                     29-May-2024 00:07                2807
gmagickdraw.settextdecoration.php                  29-May-2024 00:07                2893
gmagickdraw.settextencoding.php                    29-May-2024 00:07                3101
gmagickpixel.construct.php                         29-May-2024 00:07                2602
gmagickpixel.getcolor.php                          29-May-2024 00:07                4393
gmagickpixel.getcolorcount.php                     29-May-2024 00:07                2537
gmagickpixel.getcolorvalue.php                     29-May-2024 00:07                2937
gmagickpixel.setcolor.php                          29-May-2024 00:07                3068
gmagickpixel.setcolorvalue.php                     29-May-2024 00:07                3347
gmp.configuration.php                              29-May-2024 00:07                1295
gmp.constants.php                                  29-May-2024 00:07                4538
gmp.construct.php                                  29-May-2024 00:07                3790
gmp.examples.php                                   29-May-2024 00:07                3091
gmp.installation.php                               29-May-2024 00:07                1365
gmp.requirements.php                               29-May-2024 00:07                1736
gmp.serialize.php                                  29-May-2024 00:07                2310
gmp.setup.php                                      29-May-2024 00:07                1531
gmp.unserialize.php                                29-May-2024 00:07                2614
gnupg.configuration.php                            29-May-2024 00:07                1308
gnupg.constants.php                                29-May-2024 00:07                9449
gnupg.examples-clearsign.php                       29-May-2024 00:07                6362
gnupg.examples.php                                 29-May-2024 00:07                1418
gnupg.installation.php                             29-May-2024 00:07                1583
gnupg.requirements.php                             29-May-2024 00:07                1295
gnupg.resources.php                                29-May-2024 00:07                1261
gnupg.setup.php                                    29-May-2024 00:07                1632
hash.configuration.php                             29-May-2024 00:07                1303
hash.constants.php                                 29-May-2024 00:07                1884
hash.installation.php                              29-May-2024 00:07                1771
hash.requirements.php                              29-May-2024 00:07                1247
hash.resources.php                                 29-May-2024 00:07                1380
hash.setup.php                                     29-May-2024 00:07                1613
hashcontext.construct.php                          29-May-2024 00:07                1966
hashcontext.serialize.php                          29-May-2024 00:07                2439
hashcontext.unserialize.php                        29-May-2024 00:07                2742
history.php                                        29-May-2024 00:07                2185
history.php.books.php                              29-May-2024 00:07                2606
history.php.php                                    29-May-2024 00:07               10818
history.php.publications.php                       29-May-2024 00:07                1843
history.php.related.php                            29-May-2024 00:07                6005
hrtime-performancecounter.getfrequency.php         29-May-2024 00:07                2793
hrtime-performancecounter.getticks.php             29-May-2024 00:07                2666
hrtime-performancecounter.gettickssince.php        29-May-2024 00:07                2966
hrtime-stopwatch.getelapsedticks.php               29-May-2024 00:07                2568
hrtime-stopwatch.getelapsedtime.php                29-May-2024 00:07                2961
hrtime-stopwatch.getlastelapsedticks.php           29-May-2024 00:07                2636
hrtime-stopwatch.getlastelapsedtime.php            29-May-2024 00:07                2985
hrtime-stopwatch.isrunning.php                     29-May-2024 00:07                2529
hrtime-stopwatch.start.php                         29-May-2024 00:07                2430
hrtime-stopwatch.stop.php                          29-May-2024 00:07                2309
hrtime.example.basic.php                           29-May-2024 00:07                5487
hrtime.examples.php                                29-May-2024 00:07                1397
hrtime.installation.php                            29-May-2024 00:07                1961
hrtime.setup.php                                   29-May-2024 00:07                1397
ibase.configuration.php                            29-May-2024 00:07                8060
ibase.constants.php                                29-May-2024 00:07               21400
ibase.installation.php                             29-May-2024 00:07                3412
ibase.requirements.php                             29-May-2024 00:07                1217
ibase.resources.php                                29-May-2024 00:07                1261
ibase.setup.php                                    29-May-2024 00:07                1650
ibm-db2.configuration.php                          29-May-2024 00:07               20908
ibm-db2.constants.php                              29-May-2024 00:07                9143
ibm-db2.installation.php                           29-May-2024 00:07                3537
ibm-db2.requirements.php                           29-May-2024 00:07                3234
ibm-db2.resources.php                              29-May-2024 00:07                1327
ibm-db2.setup.php                                  29-May-2024 00:07                1662
iconv.configuration.php                            29-May-2024 00:07                4621
iconv.constants.php                                29-May-2024 00:07                3771
iconv.installation.php                             29-May-2024 00:07                1649
iconv.requirements.php                             29-May-2024 00:07                1521
iconv.resources.php                                29-May-2024 00:07                1261
iconv.setup.php                                    29-May-2024 00:07                1640
igbinary.configuration.php                         29-May-2024 00:07                3548
igbinary.installation.php                          29-May-2024 00:07                1970
igbinary.requirements.php                          29-May-2024 00:07                1238
igbinary.setup.php                                 29-May-2024 00:07                1576
image.configuration.php                            29-May-2024 00:07                3602
image.constants.php                                29-May-2024 00:07               52716
image.examples-png.php                             29-May-2024 00:07                4727
image.examples-watermark.php                       29-May-2024 00:07                6018
image.examples.merged-watermark.php                29-May-2024 00:07                8844
image.examples.php                                 29-May-2024 00:07                1669
image.installation.php                             29-May-2024 00:07                6662
image.requirements.php                             29-May-2024 00:07                4684
image.resources.php                                29-May-2024 00:07                2157
image.setup.php                                    29-May-2024 00:07                1635
imagick.adaptiveblurimage.php                      29-May-2024 00:07                6983
imagick.adaptiveresizeimage.php                    29-May-2024 00:07                9798
imagick.adaptivesharpenimage.php                   29-May-2024 00:07                6517
imagick.adaptivethresholdimage.php                 29-May-2024 00:07                6309
imagick.addimage.php                               29-May-2024 00:07                3308
imagick.addnoiseimage.php                          29-May-2024 00:07                5636
imagick.affinetransformimage.php                   29-May-2024 00:07                6732
imagick.animateimages.php                          29-May-2024 00:07                3302
imagick.annotateimage.php                          29-May-2024 00:07                8891
imagick.appendimages.php                           29-May-2024 00:07                7049
imagick.autolevelimage.php                         29-May-2024 00:07                4506
imagick.averageimages.php                          29-May-2024 00:07                2894
imagick.blackthresholdimage.php                    29-May-2024 00:07                5696
imagick.blueshiftimage.php                         29-May-2024 00:07                4551
imagick.blurimage.php                              29-May-2024 00:07                6282
imagick.borderimage.php                            29-May-2024 00:07                6507
imagick.brightnesscontrastimage.php                29-May-2024 00:07                5711
imagick.charcoalimage.php                          29-May-2024 00:07                5060
imagick.chopimage.php                              29-May-2024 00:07                7210
imagick.clampimage.php                             29-May-2024 00:07                2777
imagick.clear.php                                  29-May-2024 00:07                2505
imagick.clipimage.php                              29-May-2024 00:07                2788
imagick.clipimagepath.php                          29-May-2024 00:07                3190
imagick.clippathimage.php                          29-May-2024 00:07                3681
imagick.clone.php                                  29-May-2024 00:07                4695
imagick.clutimage.php                              29-May-2024 00:07                6440
imagick.coalesceimages.php                         29-May-2024 00:07                3207
imagick.colorfloodfillimage.php                    29-May-2024 00:07                5851
imagick.colorizeimage.php                          29-May-2024 00:07                7102
imagick.colormatriximage.php                       29-May-2024 00:07                7674
imagick.combineimages.php                          29-May-2024 00:07                3389
imagick.commentimage.php                           29-May-2024 00:07                5188
imagick.compareimagechannels.php                   29-May-2024 00:07                4269
imagick.compareimagelayers.php                     29-May-2024 00:07                5873
imagick.compareimages.php                          29-May-2024 00:07                5839
imagick.compositeimage.php                         29-May-2024 00:07                8473
imagick.configuration.php                          29-May-2024 00:07                4620
imagick.constants.php                              29-May-2024 00:07              163289
imagick.construct.php                              29-May-2024 00:07                2745
imagick.contrastimage.php                          29-May-2024 00:07                5233
imagick.contraststretchimage.php                   29-May-2024 00:07                3883
imagick.convolveimage.php                          29-May-2024 00:07                5998
imagick.count.php                                  29-May-2024 00:07                2758
imagick.cropimage.php                              29-May-2024 00:07                4018
imagick.cropthumbnailimage.php                     29-May-2024 00:07                3740
imagick.current.php                                29-May-2024 00:07                2647
imagick.cyclecolormapimage.php                     29-May-2024 00:07                3180
imagick.decipherimage.php                          29-May-2024 00:07                3358
imagick.deconstructimages.php                      29-May-2024 00:07                2894
imagick.deleteimageartifact.php                    29-May-2024 00:07                3827
imagick.deleteimageproperty.php                    29-May-2024 00:07                2699
imagick.deskewimage.php                            29-May-2024 00:07               11088
imagick.despeckleimage.php                         29-May-2024 00:07                4408
imagick.destroy.php                                29-May-2024 00:07                2627
imagick.displayimage.php                           29-May-2024 00:07                2949
imagick.displayimages.php                          29-May-2024 00:07                2976
imagick.distortimage.php                           29-May-2024 00:07               12409
imagick.drawimage.php                              29-May-2024 00:07                2778
imagick.edgeimage.php                              29-May-2024 00:07                4986
imagick.embossimage.php                            29-May-2024 00:07                5765
imagick.encipherimage.php                          29-May-2024 00:07                3404
imagick.enhanceimage.php                           29-May-2024 00:07                4538
imagick.equalizeimage.php                          29-May-2024 00:07                4358
imagick.evaluateimage.php                          29-May-2024 00:07                6043
imagick.examples-1.php                             29-May-2024 00:07               30566
imagick.examples.php                               29-May-2024 00:07                1428
imagick.exportimagepixels.php                      29-May-2024 00:07                8086
imagick.extentimage.php                            29-May-2024 00:07                5623
imagick.filter.php                                 29-May-2024 00:07                7495
imagick.flattenimages.php                          29-May-2024 00:07                3090
imagick.flipimage.php                              29-May-2024 00:07                4745
imagick.floodfillpaintimage.php                    29-May-2024 00:07               11758
imagick.flopimage.php                              29-May-2024 00:07                4891
imagick.forwardfouriertransformimage.php           29-May-2024 00:07               12138
imagick.frameimage.php                             29-May-2024 00:07                8784
imagick.functionimage.php                          29-May-2024 00:07               13884
imagick.fximage.php                                29-May-2024 00:07                6134
imagick.gammaimage.php                             29-May-2024 00:07                5710
imagick.gaussianblurimage.php                      29-May-2024 00:07                6675
imagick.getcolorspace.php                          29-May-2024 00:07                2525
imagick.getcompression.php                         29-May-2024 00:07                2503
imagick.getcompressionquality.php                  29-May-2024 00:07                2450
imagick.getcopyright.php                           29-May-2024 00:07                2371
imagick.getfilename.php                            29-May-2024 00:07                2770
imagick.getfont.php                                29-May-2024 00:07                3287
imagick.getformat.php                              29-May-2024 00:07                2818
imagick.getgravity.php                             29-May-2024 00:07                2508
imagick.gethomeurl.php                             29-May-2024 00:07                2351
imagick.getimage.php                               29-May-2024 00:07                2831
imagick.getimagealphachannel.php                   29-May-2024 00:07                3682
imagick.getimageartifact.php                       29-May-2024 00:07                3715
imagick.getimageattribute.php                      29-May-2024 00:07                2858
imagick.getimagebackgroundcolor.php                29-May-2024 00:07                2845
imagick.getimageblob.php                           29-May-2024 00:07                2955
imagick.getimageblueprimary.php                    29-May-2024 00:07                2704
imagick.getimagebordercolor.php                    29-May-2024 00:07                2851
imagick.getimagechanneldepth.php                   29-May-2024 00:07                3094
imagick.getimagechanneldistortion.php              29-May-2024 00:07                4220
imagick.getimagechanneldistortions.php             29-May-2024 00:07                4484
imagick.getimagechannelextrema.php                 29-May-2024 00:07                3842
imagick.getimagechannelkurtosis.php                29-May-2024 00:07                3619
imagick.getimagechannelmean.php                    29-May-2024 00:07                3400
imagick.getimagechannelrange.php                   29-May-2024 00:07                3472
imagick.getimagechannelstatistics.php              29-May-2024 00:07                2657
imagick.getimageclipmask.php                       29-May-2024 00:07                3327
imagick.getimagecolormapcolor.php                  29-May-2024 00:07                3154
imagick.getimagecolors.php                         29-May-2024 00:07                2441
imagick.getimagecolorspace.php                     29-May-2024 00:07                2484
imagick.getimagecompose.php                        29-May-2024 00:07                2504
imagick.getimagecompression.php                    29-May-2024 00:07                2581
imagick.getimagecompressionquality.php             29-May-2024 00:07                2587
imagick.getimagedelay.php                          29-May-2024 00:07                2782
imagick.getimagedepth.php                          29-May-2024 00:07                2341
imagick.getimagedispose.php                        29-May-2024 00:07                2796
imagick.getimagedistortion.php                     29-May-2024 00:07                3660
imagick.getimageextrema.php                        29-May-2024 00:07                3049
imagick.getimagefilename.php                       29-May-2024 00:07                2787
imagick.getimageformat.php                         29-May-2024 00:07                2754
imagick.getimagegamma.php                          29-May-2024 00:07                2635
imagick.getimagegeometry.php                       29-May-2024 00:07                4305
imagick.getimagegravity.php                        29-May-2024 00:07                2797
imagick.getimagegreenprimary.php                   29-May-2024 00:07                3062
imagick.getimageheight.php                         29-May-2024 00:07                2665
imagick.getimagehistogram.php                      29-May-2024 00:07               17551
imagick.getimageindex.php                          29-May-2024 00:07                3260
imagick.getimageinterlacescheme.php                29-May-2024 00:07                2736
imagick.getimageinterpolatemethod.php              29-May-2024 00:07                2874
imagick.getimageiterations.php                     29-May-2024 00:07                2722
imagick.getimagelength.php                         29-May-2024 00:07                3495
imagick.getimagematte.php                          29-May-2024 00:07                3094
imagick.getimagemattecolor.php                     29-May-2024 00:07                3084
imagick.getimagemimetype.php                       29-May-2024 00:07                2333
imagick.getimageorientation.php                    29-May-2024 00:07                2790
imagick.getimagepage.php                           29-May-2024 00:07                2839
imagick.getimagepixelcolor.php                     29-May-2024 00:07                3507
imagick.getimageprofile.php                        29-May-2024 00:07                2954
imagick.getimageprofiles.php                       29-May-2024 00:07                3837
imagick.getimageproperties.php                     29-May-2024 00:07                6076
imagick.getimageproperty.php                       29-May-2024 00:07                5064
imagick.getimageredprimary.php                     29-May-2024 00:07                3038
imagick.getimageregion.php                         29-May-2024 00:07                4055
imagick.getimagerenderingintent.php                29-May-2024 00:07                2875
imagick.getimageresolution.php                     29-May-2024 00:07                2732
imagick.getimagesblob.php                          29-May-2024 00:07                2820
imagick.getimagesignature.php                      29-May-2024 00:07                2682
imagick.getimagesize.php                           29-May-2024 00:07                2957
imagick.getimagetickspersecond.php                 29-May-2024 00:07                2768
imagick.getimagetotalinkdensity.php                29-May-2024 00:07                2655
imagick.getimagetype.php                           29-May-2024 00:07                5118
imagick.getimageunits.php                          29-May-2024 00:07                2913
imagick.getimagevirtualpixelmethod.php             29-May-2024 00:07                3049
imagick.getimagewhitepoint.php                     29-May-2024 00:07                2886
imagick.getimagewidth.php                          29-May-2024 00:07                2620
imagick.getinterlacescheme.php                     29-May-2024 00:07                2954
imagick.getiteratorindex.php                       29-May-2024 00:07                6428
imagick.getnumberimages.php                        29-May-2024 00:07                2875
imagick.getoption.php                              29-May-2024 00:07                2938
imagick.getpackagename.php                         29-May-2024 00:07                2613
imagick.getpage.php                                29-May-2024 00:07                2837
imagick.getpixeliterator.php                       29-May-2024 00:07                6418
imagick.getpixelregioniterator.php                 29-May-2024 00:07                7230
imagick.getpointsize.php                           29-May-2024 00:07                2958
imagick.getquantum.php                             29-May-2024 00:07                2357
imagick.getquantumdepth.php                        29-May-2024 00:07                2846
imagick.getquantumrange.php                        29-May-2024 00:07                3108
imagick.getregistry.php                            29-May-2024 00:07                2567
imagick.getreleasedate.php                         29-May-2024 00:07                2663
imagick.getresource.php                            29-May-2024 00:07                3108
imagick.getresourcelimit.php                       29-May-2024 00:07                3544
imagick.getsamplingfactors.php                     29-May-2024 00:07                2726
imagick.getsize.php                                29-May-2024 00:07                6276
imagick.getsizeoffset.php                          29-May-2024 00:07                2946
imagick.getversion.php                             29-May-2024 00:07                2641
imagick.haldclutimage.php                          29-May-2024 00:07                6086
imagick.hasnextimage.php                           29-May-2024 00:07                2692
imagick.haspreviousimage.php                       29-May-2024 00:07                2723
imagick.identifyformat.php                         29-May-2024 00:07                4527
imagick.identifyimage.php                          29-May-2024 00:07                4188
imagick.implodeimage.php                           29-May-2024 00:07                4838
imagick.importimagepixels.php                      29-May-2024 00:07               11552
imagick.installation.php                           29-May-2024 00:07                3056
imagick.inversefouriertransformimage.php           29-May-2024 00:07                3547
imagick.labelimage.php                             29-May-2024 00:07                2655
imagick.levelimage.php                             29-May-2024 00:07                8008
imagick.linearstretchimage.php                     29-May-2024 00:07                5767
imagick.liquidrescaleimage.php                     29-May-2024 00:07                4789
imagick.listregistry.php                           29-May-2024 00:07                2416
imagick.magnifyimage.php                           29-May-2024 00:07                4376
imagick.mapimage.php                               29-May-2024 00:07                3544
imagick.mattefloodfillimage.php                    29-May-2024 00:07                6063
imagick.medianfilterimage.php                      29-May-2024 00:07                5428
imagick.mergeimagelayers.php                       29-May-2024 00:07                6794
imagick.minifyimage.php                            29-May-2024 00:07                2437
imagick.modulateimage.php                          29-May-2024 00:07                5960
imagick.montageimage.php                           29-May-2024 00:07                4744
imagick.morphimages.php                            29-May-2024 00:07                3050
imagick.morphology.php                             29-May-2024 00:07               66556
imagick.mosaicimages.php                           29-May-2024 00:07                2876
imagick.motionblurimage.php                        29-May-2024 00:07                6992
imagick.negateimage.php                            29-May-2024 00:07                5920
imagick.newimage.php                               29-May-2024 00:07                6857
imagick.newpseudoimage.php                         29-May-2024 00:07                6096
imagick.nextimage.php                              29-May-2024 00:07                2490
imagick.normalizeimage.php                         29-May-2024 00:07                6407
imagick.oilpaintimage.php                          29-May-2024 00:07                4718
imagick.opaquepaintimage.php                       29-May-2024 00:07                5152
imagick.optimizeimagelayers.php                    29-May-2024 00:07                5673
imagick.orderedposterizeimage.php                  29-May-2024 00:07                6816
imagick.paintfloodfillimage.php                    29-May-2024 00:07                5885
imagick.paintopaqueimage.php                       29-May-2024 00:07                5607
imagick.painttransparentimage.php                  29-May-2024 00:07                4843
imagick.pingimage.php                              29-May-2024 00:07                2774
imagick.pingimageblob.php                          29-May-2024 00:07                6137
imagick.pingimagefile.php                          29-May-2024 00:07                6043
imagick.polaroidimage.php                          29-May-2024 00:07                4683
imagick.posterizeimage.php                         29-May-2024 00:07                5862
imagick.previewimages.php                          29-May-2024 00:07                3339
imagick.previousimage.php                          29-May-2024 00:07                2524
imagick.profileimage.php                           29-May-2024 00:07                3446
imagick.quantizeimage.php                          29-May-2024 00:07                7755
imagick.quantizeimages.php                         29-May-2024 00:07                5102
imagick.queryfontmetrics.php                       29-May-2024 00:07                5843
imagick.queryfonts.php                             29-May-2024 00:07                4930
imagick.queryformats.php                           29-May-2024 00:07                7295
imagick.radialblurimage.php                        29-May-2024 00:07                6072
imagick.raiseimage.php                             29-May-2024 00:07                6563
imagick.randomthresholdimage.php                   29-May-2024 00:07                6517
imagick.readimage.php                              29-May-2024 00:07                2639
imagick.readimageblob.php                          29-May-2024 00:07                5592
imagick.readimagefile.php                          29-May-2024 00:07                3366
imagick.readimages.php                             29-May-2024 00:07                2654
imagick.recolorimage.php                           29-May-2024 00:07                6524
imagick.reducenoiseimage.php                       29-May-2024 00:07                5365
imagick.remapimage.php                             29-May-2024 00:07                3604
imagick.removeimage.php                            29-May-2024 00:07                2665
imagick.removeimageprofile.php                     29-May-2024 00:07                2933
imagick.render.php                                 29-May-2024 00:07                2367
imagick.requirements.php                           29-May-2024 00:07                1569
imagick.resampleimage.php                          29-May-2024 00:07                5802
imagick.resetimagepage.php                         29-May-2024 00:07                2882
imagick.resizeimage.php                            29-May-2024 00:07                6121
imagick.resources.php                              29-May-2024 00:07                1275
imagick.rollimage.php                              29-May-2024 00:07                4918
imagick.rotateimage.php                            29-May-2024 00:07                5791
imagick.rotationalblurimage.php                    29-May-2024 00:07                5647
imagick.roundcorners.php                           29-May-2024 00:07                6835
imagick.sampleimage.php                            29-May-2024 00:07                3042
imagick.scaleimage.php                             29-May-2024 00:07                7380
imagick.segmentimage.php                           29-May-2024 00:07                6834
imagick.selectiveblurimage.php                     29-May-2024 00:07                6510
imagick.separateimagechannel.php                   29-May-2024 00:07                5372
imagick.sepiatoneimage.php                         29-May-2024 00:07                5041
imagick.setbackgroundcolor.php                     29-May-2024 00:07                3413
imagick.setcolorspace.php                          29-May-2024 00:07                3161
imagick.setcompression.php                         29-May-2024 00:07                2850
imagick.setcompressionquality.php                  29-May-2024 00:07                6966
imagick.setfilename.php                            29-May-2024 00:07                2674
imagick.setfirstiterator.php                       29-May-2024 00:07                2515
imagick.setfont.php                                29-May-2024 00:07                5693
imagick.setformat.php                              29-May-2024 00:07                2682
imagick.setgravity.php                             29-May-2024 00:07                2800
imagick.setimage.php                               29-May-2024 00:07                4780
imagick.setimagealphachannel.php                   29-May-2024 00:07                3956
imagick.setimageartifact.php                       29-May-2024 00:07                7480
imagick.setimageattribute.php                      29-May-2024 00:07                3211
imagick.setimagebackgroundcolor.php                29-May-2024 00:07                3743
imagick.setimagebias.php                           29-May-2024 00:07                7001
imagick.setimagebiasquantum.php                    29-May-2024 00:07                2933
imagick.setimageblueprimary.php                    29-May-2024 00:07                3357
imagick.setimagebordercolor.php                    29-May-2024 00:07                3744
imagick.setimagechanneldepth.php                   29-May-2024 00:07                3343
imagick.setimageclipmask.php                       29-May-2024 00:07                8982
imagick.setimagecolormapcolor.php                  29-May-2024 00:07                3340
imagick.setimagecolorspace.php                     29-May-2024 00:07                3395
imagick.setimagecompose.php                        29-May-2024 00:07                3364
imagick.setimagecompression.php                    29-May-2024 00:07                3195
imagick.setimagecompressionquality.php             29-May-2024 00:07                5044
imagick.setimagedelay.php                          29-May-2024 00:07                6160
imagick.setimagedepth.php                          29-May-2024 00:07                2932
imagick.setimagedispose.php                        29-May-2024 00:07                3121
imagick.setimageextent.php                         29-May-2024 00:07                3343
imagick.setimagefilename.php                       29-May-2024 00:07                3025
imagick.setimageformat.php                         29-May-2024 00:07                2835
imagick.setimagegamma.php                          29-May-2024 00:07                2936
imagick.setimagegravity.php                        29-May-2024 00:07                2965
imagick.setimagegreenprimary.php                   29-May-2024 00:07                3346
imagick.setimageindex.php                          29-May-2024 00:07                3517
imagick.setimageinterlacescheme.php                29-May-2024 00:07                3214
imagick.setimageinterpolatemethod.php              29-May-2024 00:07                2908
imagick.setimageiterations.php                     29-May-2024 00:07                5127
imagick.setimagematte.php                          29-May-2024 00:07                3035
imagick.setimagemattecolor.php                     29-May-2024 00:07                3968
imagick.setimageopacity.php                        29-May-2024 00:07                5066
imagick.setimageorientation.php                    29-May-2024 00:07                4853
imagick.setimagepage.php                           29-May-2024 00:07                3890
imagick.setimageprofile.php                        29-May-2024 00:07                3705
imagick.setimageproperty.php                       29-May-2024 00:07                5386
imagick.setimageredprimary.php                     29-May-2024 00:07                3354
imagick.setimagerenderingintent.php                29-May-2024 00:07                3249
imagick.setimageresolution.php                     29-May-2024 00:07                5211
imagick.setimagescene.php                          29-May-2024 00:07                2950
imagick.setimagetickspersecond.php                 29-May-2024 00:07                7593
imagick.setimagetype.php                           29-May-2024 00:07                2789
imagick.setimageunits.php                          29-May-2024 00:07                2710
imagick.setimagevirtualpixelmethod.php             29-May-2024 00:07                2959
imagick.setimagewhitepoint.php                     29-May-2024 00:07                3311
imagick.setinterlacescheme.php                     29-May-2024 00:07                2752
imagick.setiteratorindex.php                       29-May-2024 00:07                6414
imagick.setlastiterator.php                        29-May-2024 00:07                2612
imagick.setoption.php                              29-May-2024 00:07               11610
imagick.setpage.php                                29-May-2024 00:07                3707
imagick.setpointsize.php                           29-May-2024 00:07                5374
imagick.setprogressmonitor.php                     29-May-2024 00:07               10283
imagick.setregistry.php                            29-May-2024 00:07                3111
imagick.setresolution.php                          29-May-2024 00:07                4015
imagick.setresourcelimit.php                       29-May-2024 00:07                3653
imagick.setsamplingfactors.php                     29-May-2024 00:07                6853
imagick.setsize.php                                29-May-2024 00:07                3088
imagick.setsizeoffset.php                          29-May-2024 00:07                3664
imagick.settype.php                                29-May-2024 00:07                2753
imagick.setup.php                                  29-May-2024 00:07                1657
imagick.shadeimage.php                             29-May-2024 00:07                6006
imagick.shadowimage.php                            29-May-2024 00:07                5521
imagick.sharpenimage.php                           29-May-2024 00:07                6087
imagick.shaveimage.php                             29-May-2024 00:07                4727
imagick.shearimage.php                             29-May-2024 00:07                6734
imagick.sigmoidalcontrastimage.php                 29-May-2024 00:07                8200
imagick.sketchimage.php                            29-May-2024 00:07                6093
imagick.smushimages.php                            29-May-2024 00:07                5836
imagick.solarizeimage.php                          29-May-2024 00:07                4927
imagick.sparsecolorimage.php                       29-May-2024 00:07               26658
imagick.spliceimage.php                            29-May-2024 00:07                5876
imagick.spreadimage.php                            29-May-2024 00:07                4869
imagick.statisticimage.php                         29-May-2024 00:07                6780
imagick.steganoimage.php                           29-May-2024 00:07                3141
imagick.stereoimage.php                            29-May-2024 00:07                2981
imagick.subimagematch.php                          29-May-2024 00:07                7549
imagick.swirlimage.php                             29-May-2024 00:07                4929
imagick.textureimage.php                           29-May-2024 00:07                6306
imagick.thresholdimage.php                         29-May-2024 00:07                5524
imagick.thumbnailimage.php                         29-May-2024 00:07                7840
imagick.tintimage.php                              29-May-2024 00:07                8319
imagick.tostring.php                               29-May-2024 00:07                3082
imagick.transformimage.php                         29-May-2024 00:07                6842
imagick.transformimagecolorspace.php               29-May-2024 00:07                5775
imagick.transparentpaintimage.php                  29-May-2024 00:07                7348
imagick.transposeimage.php                         29-May-2024 00:07                4732
imagick.transverseimage.php                        29-May-2024 00:07                4731
imagick.trimimage.php                              29-May-2024 00:07                6289
imagick.uniqueimagecolors.php                      29-May-2024 00:07                5628
imagick.unsharpmaskimage.php                       29-May-2024 00:07                7202
imagick.valid.php                                  29-May-2024 00:07                2440
imagick.vignetteimage.php                          29-May-2024 00:07                6722
imagick.waveimage.php                              29-May-2024 00:07                6646
imagick.whitethresholdimage.php                    29-May-2024 00:07                5564
imagick.writeimage.php                             29-May-2024 00:07                3445
imagick.writeimagefile.php                         29-May-2024 00:07                4022
imagick.writeimages.php                            29-May-2024 00:07                3040
imagick.writeimagesfile.php                        29-May-2024 00:07                4031
imagickdraw.affine.php                             29-May-2024 00:07               16835
imagickdraw.annotation.php                         29-May-2024 00:07                3427
imagickdraw.arc.php                                29-May-2024 00:07                9748
imagickdraw.bezier.php                             29-May-2024 00:07               16864
imagickdraw.circle.php                             29-May-2024 00:07                9124
imagickdraw.clear.php                              29-May-2024 00:07                2557
imagickdraw.clone.php                              29-May-2024 00:07                2548
imagickdraw.color.php                              29-May-2024 00:07                3561
imagickdraw.comment.php                            29-May-2024 00:07                2825
imagickdraw.composite.php                          29-May-2024 00:07               11946
imagickdraw.construct.php                          29-May-2024 00:07                2328
imagickdraw.destroy.php                            29-May-2024 00:07                2453
imagickdraw.ellipse.php                            29-May-2024 00:07               12315
imagickdraw.getclippath.php                        29-May-2024 00:07                2501
imagickdraw.getcliprule.php                        29-May-2024 00:07                2529
imagickdraw.getclipunits.php                       29-May-2024 00:07                2358
imagickdraw.getfillcolor.php                       29-May-2024 00:07                2447
imagickdraw.getfillopacity.php                     29-May-2024 00:07                2457
imagickdraw.getfillrule.php                        29-May-2024 00:07                2462
imagickdraw.getfont.php                            29-May-2024 00:07                2417
imagickdraw.getfontfamily.php                      29-May-2024 00:07                2513
imagickdraw.getfontsize.php                        29-May-2024 00:07                2506
imagickdraw.getfontstretch.php                     29-May-2024 00:07                2424
imagickdraw.getfontstyle.php                       29-May-2024 00:07                2656
imagickdraw.getfontweight.php                      29-May-2024 00:07                2395
imagickdraw.getgravity.php                         29-May-2024 00:07                2530
imagickdraw.getstrokeantialias.php                 29-May-2024 00:07                2865
imagickdraw.getstrokecolor.php                     29-May-2024 00:07                2573
imagickdraw.getstrokedasharray.php                 29-May-2024 00:07                2629
imagickdraw.getstrokedashoffset.php                29-May-2024 00:07                2536
imagickdraw.getstrokelinecap.php                   29-May-2024 00:07                2611
imagickdraw.getstrokelinejoin.php                  29-May-2024 00:07                2594
imagickdraw.getstrokemiterlimit.php                29-May-2024 00:07                2780
imagickdraw.getstrokeopacity.php                   29-May-2024 00:07                2642
imagickdraw.getstrokewidth.php                     29-May-2024 00:07                2616
imagickdraw.gettextalignment.php                   29-May-2024 00:07                2540
imagickdraw.gettextantialias.php                   29-May-2024 00:07                2656
imagickdraw.gettextdecoration.php                  29-May-2024 00:07                2577
imagickdraw.gettextencoding.php                    29-May-2024 00:07                2631
imagickdraw.gettextinterlinespacing.php            29-May-2024 00:07                2461
imagickdraw.gettextinterwordspacing.php            29-May-2024 00:07                2485
imagickdraw.gettextkerning.php                     29-May-2024 00:07                2380
imagickdraw.gettextundercolor.php                  29-May-2024 00:07                2512
imagickdraw.getvectorgraphics.php                  29-May-2024 00:07                2561
imagickdraw.line.php                               29-May-2024 00:07                8456
imagickdraw.matte.php                              29-May-2024 00:07                8369
imagickdraw.pathclose.php                          29-May-2024 00:07                2412
imagickdraw.pathcurvetoabsolute.php                29-May-2024 00:07                5213
imagickdraw.pathcurvetoquadraticbezierabsolute.php 29-May-2024 00:07               11476
imagickdraw.pathcurvetoquadraticbezierrelative.php 29-May-2024 00:07                4537
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 29-May-2024 00:07               11192
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 29-May-2024 00:07               11164
imagickdraw.pathcurvetorelative.php                29-May-2024 00:07                5258
imagickdraw.pathcurvetosmoothabsolute.php          29-May-2024 00:07                5223
imagickdraw.pathcurvetosmoothrelative.php          29-May-2024 00:07                5232
imagickdraw.pathellipticarcabsolute.php            29-May-2024 00:07                6381
imagickdraw.pathellipticarcrelative.php            29-May-2024 00:07                6352
imagickdraw.pathfinish.php                         29-May-2024 00:07                2318
imagickdraw.pathlinetoabsolute.php                 29-May-2024 00:07                3274
imagickdraw.pathlinetohorizontalabsolute.php       29-May-2024 00:07                3120
imagickdraw.pathlinetohorizontalrelative.php       29-May-2024 00:07                3121
imagickdraw.pathlinetorelative.php                 29-May-2024 00:07                3323
imagickdraw.pathlinetoverticalabsolute.php         29-May-2024 00:07                3084
imagickdraw.pathlinetoverticalrelative.php         29-May-2024 00:07                3085
imagickdraw.pathmovetoabsolute.php                 29-May-2024 00:07                3341
imagickdraw.pathmovetorelative.php                 29-May-2024 00:07                3268
imagickdraw.pathstart.php                          29-May-2024 00:07               12136
imagickdraw.point.php                              29-May-2024 00:07                6923
imagickdraw.polygon.php                            29-May-2024 00:07                9058
imagickdraw.polyline.php                           29-May-2024 00:07                9058
imagickdraw.pop.php                                29-May-2024 00:07                2875
imagickdraw.popclippath.php                        29-May-2024 00:07                2301
imagickdraw.popdefs.php                            29-May-2024 00:07                7770
imagickdraw.poppattern.php                         29-May-2024 00:07                2483
imagickdraw.push.php                               29-May-2024 00:07                9248
imagickdraw.pushclippath.php                       29-May-2024 00:07                3078
imagickdraw.pushdefs.php                           29-May-2024 00:07                8320
imagickdraw.pushpattern.php                        29-May-2024 00:07               15020
imagickdraw.rectangle.php                          29-May-2024 00:07                8607
imagickdraw.render.php                             29-May-2024 00:07                2517
imagickdraw.resetvectorgraphics.php                29-May-2024 00:07                2476
imagickdraw.rotate.php                             29-May-2024 00:07                7795
imagickdraw.roundrectangle.php                     29-May-2024 00:07                9521
imagickdraw.scale.php                              29-May-2024 00:07                8116
imagickdraw.setclippath.php                        29-May-2024 00:07                8529
imagickdraw.setcliprule.php                        29-May-2024 00:07                9533
imagickdraw.setclipunits.php                       29-May-2024 00:07                8892
imagickdraw.setfillalpha.php                       29-May-2024 00:07                7852
imagickdraw.setfillcolor.php                       29-May-2024 00:07                7935
imagickdraw.setfillopacity.php                     29-May-2024 00:07                7888
imagickdraw.setfillpatternurl.php                  29-May-2024 00:07                3598
imagickdraw.setfillrule.php                        29-May-2024 00:07               13044
imagickdraw.setfont.php                            29-May-2024 00:07                9346
imagickdraw.setfontfamily.php                      29-May-2024 00:07                9922
imagickdraw.setfontsize.php                        29-May-2024 00:07                8298
imagickdraw.setfontstretch.php                     29-May-2024 00:07                9682
imagickdraw.setfontstyle.php                       29-May-2024 00:07                8947
imagickdraw.setfontweight.php                      29-May-2024 00:07                9204
imagickdraw.setgravity.php                         29-May-2024 00:07               10615
imagickdraw.setresolution.php                      29-May-2024 00:07                2953
imagickdraw.setstrokealpha.php                     29-May-2024 00:07                8524
imagickdraw.setstrokeantialias.php                 29-May-2024 00:07                9152
imagickdraw.setstrokecolor.php                     29-May-2024 00:07                8604
imagickdraw.setstrokedasharray.php                 29-May-2024 00:07               13548
imagickdraw.setstrokedashoffset.php                29-May-2024 00:07                9916
imagickdraw.setstrokelinecap.php                   29-May-2024 00:07                8570
imagickdraw.setstrokelinejoin.php                  29-May-2024 00:07               11447
imagickdraw.setstrokemiterlimit.php                29-May-2024 00:07               11372
imagickdraw.setstrokeopacity.php                   29-May-2024 00:07               10295
imagickdraw.setstrokepatternurl.php                29-May-2024 00:07                3122
imagickdraw.setstrokewidth.php                     29-May-2024 00:07                8591
imagickdraw.settextalignment.php                   29-May-2024 00:07                9467
imagickdraw.settextantialias.php                   29-May-2024 00:07                8970
imagickdraw.settextdecoration.php                  29-May-2024 00:07                7510
imagickdraw.settextencoding.php                    29-May-2024 00:07                3256
imagickdraw.settextinterlinespacing.php            29-May-2024 00:07                2983
imagickdraw.settextinterwordspacing.php            29-May-2024 00:07                2817
imagickdraw.settextkerning.php                     29-May-2024 00:07                2892
imagickdraw.settextundercolor.php                  29-May-2024 00:07                7793
imagickdraw.setvectorgraphics.php                  29-May-2024 00:07                9182
imagickdraw.setviewbox.php                         29-May-2024 00:07               10441
imagickdraw.skewx.php                              29-May-2024 00:07                8194
imagickdraw.skewy.php                              29-May-2024 00:07                8196
imagickdraw.translate.php                          29-May-2024 00:07                8553
imagickkernel.addkernel.php                        29-May-2024 00:07                7066
imagickkernel.addunitykernel.php                   29-May-2024 00:07               13720
imagickkernel.frombuiltin.php                      29-May-2024 00:07               26271
imagickkernel.frommatrix.php                       29-May-2024 00:07               23203
imagickkernel.getmatrix.php                        29-May-2024 00:07                7130
imagickkernel.scale.php                            29-May-2024 00:07               13233
imagickkernel.separate.php                         29-May-2024 00:07                9754
imagickpixel.clear.php                             29-May-2024 00:07                2448
imagickpixel.construct.php                         29-May-2024 00:07               12055
imagickpixel.destroy.php                           29-May-2024 00:07                2568
imagickpixel.getcolor.php                          29-May-2024 00:07                7888
imagickpixel.getcolorasstring.php                  29-May-2024 00:07                4919
imagickpixel.getcolorcount.php                     29-May-2024 00:07                5199
imagickpixel.getcolorquantum.php                   29-May-2024 00:07                2940
imagickpixel.getcolorvalue.php                     29-May-2024 00:07                7195
imagickpixel.getcolorvaluequantum.php              29-May-2024 00:07                6146
imagickpixel.gethsl.php                            29-May-2024 00:07                4622
imagickpixel.getindex.php                          29-May-2024 00:07                2327
imagickpixel.ispixelsimilar.php                    29-May-2024 00:07                3674
imagickpixel.ispixelsimilarquantum.php             29-May-2024 00:07                3272
imagickpixel.issimilar.php                         29-May-2024 00:07               16602
imagickpixel.setcolor.php                          29-May-2024 00:07                7393
imagickpixel.setcolorcount.php                     29-May-2024 00:07                2726
imagickpixel.setcolorvalue.php                     29-May-2024 00:07                5250
imagickpixel.setcolorvaluequantum.php              29-May-2024 00:07                8500
imagickpixel.sethsl.php                            29-May-2024 00:07                7758
imagickpixel.setindex.php                          29-May-2024 00:07                2655
imagickpixeliterator.clear.php                     29-May-2024 00:07                6339
imagickpixeliterator.construct.php                 29-May-2024 00:07                6209
imagickpixeliterator.destroy.php                   29-May-2024 00:07                2593
imagickpixeliterator.getcurrentiteratorrow.php     29-May-2024 00:07                2935
imagickpixeliterator.getiteratorrow.php            29-May-2024 00:07                2594
imagickpixeliterator.getnextiteratorrow.php        29-May-2024 00:07                6809
imagickpixeliterator.getpreviousiteratorrow.php    29-May-2024 00:07                2912
imagickpixeliterator.newpixeliterator.php          29-May-2024 00:07                2924
imagickpixeliterator.newpixelregioniterator.php    29-May-2024 00:07                4606
imagickpixeliterator.resetiterator.php             29-May-2024 00:07                9094
imagickpixeliterator.setiteratorfirstrow.php       29-May-2024 00:07                2652
imagickpixeliterator.setiteratorlastrow.php        29-May-2024 00:07                2647
imagickpixeliterator.setiteratorrow.php            29-May-2024 00:07                7012
imagickpixeliterator.synciterator.php              29-May-2024 00:07                2508
imap.configuration.php                             29-May-2024 00:07                3411
imap.constants.php                                 29-May-2024 00:07               25189
imap.installation.php                              29-May-2024 00:07                2830
imap.requirements.php                              29-May-2024 00:07                2703
imap.resources.php                                 29-May-2024 00:07                1494
imap.setup.php                                     29-May-2024 00:07                1627
index.php                                          29-May-2024 00:07               14965
indexes.examples.php                               29-May-2024 00:07              744517
indexes.functions.php                              29-May-2024 00:07             1209196
indexes.php                                        29-May-2024 00:07                1482
infiniteiterator.construct.php                     29-May-2024 00:07                5089
infiniteiterator.next.php                          29-May-2024 00:07                3350
info.configuration.php                             29-May-2024 00:07               14037
info.constants.php                                 29-May-2024 00:07               23942
info.installation.php                              29-May-2024 00:07                1266
info.requirements.php                              29-May-2024 00:07                1210
info.resources.php                                 29-May-2024 00:07                1254
info.setup.php                                     29-May-2024 00:07                1602
ini.core.php                                       29-May-2024 00:07               76721
ini.list.php                                       29-May-2024 00:07              108640
ini.php                                            29-May-2024 00:07                1647
ini.sections.php                                   29-May-2024 00:07                4175
inotify.configuration.php                          29-May-2024 00:07                1334
inotify.constants.php                              29-May-2024 00:07               10453
inotify.install.php                                29-May-2024 00:07                1757
inotify.requirements.php                           29-May-2024 00:07                1249
inotify.resources.php                              29-May-2024 00:07                1384
inotify.setup.php                                  29-May-2024 00:07                1662
install.cloud.azure.php                            29-May-2024 00:07                4300
install.cloud.digitalocean.php                     29-May-2024 00:07                3027
install.cloud.ec2.php                              29-May-2024 00:07                1456
install.cloud.php                                  29-May-2024 00:07                1720
install.fpm.configuration.php                      29-May-2024 00:07               36130
install.fpm.install.php                            29-May-2024 00:07                3342
install.fpm.php                                    29-May-2024 00:07                3679
install.general.php                                29-May-2024 00:07                4789
install.macosx.bundled.php                         29-May-2024 00:07               10747
install.macosx.compile.php                         29-May-2024 00:07                1394
install.macosx.packages.php                        29-May-2024 00:07                3059
install.macosx.php                                 29-May-2024 00:07                2076
install.pecl.downloads.php                         29-May-2024 00:07                3624
install.pecl.intro.php                             29-May-2024 00:07                3274
install.pecl.pear.php                              29-May-2024 00:07                3086
install.pecl.php                                   29-May-2024 00:07                2028
install.pecl.php-config.php                        29-May-2024 00:07                4152
install.pecl.phpize.php                            29-May-2024 00:07                3099
install.pecl.static.php                            29-May-2024 00:07                3638
install.pecl.windows.php                           29-May-2024 00:07                9837
install.php                                        29-May-2024 00:07                5691
install.problems.bugs.php                          29-May-2024 00:07                2002
install.problems.faq.php                           29-May-2024 00:07                1370
install.problems.php                               29-May-2024 00:07                1603
install.problems.support.php                       29-May-2024 00:07                2618
install.unix.apache2.php                           29-May-2024 00:07               13193
install.unix.commandline.php                       29-May-2024 00:07                4042
install.unix.debian.php                            29-May-2024 00:07                7352
install.unix.lighttpd-14.php                       29-May-2024 00:07                6461
install.unix.litespeed.php                         29-May-2024 00:07                8998
install.unix.nginx.php                             29-May-2024 00:07                8365
install.unix.openbsd.php                           29-May-2024 00:07                6014
install.unix.php                                   29-May-2024 00:07                7519
install.unix.solaris.php                           29-May-2024 00:07                3929
install.windows.apache2.php                        29-May-2024 00:07                7258
install.windows.building.php                       29-May-2024 00:07                1724
install.windows.commandline.php                    29-May-2024 00:07                8773
install.windows.manual.php                         29-May-2024 00:07                5585
install.windows.pecl.php                           29-May-2024 00:07                1671
install.windows.php                                29-May-2024 00:07                3336
install.windows.recommended.php                    29-May-2024 00:07                5169
install.windows.requirements.php                   29-May-2024 00:07                2275
install.windows.tools.php                          29-May-2024 00:07                1861
install.windows.troubleshooting.php                29-May-2024 00:07                1769
internaliterator.construct.php                     29-May-2024 00:07                2025
internaliterator.current.php                       29-May-2024 00:07                2334
internaliterator.key.php                           29-May-2024 00:07                2330
internaliterator.next.php                          29-May-2024 00:07                2296
internaliterator.rewind.php                        29-May-2024 00:07                2327
internaliterator.valid.php                         29-May-2024 00:07                2457
intl.configuration.php                             29-May-2024 00:07                5409
intl.constants.php                                 29-May-2024 00:07                9620
intl.examples.basic.php                            29-May-2024 00:07                4367
intl.examples.php                                  29-May-2024 00:07                1436
intl.installation.php                              29-May-2024 00:07                1828
intl.requirements.php                              29-May-2024 00:07                1380
intl.resources.php                                 29-May-2024 00:07                1254
intl.setup.php                                     29-May-2024 00:07                1624
intlbreakiterator.construct.php                    29-May-2024 00:07                4110
intlbreakiterator.createcharacterinstance.php      29-May-2024 00:07                3379
intlbreakiterator.createcodepointinstance.php      29-May-2024 00:07                2828
intlbreakiterator.createlineinstance.php           29-May-2024 00:07                3340
intlbreakiterator.createsentenceinstance.php       29-May-2024 00:07                3342
intlbreakiterator.createtitleinstance.php          29-May-2024 00:07                3322
intlbreakiterator.createwordinstance.php           29-May-2024 00:07                3276
intlbreakiterator.current.php                      29-May-2024 00:07                2517
intlbreakiterator.first.php                        29-May-2024 00:07                2501
intlbreakiterator.following.php                    29-May-2024 00:07                2797
intlbreakiterator.geterrorcode.php                 29-May-2024 00:07                3052
intlbreakiterator.geterrormessage.php              29-May-2024 00:07                3101
intlbreakiterator.getlocale.php                    29-May-2024 00:07                2907
intlbreakiterator.getpartsiterator.php             29-May-2024 00:07                3734
intlbreakiterator.gettext.php                      29-May-2024 00:07                2634
intlbreakiterator.isboundary.php                   29-May-2024 00:07                2767
intlbreakiterator.last.php                         29-May-2024 00:07                2500
intlbreakiterator.next.php                         29-May-2024 00:07                2931
intlbreakiterator.preceding.php                    29-May-2024 00:07                2775
intlbreakiterator.previous.php                     29-May-2024 00:07                2556
intlbreakiterator.settext.php                      29-May-2024 00:07                3644
intlcalendar.add.php                               29-May-2024 00:07                8883
intlcalendar.after.php                             29-May-2024 00:07                6921
intlcalendar.before.php                            29-May-2024 00:07                4307
intlcalendar.clear.php                             29-May-2024 00:07               19134
intlcalendar.construct.php                         29-May-2024 00:07                2380
intlcalendar.createinstance.php                    29-May-2024 00:07               13595
intlcalendar.equals.php                            29-May-2024 00:07               11016
intlcalendar.fielddifference.php                   29-May-2024 00:07               11409
intlcalendar.fromdatetime.php                      29-May-2024 00:07                8089
intlcalendar.get.php                               29-May-2024 00:07                8898
intlcalendar.getactualmaximum.php                  29-May-2024 00:07                8819
intlcalendar.getactualminimum.php                  29-May-2024 00:07                6002
intlcalendar.getavailablelocales.php               29-May-2024 00:07                4501
intlcalendar.getdayofweektype.php                  29-May-2024 00:07               10729
intlcalendar.geterrorcode.php                      29-May-2024 00:07                9241
intlcalendar.geterrormessage.php                   29-May-2024 00:07                6235
intlcalendar.getfirstdayofweek.php                 29-May-2024 00:07                8829
intlcalendar.getgreatestminimum.php                29-May-2024 00:07                4880
intlcalendar.getkeywordvaluesforlocale.php         29-May-2024 00:07                7580
intlcalendar.getleastmaximum.php                   29-May-2024 00:07                8466
intlcalendar.getlocale.php                         29-May-2024 00:07                6409
intlcalendar.getmaximum.php                        29-May-2024 00:07                5535
intlcalendar.getminimaldaysinfirstweek.php         29-May-2024 00:07                9117
intlcalendar.getminimum.php                        29-May-2024 00:07                4824
intlcalendar.getnow.php                            29-May-2024 00:07                5418
intlcalendar.getrepeatedwalltimeoption.php         29-May-2024 00:07               10393
intlcalendar.getskippedwalltimeoption.php          29-May-2024 00:07               12732
intlcalendar.gettime.php                           29-May-2024 00:07                6682
intlcalendar.gettimezone.php                       29-May-2024 00:07                7630
intlcalendar.gettype.php                           29-May-2024 00:07                5804
intlcalendar.getweekendtransition.php              29-May-2024 00:07                5486
intlcalendar.indaylighttime.php                    29-May-2024 00:07                8845
intlcalendar.isequivalentto.php                    29-May-2024 00:07                8554
intlcalendar.islenient.php                         29-May-2024 00:07                8450
intlcalendar.isset.php                             29-May-2024 00:07                4921
intlcalendar.isweekend.php                         29-May-2024 00:07                9098
intlcalendar.roll.php                              29-May-2024 00:07                9593
intlcalendar.set.php                               29-May-2024 00:07               16114
intlcalendar.setdate.php                           29-May-2024 00:07                4901
intlcalendar.setdatetime.php                       29-May-2024 00:07                6824
intlcalendar.setfirstdayofweek.php                 29-May-2024 00:07                8957
intlcalendar.setlenient.php                        29-May-2024 00:07                5147
intlcalendar.setminimaldaysinfirstweek.php         29-May-2024 00:07                5492
intlcalendar.setrepeatedwalltimeoption.php         29-May-2024 00:07                6620
intlcalendar.setskippedwalltimeoption.php          29-May-2024 00:07                7487
intlcalendar.settime.php                           29-May-2024 00:07                8782
intlcalendar.settimezone.php                       29-May-2024 00:07               11324
intlcalendar.todatetime.php                        29-May-2024 00:07                7238
intlchar.charage.php                               29-May-2024 00:07                5967
intlchar.chardigitvalue.php                        29-May-2024 00:07                5628
intlchar.chardirection.php                         29-May-2024 00:07               10781
intlchar.charfromname.php                          29-May-2024 00:07                7336
intlchar.charmirror.php                            29-May-2024 00:07                6796
intlchar.charname.php                              29-May-2024 00:07                7739
intlchar.chartype.php                              29-May-2024 00:07               11669
intlchar.chr.php                                   29-May-2024 00:07                5741
intlchar.digit.php                                 29-May-2024 00:07                8567
intlchar.enumcharnames.php                         29-May-2024 00:07                9151
intlchar.enumchartypes.php                         29-May-2024 00:07                5880
intlchar.foldcase.php                              29-May-2024 00:07                4148
intlchar.fordigit.php                              29-May-2024 00:07                7163
intlchar.getbidipairedbracket.php                  29-May-2024 00:07                6556
intlchar.getblockcode.php                          29-May-2024 00:07                5682
intlchar.getcombiningclass.php                     29-May-2024 00:07                5026
intlchar.getfc-nfkc-closure.php                    29-May-2024 00:07                5047
intlchar.getintpropertymaxvalue.php                29-May-2024 00:07                6428
intlchar.getintpropertyminvalue.php                29-May-2024 00:07                6421
intlchar.getintpropertyvalue.php                   29-May-2024 00:07                8149
intlchar.getnumericvalue.php                       29-May-2024 00:07                5732
intlchar.getpropertyenum.php                       29-May-2024 00:07                6780
intlchar.getpropertyname.php                       29-May-2024 00:07                9126
intlchar.getpropertyvalueenum.php                  29-May-2024 00:07                8024
intlchar.getpropertyvaluename.php                  29-May-2024 00:07               10939
intlchar.getunicodeversion.php                     29-May-2024 00:07                4027
intlchar.hasbinaryproperty.php                     29-May-2024 00:07                9110
intlchar.isalnum.php                               29-May-2024 00:07                6081
intlchar.isalpha.php                               29-May-2024 00:07                5964
intlchar.isbase.php                                29-May-2024 00:07                6260
intlchar.isblank.php                               29-May-2024 00:07                6923
intlchar.iscntrl.php                               29-May-2024 00:07                7036
intlchar.isdefined.php                             29-May-2024 00:07                6937
intlchar.isdigit.php                               29-May-2024 00:07                6275
intlchar.isgraph.php                               29-May-2024 00:07                6243
intlchar.isidignorable.php                         29-May-2024 00:07                6469
intlchar.isidpart.php                              29-May-2024 00:07                7110
intlchar.isidstart.php                             29-May-2024 00:07                6536
intlchar.isisocontrol.php                          29-May-2024 00:07                5743
intlchar.isjavaidpart.php                          29-May-2024 00:07                7028
intlchar.isjavaidstart.php                         29-May-2024 00:07                6758
intlchar.isjavaspacechar.php                       29-May-2024 00:07                6991
intlchar.islower.php                               29-May-2024 00:07                7453
intlchar.ismirrored.php                            29-May-2024 00:07                5867
intlchar.isprint.php                               29-May-2024 00:07                6362
intlchar.ispunct.php                               29-May-2024 00:07                6006
intlchar.isspace.php                               29-May-2024 00:07                6769
intlchar.istitle.php                               29-May-2024 00:07                7633
intlchar.isualphabetic.php                         29-May-2024 00:07                6080
intlchar.isulowercase.php                          29-May-2024 00:07                7115
intlchar.isupper.php                               29-May-2024 00:07                7444
intlchar.isuuppercase.php                          29-May-2024 00:07                7153
intlchar.isuwhitespace.php                         29-May-2024 00:07                7575
intlchar.iswhitespace.php                          29-May-2024 00:07                7465
intlchar.isxdigit.php                              29-May-2024 00:07                7333
intlchar.ord.php                                   29-May-2024 00:07                5604
intlchar.tolower.php                               29-May-2024 00:07                7987
intlchar.totitle.php                               29-May-2024 00:07                8173
intlchar.toupper.php                               29-May-2024 00:07                7872
intlcodepointbreakiterator.getlastcodepoint.php    29-May-2024 00:07                2759
intldateformatter.create.php                       29-May-2024 00:07               27973
intldateformatter.format.php                       29-May-2024 00:07               26814
intldateformatter.formatobject.php                 29-May-2024 00:07               14686
intldateformatter.getcalendar.php                  29-May-2024 00:07                9516
intldateformatter.getcalendarobject.php            29-May-2024 00:07                7769
intldateformatter.getdatetype.php                  29-May-2024 00:07               11895
intldateformatter.geterrorcode.php                 29-May-2024 00:07                8803
intldateformatter.geterrormessage.php              29-May-2024 00:07                8722
intldateformatter.getlocale.php                    29-May-2024 00:07               12200
intldateformatter.getpattern.php                   29-May-2024 00:07               11069
intldateformatter.gettimetype.php                  29-May-2024 00:07               11796
intldateformatter.gettimezone.php                  29-May-2024 00:07                8761
intldateformatter.gettimezoneid.php                29-May-2024 00:07                9039
intldateformatter.islenient.php                    29-May-2024 00:07               15029
intldateformatter.localtime.php                    29-May-2024 00:07               11679
intldateformatter.parse.php                        29-May-2024 00:07               13402
intldateformatter.setcalendar.php                  29-May-2024 00:07               14187
intldateformatter.setlenient.php                   29-May-2024 00:07               15902
intldateformatter.setpattern.php                   29-May-2024 00:07               11695
intldateformatter.settimezone.php                  29-May-2024 00:07               12573
intldatepatterngenerator.create.php                29-May-2024 00:07                4437
intldatepatterngenerator.getbestpattern.php        29-May-2024 00:07                6956
intlgregoriancalendar.construct.php                29-May-2024 00:07                5693
intlgregoriancalendar.createfromdate.php           29-May-2024 00:07                7455
intlgregoriancalendar.createfromdatetime.php       29-May-2024 00:07                9164
intlgregoriancalendar.getgregorianchange.php       29-May-2024 00:07                2739
intlgregoriancalendar.isleapyear.php               29-May-2024 00:07                3099
intlgregoriancalendar.setgregorianchange.php       29-May-2024 00:07                3129
intliterator.current.php                           29-May-2024 00:07                2391
intliterator.key.php                               29-May-2024 00:07                2360
intliterator.next.php                              29-May-2024 00:07                2376
intliterator.rewind.php                            29-May-2024 00:07                2404
intliterator.valid.php                             29-May-2024 00:07                2382
intlpartsiterator.getbreakiterator.php             29-May-2024 00:07                2602
intlrulebasedbreakiterator.construct.php           29-May-2024 00:07                3233
intlrulebasedbreakiterator.getbinaryrules.php      29-May-2024 00:07                2859
intlrulebasedbreakiterator.getrules.php            29-May-2024 00:07                2823
intlrulebasedbreakiterator.getrulestatus.php       29-May-2024 00:07                2795
intlrulebasedbreakiterator.getrulestatusvec.php    29-May-2024 00:07                2917
intltimezone.construct.php                         29-May-2024 00:07                2021
intltimezone.countequivalentids.php                29-May-2024 00:07                3727
intltimezone.createdefault.php                     29-May-2024 00:07                3059
intltimezone.createenumeration.php                 29-May-2024 00:07                4813
intltimezone.createtimezone.php                    29-May-2024 00:07                3703
intltimezone.createtimezoneidenumeration.php       29-May-2024 00:07                5897
intltimezone.fromdatetimezone.php                  29-May-2024 00:07                3824
intltimezone.getcanonicalid.php                    29-May-2024 00:07                4450
intltimezone.getdisplayname.php                    29-May-2024 00:07                5631
intltimezone.getdstsavings.php                     29-May-2024 00:07                3191
intltimezone.getequivalentid.php                   29-May-2024 00:07                4133
intltimezone.geterrorcode.php                      29-May-2024 00:07                3363
intltimezone.geterrormessage.php                   29-May-2024 00:07                3391
intltimezone.getgmt.php                            29-May-2024 00:07                2908
intltimezone.getid.php                             29-May-2024 00:07                3243
intltimezone.getidforwindowsid.php                 29-May-2024 00:07                5914
intltimezone.getoffset.php                         29-May-2024 00:07                5151
intltimezone.getrawoffset.php                      29-May-2024 00:07                3142
intltimezone.getregion.php                         29-May-2024 00:07                3738
intltimezone.gettzdataversion.php                  29-May-2024 00:07                3282
intltimezone.getunknown.php                        29-May-2024 00:07                3174
intltimezone.getwindowsid.php                      29-May-2024 00:07                4489
intltimezone.hassamerules.php                      29-May-2024 00:07                3565
intltimezone.todatetimezone.php                    29-May-2024 00:07                3492
intltimezone.usedaylighttime.php                   29-May-2024 00:07                3175
intro-whatcando.php                                29-May-2024 00:07                8463
intro-whatis.php                                   29-May-2024 00:07                4435
intro.apache.php                                   29-May-2024 00:07                1193
intro.apcu.php                                     29-May-2024 00:07                1832
intro.array.php                                    29-May-2024 00:07                2060
intro.bc.php                                       29-May-2024 00:07                4580
intro.bzip2.php                                    29-May-2024 00:07                1214
intro.calendar.php                                 29-May-2024 00:07                2160
intro.classobj.php                                 29-May-2024 00:07                1754
intro.cmark.php                                    29-May-2024 00:07                7345
intro.com.php                                      29-May-2024 00:07                3205
intro.componere.php                                29-May-2024 00:07                6671
intro.ctype.php                                    29-May-2024 00:07                4056
intro.cubrid.php                                   29-May-2024 00:07                1478
intro.curl.php                                     29-May-2024 00:07                1673
intro.datetime.php                                 29-May-2024 00:07                2800
intro.dba.php                                      29-May-2024 00:07                1498
intro.dbase.php                                    29-May-2024 00:07                6801
intro.dio.php                                      29-May-2024 00:07                1655
intro.dom.php                                      29-May-2024 00:07                1716
intro.ds.php                                       29-May-2024 00:07                1458
intro.eio.php                                      29-May-2024 00:07               14364
intro.enchant.php                                  29-May-2024 00:07                2611
intro.errorfunc.php                                29-May-2024 00:07                2115
intro.ev.php                                       29-May-2024 00:07                2269
intro.event.php                                    29-May-2024 00:07                1971
intro.exec.php                                     29-May-2024 00:07                1771
intro.exif.php                                     29-May-2024 00:07                1497
intro.expect.php                                   29-May-2024 00:07                1432
intro.fann.php                                     29-May-2024 00:07                1411
intro.fdf.php                                      29-May-2024 00:07                3827
intro.ffi.php                                      29-May-2024 00:07                2854
intro.fileinfo.php                                 29-May-2024 00:07                1410
intro.filesystem.php                               29-May-2024 00:07                1477
intro.filter.php                                   29-May-2024 00:07                2821
intro.fpm.php                                      29-May-2024 00:07                1354
intro.ftp.php                                      29-May-2024 00:07                1852
intro.funchand.php                                 29-May-2024 00:07                1216
intro.gearman.php                                  29-May-2024 00:07                1662
intro.gender.php                                   29-May-2024 00:07                1330
intro.geoip.php                                    29-May-2024 00:07                1569
intro.gettext.php                                  29-May-2024 00:07                1549
intro.gmagick.php                                  29-May-2024 00:07                1692
intro.gmp.php                                      29-May-2024 00:07                3012
intro.gnupg.php                                    29-May-2024 00:07                1219
intro.hash.php                                     29-May-2024 00:07                1237
intro.hrtime.php                                   29-May-2024 00:07                1667
intro.ibase.php                                    29-May-2024 00:07                3175
intro.ibm-db2.php                                  29-May-2024 00:07                1279
intro.iconv.php                                    29-May-2024 00:07                1911
intro.igbinary.php                                 29-May-2024 00:07                1674
intro.image.php                                    29-May-2024 00:07                5870
intro.imagick.php                                  29-May-2024 00:07                1844
intro.imap.php                                     29-May-2024 00:07                1754
intro.info.php                                     29-May-2024 00:07                1542
intro.inotify.php                                  29-May-2024 00:07                2341
intro.intl.php                                     29-May-2024 00:07                5899
intro.json.php                                     29-May-2024 00:07                1693
intro.ldap.php                                     29-May-2024 00:07                4079
intro.libxml.php                                   29-May-2024 00:07                1676
intro.lua.php                                      29-May-2024 00:07                1267
intro.luasandbox.php                               29-May-2024 00:07                2364
intro.lzf.php                                      29-May-2024 00:07                1583
intro.mail.php                                     29-May-2024 00:07                1222
intro.mailparse.php                                29-May-2024 00:07                1941
intro.math.php                                     29-May-2024 00:07                2012
intro.mbstring.php                                 29-May-2024 00:07                2746
intro.mcrypt.php                                   29-May-2024 00:07                2344
intro.memcache.php                                 29-May-2024 00:07                1683
intro.memcached.php                                29-May-2024 00:07                1876
intro.mhash.php                                    29-May-2024 00:07                2905
intro.misc.php                                     29-May-2024 00:07                1169
intro.mqseries.php                                 29-May-2024 00:07                1743
intro.mysql-xdevapi.php                            29-May-2024 00:07                1879
intro.mysql.php                                    29-May-2024 00:07                2162
intro.mysqli.php                                   29-May-2024 00:07                2167
intro.mysqlnd.php                                  29-May-2024 00:07                1945
intro.network.php                                  29-May-2024 00:07                1164
intro.oauth.php                                    29-May-2024 00:07                1333
intro.oci8.php                                     29-May-2024 00:07                1475
intro.opcache.php                                  29-May-2024 00:07                1529
intro.openal.php                                   29-May-2024 00:07                1252
intro.openssl.php                                  29-May-2024 00:07                1583
intro.outcontrol.php                               29-May-2024 00:07                1862
intro.parallel.php                                 29-May-2024 00:07                6909
intro.parle.php                                    29-May-2024 00:07                3438
intro.password.php                                 29-May-2024 00:07                1435
intro.pcntl.php                                    29-May-2024 00:07                2616
intro.pcre.php                                     29-May-2024 00:07                2824
intro.pdo.php                                      29-May-2024 00:07                2150
intro.pgsql.php                                    29-May-2024 00:07                1577
intro.phar.php                                     29-May-2024 00:07               10014
intro.phpdbg.php                                   29-May-2024 00:07                6040
intro.posix.php                                    29-May-2024 00:07                1641
intro.ps.php                                       29-May-2024 00:07                1761
intro.pspell.php                                   29-May-2024 00:07                1194
intro.pthreads.php                                 29-May-2024 00:07                9131
intro.quickhash.php                                29-May-2024 00:07                1266
intro.radius.php                                   29-May-2024 00:07                2169
intro.random.php                                   29-May-2024 00:07                1108
intro.rar.php                                      29-May-2024 00:07                1540
intro.readline.php                                 29-May-2024 00:07                1961
intro.recode.php                                   29-May-2024 00:07                2356
intro.reflection.php                               29-May-2024 00:07                1884
intro.rnp.php                                      29-May-2024 00:07                1279
intro.rpminfo.php                                  29-May-2024 00:07                1396
intro.rrd.php                                      29-May-2024 00:07                1435
intro.runkit7.php                                  29-May-2024 00:07                1478
intro.scoutapm.php                                 29-May-2024 00:07                1462
intro.seaslog.php                                  29-May-2024 00:07                3932
intro.sem.php                                      29-May-2024 00:07                3227
intro.session.php                                  29-May-2024 00:07                5529
intro.shmop.php                                    29-May-2024 00:07                1240
intro.simdjson.php                                 29-May-2024 00:07                1228
intro.simplexml.php                                29-May-2024 00:07                1312
intro.snmp.php                                     29-May-2024 00:07                1658
intro.soap.php                                     29-May-2024 00:07                1463
intro.sockets.php                                  29-May-2024 00:07                2636
intro.sodium.php                                   29-May-2024 00:07                1329
intro.solr.php                                     29-May-2024 00:07                1784
intro.spl.php                                      29-May-2024 00:07                1574
intro.sqlite3.php                                  29-May-2024 00:07                1175
intro.sqlsrv.php                                   29-May-2024 00:07                2165
intro.ssdeep.php                                   29-May-2024 00:07                1758
intro.ssh2.php                                     29-May-2024 00:07                1365
intro.stats.php                                    29-May-2024 00:07                1510
intro.stomp.php                                    29-May-2024 00:07                1343
intro.stream.php                                   29-May-2024 00:07                4372
intro.strings.php                                  29-May-2024 00:07                1689
intro.svm.php                                      29-May-2024 00:07                1241
intro.svn.php                                      29-May-2024 00:07                1765
intro.swoole.php                                   29-May-2024 00:07                1635
intro.sync.php                                     29-May-2024 00:07                2356
intro.taint.php                                    29-May-2024 00:07                4295
intro.tcpwrap.php                                  29-May-2024 00:07                1264
intro.tidy.php                                     29-May-2024 00:07                1497
intro.tokenizer.php                                29-May-2024 00:07                1548
intro.trader.php                                   29-May-2024 00:07                2387
intro.ui.php                                       29-May-2024 00:07                1200
intro.uodbc.php                                    29-May-2024 00:07                2822
intro.uopz.php                                     29-May-2024 00:07                2285
intro.url.php                                      29-May-2024 00:07                1159
intro.v8js.php                                     29-May-2024 00:07                1227
intro.var.php                                      29-May-2024 00:07                1321
intro.var_representation.php                       29-May-2024 00:07                1428
intro.varnish.php                                  29-May-2024 00:07                1317
intro.wddx.php                                     29-May-2024 00:07                2304
intro.win32service.php                             29-May-2024 00:07                1450
intro.wincache.php                                 29-May-2024 00:07                4889
intro.wkhtmltox.php                                29-May-2024 00:07                1276
intro.xattr.php                                    29-May-2024 00:07                1190
intro.xdiff.php                                    29-May-2024 00:07                2718
intro.xhprof.php                                   29-May-2024 00:07                2793
intro.xlswriter.php                                29-May-2024 00:07                1189
intro.xml.php                                      29-May-2024 00:07                2664
intro.xmldiff.php                                  29-May-2024 00:07                1410
intro.xmlreader.php                                29-May-2024 00:07                1501
intro.xmlrpc.php                                   29-May-2024 00:07                1908
intro.xmlwriter.php                                29-May-2024 00:07                1579
intro.xsl.php                                      29-May-2024 00:07                1352
intro.yac.php                                      29-May-2024 00:07                1201
intro.yaconf.php                                   29-May-2024 00:07                2544
intro.yaf.php                                      29-May-2024 00:07                1549
intro.yaml.php                                     29-May-2024 00:07                1405
intro.yar.php                                      29-May-2024 00:07                1270
intro.yaz.php                                      29-May-2024 00:07                2596
intro.zip.php                                      29-May-2024 00:07                1205
intro.zlib.php                                     29-May-2024 00:07                1756
intro.zmq.php                                      29-May-2024 00:07                1386
intro.zookeeper.php                                29-May-2024 00:07                1447
introduction.php                                   29-May-2024 00:07                1432
iterator.current.php                               29-May-2024 00:07                2201
iterator.key.php                                   29-May-2024 00:07                2644
iterator.next.php                                  29-May-2024 00:07                2452
iterator.rewind.php                                29-May-2024 00:07                2601
iterator.valid.php                                 29-May-2024 00:07                2866
iteratoraggregate.getiterator.php                  29-May-2024 00:07                2942
iteratoriterator.construct.php                     29-May-2024 00:07                3487
iteratoriterator.current.php                       29-May-2024 00:07                2767
iteratoriterator.getinneriterator.php              29-May-2024 00:07                3214
iteratoriterator.key.php                           29-May-2024 00:07                2715
iteratoriterator.next.php                          29-May-2024 00:07                2874
iteratoriterator.rewind.php                        29-May-2024 00:07                2893
iteratoriterator.valid.php                         29-May-2024 00:07                3086
json.configuration.php                             29-May-2024 00:07                1303
json.constants.php                                 29-May-2024 00:07               16947
json.installation.php                              29-May-2024 00:07                1830
json.requirements.php                              29-May-2024 00:07                1247
json.resources.php                                 29-May-2024 00:07                1254
json.setup.php                                     29-May-2024 00:07                1597
jsonserializable.jsonserialize.php                 29-May-2024 00:07               12277
langref.php                                        29-May-2024 00:07               21435
language.attributes.classes.php                    29-May-2024 00:07                6738
language.attributes.overview.php                   29-May-2024 00:07               10503
language.attributes.php                            29-May-2024 00:07                1850
language.attributes.reflection.php                 29-May-2024 00:07                8463
language.attributes.syntax.php                     29-May-2024 00:07                6189
language.basic-syntax.comments.php                 29-May-2024 00:07                4023
language.basic-syntax.instruction-separation.php   29-May-2024 00:07                4277
language.basic-syntax.php                          29-May-2024 00:07                1717
language.basic-syntax.phpmode.php                  29-May-2024 00:07                4748
language.basic-syntax.phptags.php                  29-May-2024 00:07                4965
language.constants.magic.php                       29-May-2024 00:07                5705
language.constants.php                             29-May-2024 00:07                6571
language.constants.predefined.php                  29-May-2024 00:07                1528
language.constants.syntax.php                      29-May-2024 00:07               10384
language.control-structures.php                    29-May-2024 00:07                2778
language.enumerations.backed.php                   29-May-2024 00:07               10596
language.enumerations.basics.php                   29-May-2024 00:07                8638
language.enumerations.constants.php                29-May-2024 00:07                2307
language.enumerations.examples.php                 29-May-2024 00:07                7338
language.enumerations.expressions.php              29-May-2024 00:07                6718
language.enumerations.listing.php                  29-May-2024 00:07                2329
language.enumerations.methods.php                  29-May-2024 00:07               13605
language.enumerations.object-differences.inheri..> 29-May-2024 00:07                6245
language.enumerations.object-differences.php       29-May-2024 00:07                4886
language.enumerations.overview.php                 29-May-2024 00:07                2533
language.enumerations.php                          29-May-2024 00:07                2547
language.enumerations.serialization.php            29-May-2024 00:07                5013
language.enumerations.static-methods.php           29-May-2024 00:07                3271
language.enumerations.traits.php                   29-May-2024 00:07                4352
language.errors.basics.php                         29-May-2024 00:07                5271
language.errors.php                                29-May-2024 00:07                1933
language.errors.php7.php                           29-May-2024 00:07                5801
language.exceptions.extending.php                  29-May-2024 00:07               20252
language.exceptions.php                            29-May-2024 00:07               28112
language.expressions.php                           29-May-2024 00:07               16601
language.fibers.php                                29-May-2024 00:07                6769
language.functions.php                             29-May-2024 00:07                2015
language.generators.comparison.php                 29-May-2024 00:07                8936
language.generators.overview.php                   29-May-2024 00:07                9131
language.generators.php                            29-May-2024 00:07                1682
language.generators.syntax.php                     29-May-2024 00:07               23925
language.namespaces.basics.php                     29-May-2024 00:07               11372
language.namespaces.definition.php                 29-May-2024 00:07                4378
language.namespaces.definitionmultiple.php         29-May-2024 00:07                9237
language.namespaces.dynamic.php                    29-May-2024 00:07                8378
language.namespaces.fallback.php                   29-May-2024 00:07                6166
language.namespaces.faq.php                        29-May-2024 00:07               32671
language.namespaces.global.php                     29-May-2024 00:07                2872
language.namespaces.importing.php                  29-May-2024 00:07               15233
language.namespaces.nested.php                     29-May-2024 00:07                2893
language.namespaces.nsconstants.php                29-May-2024 00:07                8958
language.namespaces.php                            29-May-2024 00:07                2631
language.namespaces.rationale.php                  29-May-2024 00:07                6446
language.namespaces.rules.php                      29-May-2024 00:07               12284
language.oop5.abstract.php                         29-May-2024 00:07               10996
language.oop5.anonymous.php                        29-May-2024 00:07               10517
language.oop5.autoload.php                         29-May-2024 00:07                7038
language.oop5.basic.php                            29-May-2024 00:07               49018
language.oop5.changelog.php                        29-May-2024 00:07               14108
language.oop5.cloning.php                          29-May-2024 00:07                9063
language.oop5.constants.php                        29-May-2024 00:07                9168
language.oop5.decon.php                            29-May-2024 00:07               28989
language.oop5.final.php                            29-May-2024 00:07                6345
language.oop5.inheritance.php                      29-May-2024 00:07               14044
language.oop5.interfaces.php                       29-May-2024 00:07               23175
language.oop5.iterations.php                       29-May-2024 00:07                5839
language.oop5.late-static-bindings.php             29-May-2024 00:07               14650
language.oop5.magic.php                            29-May-2024 00:07               44867
language.oop5.object-comparison.php                29-May-2024 00:07                8922
language.oop5.overloading.php                      29-May-2024 00:07               25162
language.oop5.paamayim-nekudotayim.php             29-May-2024 00:07                8535
language.oop5.php                                  29-May-2024 00:07                3554
language.oop5.properties.php                       29-May-2024 00:07               27779
language.oop5.references.php                       29-May-2024 00:07                5889
language.oop5.serialization.php                    29-May-2024 00:07                7329
language.oop5.static.php                           29-May-2024 00:07                9909
language.oop5.traits.php                           29-May-2024 00:07               35289
language.oop5.variance.php                         29-May-2024 00:07               16218
language.oop5.visibility.php                       29-May-2024 00:07               25189
language.operators.arithmetic.php                  29-May-2024 00:07                6399
language.operators.array.php                       29-May-2024 00:07                8857
language.operators.assignment.php                  29-May-2024 00:07               11236
language.operators.bitwise.php                     29-May-2024 00:07               43728
language.operators.comparison.php                  29-May-2024 00:07               42062
language.operators.errorcontrol.php                29-May-2024 00:07                5853
language.operators.execution.php                   29-May-2024 00:07                3451
language.operators.increment.php                   29-May-2024 00:07               14039
language.operators.logical.php                     29-May-2024 00:07                7341
language.operators.php                             29-May-2024 00:07                3945
language.operators.precedence.php                  29-May-2024 00:07               19659
language.operators.string.php                      29-May-2024 00:07                3177
language.operators.type.php                        29-May-2024 00:07               18309
language.references.arent.php                      29-May-2024 00:07                3408
language.references.pass.php                       29-May-2024 00:07                6899
language.references.php                            29-May-2024 00:07                2061
language.references.return.php                     29-May-2024 00:07                7441
language.references.spot.php                       29-May-2024 00:07                2757
language.references.unset.php                      29-May-2024 00:07                2553
language.references.whatare.php                    29-May-2024 00:07                2087
language.references.whatdo.php                     29-May-2024 00:07               18622
language.types.array.php                           29-May-2024 00:07               99830
language.types.boolean.php                         29-May-2024 00:07               10093
language.types.callable.php                        29-May-2024 00:07               12165
language.types.declarations.php                    29-May-2024 00:07               42960
language.types.enumerations.php                    29-May-2024 00:07                3786
language.types.float.php                           29-May-2024 00:07                9678
language.types.integer.php                         29-May-2024 00:07               21065
language.types.intro.php                           29-May-2024 00:07                8620
language.types.iterable.php                        29-May-2024 00:07                3068
language.types.mixed.php                           29-May-2024 00:07                1808
language.types.never.php                           29-May-2024 00:07                1937
language.types.null.php                            29-May-2024 00:07                3612
language.types.numeric-strings.php                 29-May-2024 00:07               10409
language.types.object.php                          29-May-2024 00:07                5792
language.types.php                                 29-May-2024 00:07                2816
language.types.relative-class-types.php            29-May-2024 00:07                2435
language.types.resource.php                        29-May-2024 00:07                3220
language.types.string.php                          29-May-2024 00:07               78736
language.types.type-juggling.php                   29-May-2024 00:07               27074
language.types.type-system.php                     29-May-2024 00:07                8415
language.types.value.php                           29-May-2024 00:07                2150
language.types.void.php                            29-May-2024 00:07                1971
language.variables.basics.php                      29-May-2024 00:07               14763
language.variables.external.php                    29-May-2024 00:07               17102
language.variables.php                             29-May-2024 00:07                1801
language.variables.predefined.php                  29-May-2024 00:07                3102
language.variables.scope.php                       29-May-2024 00:07               28005
language.variables.superglobals.php                29-May-2024 00:07                4442
language.variables.variable.php                    29-May-2024 00:07               10127
ldap.configuration.php                             29-May-2024 00:07                2493
ldap.constants.php                                 29-May-2024 00:07               32868
ldap.controls.php                                  29-May-2024 00:07                9932
ldap.examples-basic.php                            29-May-2024 00:07                8129
ldap.examples-controls.php                         29-May-2024 00:07               15992
ldap.examples.php                                  29-May-2024 00:07                1446
ldap.installation.php                              29-May-2024 00:07                2907
ldap.requirements.php                              29-May-2024 00:07                1533
ldap.resources.php                                 29-May-2024 00:07                1463
ldap.setup.php                                     29-May-2024 00:07                1624
ldap.using.php                                     29-May-2024 00:07                2254
libxml.configuration.php                           29-May-2024 00:07                1366
libxml.constants.php                               29-May-2024 00:07               13796
libxml.installation.php                            29-May-2024 00:07                2056
libxml.installation_old.php                        29-May-2024 00:07                2685
libxml.requirements.php                            29-May-2024 00:07                1399
libxml.resources.php                               29-May-2024 00:07                1268
libxml.setup.php                                   29-May-2024 00:07                1795
limititerator.construct.php                        29-May-2024 00:07                7351
limititerator.current.php                          29-May-2024 00:07                3600
limititerator.getposition.php                      29-May-2024 00:07                5782
limititerator.key.php                              29-May-2024 00:07                3650
limititerator.next.php                             29-May-2024 00:07                3332
limititerator.rewind.php                           29-May-2024 00:07                3500
limititerator.seek.php                             29-May-2024 00:07                4159
limititerator.valid.php                            29-May-2024 00:07                3565
locale.acceptfromhttp.php                          29-May-2024 00:07                6292
locale.canonicalize.php                            29-May-2024 00:07                3196
locale.composelocale.php                           29-May-2024 00:07               13543
locale.filtermatches.php                           29-May-2024 00:07                9519
locale.getallvariants.php                          29-May-2024 00:07                6711
locale.getdefault.php                              29-May-2024 00:07                6129
locale.getdisplaylanguage.php                      29-May-2024 00:07               10159
locale.getdisplayname.php                          29-May-2024 00:07               10181
locale.getdisplayregion.php                        29-May-2024 00:07               10150
locale.getdisplayscript.php                        29-May-2024 00:07               10163
locale.getdisplayvariant.php                       29-May-2024 00:07               10203
locale.getkeywords.php                             29-May-2024 00:07                7306
locale.getprimarylanguage.php                      29-May-2024 00:07                6177
locale.getregion.php                               29-May-2024 00:07                6140
locale.getscript.php                               29-May-2024 00:07                5829
locale.lookup.php                                  29-May-2024 00:07               10429
locale.parselocale.php                             29-May-2024 00:07                7568
locale.setdefault.php                              29-May-2024 00:07                5478
lua.assign.php                                     29-May-2024 00:07                4650
lua.call.php                                       29-May-2024 00:07                7544
lua.configuration.php                              29-May-2024 00:07                1296
lua.construct.php                                  29-May-2024 00:07                2440
lua.eval.php                                       29-May-2024 00:07                3801
lua.getversion.php                                 29-May-2024 00:07                2322
lua.include.php                                    29-May-2024 00:07                2744
lua.installation.php                               29-May-2024 00:07                2008
lua.registercallback.php                           29-May-2024 00:07                4609
lua.requirements.php                               29-May-2024 00:07                1296
lua.resources.php                                  29-May-2024 00:07                1247
lua.setup.php                                      29-May-2024 00:07                1584
luaclosure.invoke.php                              29-May-2024 00:07                4158
luasandbox.callfunction.php                        29-May-2024 00:07                5105
luasandbox.configuration.php                       29-May-2024 00:07                1345
luasandbox.disableprofiler.php                     29-May-2024 00:07                2918
luasandbox.enableprofiler.php                      29-May-2024 00:07                3550
luasandbox.examples-basic.php                      29-May-2024 00:07                6658
luasandbox.examples.php                            29-May-2024 00:07                1506
luasandbox.getcpuusage.php                         29-May-2024 00:07                3674
luasandbox.getmemoryusage.php                      29-May-2024 00:07                3249
luasandbox.getpeakmemoryusage.php                  29-May-2024 00:07                3299
luasandbox.getprofilerfunctionreport.php           29-May-2024 00:07                6044
luasandbox.getversioninfo.php                      29-May-2024 00:07                3155
luasandbox.installation.php                        29-May-2024 00:07                2109
luasandbox.loadbinary.php                          29-May-2024 00:07                3679
luasandbox.loadstring.php                          29-May-2024 00:07                5670
luasandbox.pauseusagetimer.php                     29-May-2024 00:07                9472
luasandbox.registerlibrary.php                     29-May-2024 00:07                6676
luasandbox.requirements.php                        29-May-2024 00:07                1782
luasandbox.resources.php                           29-May-2024 00:07                1312
luasandbox.setcpulimit.php                         29-May-2024 00:07                6192
luasandbox.setmemorylimit.php                      29-May-2024 00:07                5592
luasandbox.setup.php                               29-May-2024 00:07                1675
luasandbox.unpauseusagetimer.php                   29-May-2024 00:07                3214
luasandbox.wrapphpfunction.php                     29-May-2024 00:07                4417
luasandboxfunction.call.php                        29-May-2024 00:07                8083
luasandboxfunction.construct.php                   29-May-2024 00:07                2733
luasandboxfunction.dump.php                        29-May-2024 00:07                2496
lzf.configuration.php                              29-May-2024 00:07                1296
lzf.constants.php                                  29-May-2024 00:07                1189
lzf.installation.php                               29-May-2024 00:07                2747
lzf.requirements.php                               29-May-2024 00:07                1203
lzf.resources.php                                  29-May-2024 00:07                1247
lzf.setup.php                                      29-May-2024 00:07                1607
magick.getimagescene.php                           29-May-2024 00:07                2623
magick.stripimage.php                              29-May-2024 00:07                2676
mail.configuration.php                             29-May-2024 00:07                8690
mail.constants.php                                 29-May-2024 00:07                1200
mail.installation.php                              29-May-2024 00:07                1266
mail.requirements.php                              29-May-2024 00:07                2134
mail.resources.php                                 29-May-2024 00:07                1254
mail.setup.php                                     29-May-2024 00:07                1618
mailparse.configuration.php                        29-May-2024 00:07                2622
mailparse.constants.php                            29-May-2024 00:07                2426
mailparse.installation.php                         29-May-2024 00:07                2470
mailparse.requirements.php                         29-May-2024 00:07                1245
mailparse.resources.php                            29-May-2024 00:07                1606
mailparse.setup.php                                29-May-2024 00:07                1683
manual.php                                         29-May-2024 00:07                1312
math.configuration.php                             29-May-2024 00:07                1303
math.constants.php                                 29-May-2024 00:07                7252
math.installation.php                              29-May-2024 00:07                1266
math.requirements.php                              29-May-2024 00:07                1210
math.resources.php                                 29-May-2024 00:07                1254
math.setup.php                                     29-May-2024 00:07                1613
mbstring.configuration.php                         29-May-2024 00:07               17372
mbstring.constants.php                             29-May-2024 00:07                7014
mbstring.encodings.php                             29-May-2024 00:07               15807
mbstring.http.php                                  29-May-2024 00:07                5412
mbstring.installation.php                          29-May-2024 00:07                3558
mbstring.ja-basic.php                              29-May-2024 00:07                3839
mbstring.overload.php                              29-May-2024 00:07                7591
mbstring.php4.req.php                              29-May-2024 00:07                4158
mbstring.requirements.php                          29-May-2024 00:07                1238
mbstring.resources.php                             29-May-2024 00:07                1282
mbstring.setup.php                                 29-May-2024 00:07                1677
mbstring.supported-encodings.php                   29-May-2024 00:07                8427
mcrypt.ciphers.php                                 29-May-2024 00:07                6581
mcrypt.configuration.php                           29-May-2024 00:07                3845
mcrypt.constants.php                               29-May-2024 00:07                6607
mcrypt.installation.php                            29-May-2024 00:07                1806
mcrypt.requirements.php                            29-May-2024 00:07                2222
mcrypt.resources.php                               29-May-2024 00:07                1386
mcrypt.setup.php                                   29-May-2024 00:07                1652
memcache.add.php                                   29-May-2024 00:07                7287
memcache.addserver.php                             29-May-2024 00:07               13834
memcache.close.php                                 29-May-2024 00:07                5231
memcache.connect.php                               29-May-2024 00:07                7489
memcache.constants.php                             29-May-2024 00:07                5222
memcache.decrement.php                             29-May-2024 00:07                7322
memcache.delete.php                                29-May-2024 00:07                6591
memcache.examples-overview.php                     29-May-2024 00:07                6462
memcache.examples.php                              29-May-2024 00:07                1440
memcache.flush.php                                 29-May-2024 00:07                4642
memcache.get.php                                   29-May-2024 00:07                8884
memcache.getextendedstats.php                      29-May-2024 00:07                8258
memcache.getserverstatus.php                       29-May-2024 00:07                6231
memcache.getstats.php                              29-May-2024 00:07                4887
memcache.getversion.php                            29-May-2024 00:07                5107
memcache.increment.php                             29-May-2024 00:07                7115
memcache.ini.php                                   29-May-2024 00:07               10776
memcache.installation.php                          29-May-2024 00:07                2120
memcache.pconnect.php                              29-May-2024 00:07                6340
memcache.replace.php                               29-May-2024 00:07                7390
memcache.requirements.php                          29-May-2024 00:07                1372
memcache.resources.php                             29-May-2024 00:07                1344
memcache.set.php                                   29-May-2024 00:07                9751
memcache.setcompressthreshold.php                  29-May-2024 00:07                6077
memcache.setserverparams.php                       29-May-2024 00:07               11256
memcache.setup.php                                 29-May-2024 00:07                1665
memcached.add.php                                  29-May-2024 00:07                4741
memcached.addbykey.php                             29-May-2024 00:07                5683
memcached.addserver.php                            29-May-2024 00:07                7729
memcached.addservers.php                           29-May-2024 00:07                5489
memcached.append.php                               29-May-2024 00:07                7541
memcached.appendbykey.php                          29-May-2024 00:07                5216
memcached.callbacks.php                            29-May-2024 00:07                1543
memcached.callbacks.read-through.php               29-May-2024 00:07                4378
memcached.callbacks.result.php                     29-May-2024 00:07                4878
memcached.cas.php                                  29-May-2024 00:07                9515
memcached.casbykey.php                             29-May-2024 00:07                6009
memcached.configuration.php                        29-May-2024 00:07               28412
memcached.constants.php                            29-May-2024 00:07               29477
memcached.construct.php                            29-May-2024 00:07                5737
memcached.decrement.php                            29-May-2024 00:07                9197
memcached.decrementbykey.php                       29-May-2024 00:07                6033
memcached.delete.php                               29-May-2024 00:07                5780
memcached.deletebykey.php                          29-May-2024 00:07                5709
memcached.deletemulti.php                          29-May-2024 00:07                4922
memcached.deletemultibykey.php                     29-May-2024 00:07                5875
memcached.expiration.php                           29-May-2024 00:07                1954
memcached.fetch.php                                29-May-2024 00:07                6802
memcached.fetchall.php                             29-May-2024 00:07                6620
memcached.flush.php                                29-May-2024 00:07                4772
memcached.get.php                                  29-May-2024 00:07               10501
memcached.getallkeys.php                           29-May-2024 00:07                3119
memcached.getbykey.php                             29-May-2024 00:07                6667
memcached.getdelayed.php                           29-May-2024 00:07                8915
memcached.getdelayedbykey.php                      29-May-2024 00:07                5864
memcached.getmulti.php                             29-May-2024 00:07               20912
memcached.getmultibykey.php                        29-May-2024 00:07                5727
memcached.getoption.php                            29-May-2024 00:07                5214
memcached.getresultcode.php                        29-May-2024 00:07                4304
memcached.getresultmessage.php                     29-May-2024 00:07                4743
memcached.getserverbykey.php                       29-May-2024 00:07                7460
memcached.getserverlist.php                        29-May-2024 00:07                4657
memcached.getstats.php                             29-May-2024 00:07                5801
memcached.getversion.php                           29-May-2024 00:07                4045
memcached.increment.php                            29-May-2024 00:07                8527
memcached.incrementbykey.php                       29-May-2024 00:07                5966
memcached.installation.php                         29-May-2024 00:07                2624
memcached.ispersistent.php                         29-May-2024 00:07                3064
memcached.ispristine.php                           29-May-2024 00:07                2991
memcached.prepend.php                              29-May-2024 00:07                7576
memcached.prependbykey.php                         29-May-2024 00:07                5249
memcached.quit.php                                 29-May-2024 00:07                2512
memcached.replace.php                              29-May-2024 00:07                4813
memcached.replacebykey.php                         29-May-2024 00:07                5770
memcached.requirements.php                         29-May-2024 00:07                1546
memcached.resetserverlist.php                      29-May-2024 00:07                3230
memcached.resources.php                            29-May-2024 00:07                1289
memcached.sessions.php                             29-May-2024 00:07                2452
memcached.set.php                                  29-May-2024 00:07                9272
memcached.setbykey.php                             29-May-2024 00:07                7103
memcached.setmulti.php                             29-May-2024 00:07                6331
memcached.setmultibykey.php                        29-May-2024 00:07                5036
memcached.setoption.php                            29-May-2024 00:07                7388
memcached.setoptions.php                           29-May-2024 00:07                7002
memcached.setsaslauthdata.php                      29-May-2024 00:07                3569
memcached.setup.php                                29-May-2024 00:07                1683
memcached.touch.php                                29-May-2024 00:07                3861
memcached.touchbykey.php                           29-May-2024 00:07                4758
messageformatter.create.php                        29-May-2024 00:07               11310
messageformatter.format.php                        29-May-2024 00:07               10026
messageformatter.formatmessage.php                 29-May-2024 00:07               14720
messageformatter.geterrorcode.php                  29-May-2024 00:07                4109
messageformatter.geterrormessage.php               29-May-2024 00:07                7757
messageformatter.getlocale.php                     29-May-2024 00:07                5565
messageformatter.getpattern.php                    29-May-2024 00:07               10262
messageformatter.parse.php                         29-May-2024 00:07                9828
messageformatter.parsemessage.php                  29-May-2024 00:07               10126
messageformatter.setpattern.php                    29-May-2024 00:07               10861
mhash.configuration.php                            29-May-2024 00:07                1310
mhash.constants.php                                29-May-2024 00:07                4991
mhash.examples.php                                 29-May-2024 00:07                3387
mhash.installation.php                             29-May-2024 00:07                1627
mhash.requirements.php                             29-May-2024 00:07                1346
mhash.resources.php                                29-May-2024 00:07                1261
mhash.setup.php                                    29-May-2024 00:07                1632
migration56.changed-functions.php                  29-May-2024 00:07                6927
migration56.constants.php                          29-May-2024 00:07                6171
migration56.deprecated.php                         29-May-2024 00:07                6283
migration56.extensions.php                         29-May-2024 00:07                4373
migration56.incompatible.php                       29-May-2024 00:07                8523
migration56.new-features.php                       29-May-2024 00:07               28956
migration56.new-functions.php                      29-May-2024 00:07                7555
migration56.openssl.php                            29-May-2024 00:07               25885
migration56.php                                    29-May-2024 00:07                2432
migration70.changed-functions.php                  29-May-2024 00:07                5249
migration70.classes.php                            29-May-2024 00:07                3935
migration70.constants.php                          29-May-2024 00:07                9523
migration70.deprecated.php                         29-May-2024 00:07                5711
migration70.incompatible.php                       29-May-2024 00:07               62314
migration70.new-features.php                       29-May-2024 00:07               41154
migration70.new-functions.php                      29-May-2024 00:07                7393
migration70.other-changes.php                      29-May-2024 00:07                3458
migration70.php                                    29-May-2024 00:07                2809
migration70.removed-exts-sapis.php                 29-May-2024 00:07                3189
migration70.sapi-changes.php                       29-May-2024 00:07                2034
migration71.changed-functions.php                  29-May-2024 00:07                7628
migration71.constants.php                          29-May-2024 00:07                8806
migration71.deprecated.php                         29-May-2024 00:07                2306
migration71.incompatible.php                       29-May-2024 00:07               32309
migration71.new-features.php                       29-May-2024 00:07               27323
migration71.new-functions.php                      29-May-2024 00:07                5090
migration71.other-changes.php                      29-May-2024 00:07                8625
migration71.php                                    29-May-2024 00:07                2506
migration71.windows-support.php                    29-May-2024 00:07                7185
migration72.constants.php                          29-May-2024 00:07               31998
migration72.deprecated.php                         29-May-2024 00:07               10523
migration72.incompatible.php                       29-May-2024 00:07               19729
migration72.new-features.php                       29-May-2024 00:07               19006
migration72.new-functions.php                      29-May-2024 00:07               24434
migration72.other-changes.php                      29-May-2024 00:07                5900
migration72.php                                    29-May-2024 00:07                2405
migration73.constants.php                          29-May-2024 00:07               25892
migration73.deprecated.php                         29-May-2024 00:07                8769
migration73.incompatible.php                       29-May-2024 00:07               18136
migration73.new-features.php                       29-May-2024 00:07               16744
migration73.new-functions.php                      29-May-2024 00:07                7464
migration73.other-changes.php                      29-May-2024 00:07               16576
migration73.php                                    29-May-2024 00:07                2522
migration73.windows-support.php                    29-May-2024 00:07                1861
migration74.constants.php                          29-May-2024 00:07                7802
migration74.deprecated.php                         29-May-2024 00:07               15278
migration74.incompatible.php                       29-May-2024 00:07               18460
migration74.new-classes.php                        29-May-2024 00:07                1541
migration74.new-features.php                       29-May-2024 00:07               21994
migration74.new-functions.php                      29-May-2024 00:07                3757
migration74.other-changes.php                      29-May-2024 00:07               21284
migration74.php                                    29-May-2024 00:07                2737
migration74.removed-extensions.php                 29-May-2024 00:07                1949
migration74.windows-support.php                    29-May-2024 00:07                3814
migration80.deprecated.php                         29-May-2024 00:07               18810
migration80.incompatible.php                       29-May-2024 00:07               98700
migration80.new-features.php                       29-May-2024 00:07               32558
migration80.other-changes.php                      29-May-2024 00:07               15142
migration80.php                                    29-May-2024 00:07                2389
migration81.constants.php                          29-May-2024 00:07                8264
migration81.deprecated.php                         29-May-2024 00:07               19494
migration81.incompatible.php                       29-May-2024 00:07               23306
migration81.new-classes.php                        29-May-2024 00:07                2177
migration81.new-features.php                       29-May-2024 00:07               23966
migration81.new-functions.php                      29-May-2024 00:07                8517
migration81.other-changes.php                      29-May-2024 00:07                9872
migration81.php                                    29-May-2024 00:07                2609
migration82.constants.php                          29-May-2024 00:07               22084
migration82.deprecated.php                         29-May-2024 00:07                5911
migration82.incompatible.php                       29-May-2024 00:07                9681
migration82.new-features.php                       29-May-2024 00:07                7237
migration82.new-functions.php                      29-May-2024 00:07                4328
migration82.other-changes.php                      29-May-2024 00:07               25766
migration82.php                                    29-May-2024 00:07                2655
migration82.windows-support.php                    29-May-2024 00:07                2351
migration83.constants.php                          29-May-2024 00:07               13224
migration83.deprecated.php                         29-May-2024 00:07                7752
migration83.incompatible.php                       29-May-2024 00:07               14742
migration83.new-classes.php                        29-May-2024 00:07                3429
migration83.new-features.php                       29-May-2024 00:07                7289
migration83.new-functions.php                      29-May-2024 00:07                7347
migration83.other-changes.php                      29-May-2024 00:07               31823
migration83.php                                    29-May-2024 00:07                2796
migration83.windows-support.php                    29-May-2024 00:07                1427
misc.configuration.php                             29-May-2024 00:07                6151
misc.constants.php                                 29-May-2024 00:07                2658
misc.installation.php                              29-May-2024 00:07                1266
misc.requirements.php                              29-May-2024 00:07                1210
misc.resources.php                                 29-May-2024 00:07                1254
misc.setup.php                                     29-May-2024 00:07                1602
mongodb-bson-binary.construct.php                  29-May-2024 00:07                8003
mongodb-bson-binary.getdata.php                    29-May-2024 00:07                4481
mongodb-bson-binary.gettype.php                    29-May-2024 00:07                4463
mongodb-bson-binary.jsonserialize.php              29-May-2024 00:07                5469
mongodb-bson-binary.serialize.php                  29-May-2024 00:07                3559
mongodb-bson-binary.tostring.php                   29-May-2024 00:07                4275
mongodb-bson-binary.unserialize.php                29-May-2024 00:07                4377
mongodb-bson-binaryinterface.getdata.php           29-May-2024 00:07                2902
mongodb-bson-binaryinterface.gettype.php           29-May-2024 00:07                2912
mongodb-bson-binaryinterface.tostring.php          29-May-2024 00:07                3378
mongodb-bson-dbpointer.construct.php               29-May-2024 00:07                2726
mongodb-bson-dbpointer.jsonserialize.php           29-May-2024 00:07                5538
mongodb-bson-dbpointer.serialize.php               29-May-2024 00:07                3634
mongodb-bson-dbpointer.tostring.php                29-May-2024 00:07                2744
mongodb-bson-dbpointer.unserialize.php             29-May-2024 00:07                3876
mongodb-bson-decimal128.construct.php              29-May-2024 00:07                5846
mongodb-bson-decimal128.jsonserialize.php          29-May-2024 00:07                5559
mongodb-bson-decimal128.serialize.php              29-May-2024 00:07                3659
mongodb-bson-decimal128.tostring.php               29-May-2024 00:07                4615
mongodb-bson-decimal128.unserialize.php            29-May-2024 00:07                4469
mongodb-bson-decimal128interface.tostring.php      29-May-2024 00:07                3065
mongodb-bson-document.construct.php                29-May-2024 00:07                3340
mongodb-bson-document.frombson.php                 29-May-2024 00:07                4106
mongodb-bson-document.fromjson.php                 29-May-2024 00:07                4619
mongodb-bson-document.fromphp.php                  29-May-2024 00:07                4341
mongodb-bson-document.get.php                      29-May-2024 00:07                4317
mongodb-bson-document.getiterator.php              29-May-2024 00:07                3585
mongodb-bson-document.has.php                      29-May-2024 00:07                3844
mongodb-bson-document.offsetexists.php             29-May-2024 00:07                3576
mongodb-bson-document.offsetget.php                29-May-2024 00:07                4417
mongodb-bson-document.offsetset.php                29-May-2024 00:07                3634
mongodb-bson-document.offsetunset.php              29-May-2024 00:07                3243
mongodb-bson-document.serialize.php                29-May-2024 00:07                3639
mongodb-bson-document.tocanonicalextendedjson.php  29-May-2024 00:07               12787
mongodb-bson-document.tophp.php                    29-May-2024 00:07                5530
mongodb-bson-document.torelaxedextendedjson.php    29-May-2024 00:07               12504
mongodb-bson-document.tostring.php                 29-May-2024 00:07                2818
mongodb-bson-document.unserialize.php              29-May-2024 00:07                4425
mongodb-bson-int64.construct.php                   29-May-2024 00:07                4823
mongodb-bson-int64.jsonserialize.php               29-May-2024 00:07                5213
mongodb-bson-int64.serialize.php                   29-May-2024 00:07                3536
mongodb-bson-int64.tostring.php                    29-May-2024 00:07                3933
mongodb-bson-int64.unserialize.php                 29-May-2024 00:07                4348
mongodb-bson-iterator.construct.php                29-May-2024 00:07                3428
mongodb-bson-iterator.current.php                  29-May-2024 00:07                3696
mongodb-bson-iterator.key.php                      29-May-2024 00:07                3691
mongodb-bson-iterator.next.php                     29-May-2024 00:07                2463
mongodb-bson-iterator.rewind.php                   29-May-2024 00:07                2499
mongodb-bson-iterator.valid.php                    29-May-2024 00:07                2887
mongodb-bson-javascript.construct.php              29-May-2024 00:07                7314
mongodb-bson-javascript.getcode.php                29-May-2024 00:07                4453
mongodb-bson-javascript.getscope.php               29-May-2024 00:07                5429
mongodb-bson-javascript.jsonserialize.php          29-May-2024 00:07                5555
mongodb-bson-javascript.serialize.php              29-May-2024 00:07                3659
mongodb-bson-javascript.tostring.php               29-May-2024 00:07                4269
mongodb-bson-javascript.unserialize.php            29-May-2024 00:07                4461
mongodb-bson-javascriptinterface.getcode.php       29-May-2024 00:07                2996
mongodb-bson-javascriptinterface.getscope.php      29-May-2024 00:07                3161
mongodb-bson-javascriptinterface.tostring.php      29-May-2024 00:07                3476
mongodb-bson-maxkey.construct.php                  29-May-2024 00:07                3707
mongodb-bson-maxkey.jsonserialize.php              29-May-2024 00:07                5475
mongodb-bson-maxkey.serialize.php                  29-May-2024 00:07                3563
mongodb-bson-maxkey.unserialize.php                29-May-2024 00:07                3809
mongodb-bson-minkey.construct.php                  29-May-2024 00:07                3707
mongodb-bson-minkey.jsonserialize.php              29-May-2024 00:07                5475
mongodb-bson-minkey.serialize.php                  29-May-2024 00:07                3563
mongodb-bson-minkey.unserialize.php                29-May-2024 00:07                3813
mongodb-bson-objectid.construct.php                29-May-2024 00:07                5331
mongodb-bson-objectid.gettimestamp.php             29-May-2024 00:07                5563
mongodb-bson-objectid.jsonserialize.php            29-May-2024 00:07                5521
mongodb-bson-objectid.serialize.php                29-May-2024 00:07                3611
mongodb-bson-objectid.tostring.php                 29-May-2024 00:07                4261
mongodb-bson-objectid.unserialize.php              29-May-2024 00:07                4415
mongodb-bson-objectidinterface.gettimestamp.php    29-May-2024 00:07                3065
mongodb-bson-objectidinterface.tostring.php        29-May-2024 00:07                3049
mongodb-bson-packedarray.construct.php             29-May-2024 00:07                2960
mongodb-bson-packedarray.fromphp.php               29-May-2024 00:07                4022
mongodb-bson-packedarray.get.php                   29-May-2024 00:07                4365
mongodb-bson-packedarray.getiterator.php           29-May-2024 00:07                3639
mongodb-bson-packedarray.has.php                   29-May-2024 00:07                3898
mongodb-bson-packedarray.offsetexists.php          29-May-2024 00:07                3632
mongodb-bson-packedarray.offsetget.php             29-May-2024 00:07                4583
mongodb-bson-packedarray.offsetset.php             29-May-2024 00:07                3688
mongodb-bson-packedarray.offsetunset.php           29-May-2024 00:07                3297
mongodb-bson-packedarray.serialize.php             29-May-2024 00:07                3671
mongodb-bson-packedarray.tophp.php                 29-May-2024 00:07                4714
mongodb-bson-packedarray.tostring.php              29-May-2024 00:07                2834
mongodb-bson-packedarray.unserialize.php           29-May-2024 00:07                4481
mongodb-bson-persistable.bsonserialize.php         29-May-2024 00:07                6208
mongodb-bson-regex.construct.php                   29-May-2024 00:07                7080
mongodb-bson-regex.getflags.php                    29-May-2024 00:07                4573
mongodb-bson-regex.getpattern.php                  29-May-2024 00:07                4435
mongodb-bson-regex.jsonserialize.php               29-May-2024 00:07                5454
mongodb-bson-regex.serialize.php                   29-May-2024 00:07                3534
mongodb-bson-regex.tostring.php                    29-May-2024 00:07                3959
mongodb-bson-regex.unserialize.php                 29-May-2024 00:07                4352
mongodb-bson-regexinterface.getflags.php           29-May-2024 00:07                2901
mongodb-bson-regexinterface.getpattern.php         29-May-2024 00:07                2944
mongodb-bson-regexinterface.tostring.php           29-May-2024 00:07                2975
mongodb-bson-serializable.bsonserialize.php        29-May-2024 00:07               16659
mongodb-bson-symbol.construct.php                  29-May-2024 00:07                2666
mongodb-bson-symbol.jsonserialize.php              29-May-2024 00:07                5475
mongodb-bson-symbol.serialize.php                  29-May-2024 00:07                3559
mongodb-bson-symbol.tostring.php                   29-May-2024 00:07                2722
mongodb-bson-symbol.unserialize.php                29-May-2024 00:07                3815
mongodb-bson-timestamp.construct.php               29-May-2024 00:07                4880
mongodb-bson-timestamp.getincrement.php            29-May-2024 00:07                4372
mongodb-bson-timestamp.gettimestamp.php            29-May-2024 00:07                4357
mongodb-bson-timestamp.jsonserialize.php           29-May-2024 00:07                5542
mongodb-bson-timestamp.serialize.php               29-May-2024 00:07                3634
mongodb-bson-timestamp.tostring.php                29-May-2024 00:07                4103
mongodb-bson-timestamp.unserialize.php             29-May-2024 00:07                4448
mongodb-bson-timestampinterface.getincrement.php   29-May-2024 00:07                3428
mongodb-bson-timestampinterface.gettimestamp.php   29-May-2024 00:07                3443
mongodb-bson-timestampinterface.tostring.php       29-May-2024 00:07                3067
mongodb-bson-undefined.construct.php               29-May-2024 00:07                2726
mongodb-bson-undefined.jsonserialize.php           29-May-2024 00:07                5538
mongodb-bson-undefined.serialize.php               29-May-2024 00:07                3634
mongodb-bson-undefined.tostring.php                29-May-2024 00:07                2744
mongodb-bson-undefined.unserialize.php             29-May-2024 00:07                3877
mongodb-bson-unserializable.bsonunserialize.php    29-May-2024 00:07                7132
mongodb-bson-utcdatetime.construct.php             29-May-2024 00:07                8227
mongodb-bson-utcdatetime.jsonserialize.php         29-May-2024 00:07                5580
mongodb-bson-utcdatetime.serialize.php             29-May-2024 00:07                3686
mongodb-bson-utcdatetime.todatetime.php            29-May-2024 00:07                5904
mongodb-bson-utcdatetime.tostring.php              29-May-2024 00:07                4057
mongodb-bson-utcdatetime.unserialize.php           29-May-2024 00:07                4480
mongodb-bson-utcdatetimeinterface.todatetime.php   29-May-2024 00:07                3344
mongodb-bson-utcdatetimeinterface.tostring.php     29-May-2024 00:07                3083
mongodb-driver-bulkwrite.construct.php             29-May-2024 00:07               18717
mongodb-driver-bulkwrite.count.php                 29-May-2024 00:07                6999
mongodb-driver-bulkwrite.delete.php                29-May-2024 00:07               12100
mongodb-driver-bulkwrite.insert.php                29-May-2024 00:07                9675
mongodb-driver-bulkwrite.update.php                29-May-2024 00:07               15710
mongodb-driver-clientencryption.addkeyaltname.php  29-May-2024 00:07                5616
mongodb-driver-clientencryption.construct.php      29-May-2024 00:07               11501
mongodb-driver-clientencryption.createdatakey.php  29-May-2024 00:07               11046
mongodb-driver-clientencryption.decrypt.php        29-May-2024 00:07                4257
mongodb-driver-clientencryption.deletekey.php      29-May-2024 00:07                4353
mongodb-driver-clientencryption.encrypt.php        29-May-2024 00:07               12873
mongodb-driver-clientencryption.encryptexpressi..> 29-May-2024 00:07               14582
mongodb-driver-clientencryption.getkey.php         29-May-2024 00:07                4486
mongodb-driver-clientencryption.getkeybyaltname..> 29-May-2024 00:07                5086
mongodb-driver-clientencryption.getkeys.php        29-May-2024 00:07                3913
mongodb-driver-clientencryption.removekeyaltnam..> 29-May-2024 00:07                5681
mongodb-driver-clientencryption.rewrapmanydatak..> 29-May-2024 00:07               12224
mongodb-driver-command.construct.php               29-May-2024 00:07               14306
mongodb-driver-commandexception.getresultdocume..> 29-May-2024 00:07                3317
mongodb-driver-cursor.construct.php                29-May-2024 00:07                3400
mongodb-driver-cursor.current.php                  29-May-2024 00:07                3176
mongodb-driver-cursor.getid.php                    29-May-2024 00:07                7675
mongodb-driver-cursor.getserver.php                29-May-2024 00:07                7568
mongodb-driver-cursor.isdead.php                   29-May-2024 00:07               10690
mongodb-driver-cursor.key.php                      29-May-2024 00:07                2734
mongodb-driver-cursor.next.php                     29-May-2024 00:07                3573
mongodb-driver-cursor.rewind.php                   29-May-2024 00:07                4025
mongodb-driver-cursor.settypemap.php               29-May-2024 00:07                8030
mongodb-driver-cursor.toarray.php                  29-May-2024 00:07                7761
mongodb-driver-cursor.valid.php                    29-May-2024 00:07                2912
mongodb-driver-cursorid.construct.php              29-May-2024 00:07                2888
mongodb-driver-cursorid.serialize.php              29-May-2024 00:07                3657
mongodb-driver-cursorid.tostring.php               29-May-2024 00:07                7057
mongodb-driver-cursorid.unserialize.php            29-May-2024 00:07                4487
mongodb-driver-cursorinterface.getid.php           29-May-2024 00:07                4079
mongodb-driver-cursorinterface.getserver.php       29-May-2024 00:07                4180
mongodb-driver-cursorinterface.isdead.php          29-May-2024 00:07                4143
mongodb-driver-cursorinterface.settypemap.php      29-May-2024 00:07                4168
mongodb-driver-cursorinterface.toarray.php         29-May-2024 00:07                4042
mongodb-driver-manager.addsubscriber.php           29-May-2024 00:07                5600
mongodb-driver-manager.construct.php               29-May-2024 00:07               80354
mongodb-driver-manager.createclientencryption.php  29-May-2024 00:07               12834
mongodb-driver-manager.executebulkwrite.php        29-May-2024 00:07               23276
mongodb-driver-manager.executecommand.php          29-May-2024 00:07               25056
mongodb-driver-manager.executequery.php            29-May-2024 00:07               16585
mongodb-driver-manager.executereadcommand.php      29-May-2024 00:07               10232
mongodb-driver-manager.executereadwritecommand.php 29-May-2024 00:07               11319
mongodb-driver-manager.executewritecommand.php     29-May-2024 00:07               11411
mongodb-driver-manager.getencryptedfieldsmap.php   29-May-2024 00:07                3977
mongodb-driver-manager.getreadconcern.php          29-May-2024 00:07                5972
mongodb-driver-manager.getreadpreference.php       29-May-2024 00:07                6567
mongodb-driver-manager.getservers.php              29-May-2024 00:07                8013
mongodb-driver-manager.getwriteconcern.php         29-May-2024 00:07                6025
mongodb-driver-manager.removesubscriber.php        29-May-2024 00:07                4992
mongodb-driver-manager.selectserver.php            29-May-2024 00:07                7269
mongodb-driver-manager.startsession.php            29-May-2024 00:07               12662
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                3777
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                3704
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                3876
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                3705
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                4908
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                4096
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                4332
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                4258
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                4094
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 00:07                3878
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 00:07                4103
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 00:07                3813
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 00:07                3715
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 00:07                5217
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 00:07                4793
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 00:07                4549
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 00:07                4114
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 00:07                3898
mongodb-driver-monitoring-commandsubscriber.com..> 29-May-2024 00:07                4969
mongodb-driver-monitoring-commandsubscriber.com..> 29-May-2024 00:07                5019
mongodb-driver-monitoring-commandsubscriber.com..> 29-May-2024 00:07                5032
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 00:07                3834
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 00:07                3761
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 00:07                3945
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 00:07                4995
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 00:07                4153
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 00:07                4395
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 00:07                4763
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 00:07                4154
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 00:07                3924
mongodb-driver-monitoring-logsubscriber.log.php    29-May-2024 00:07                4699
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 00:07                4852
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 00:07                4822
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 00:07                5389
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 00:07                5434
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 00:07                5465
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 00:07                4852
mongodb-driver-monitoring-sdamsubscriber.topolo..> 29-May-2024 00:07                4927
mongodb-driver-monitoring-sdamsubscriber.topolo..> 29-May-2024 00:07                4864
mongodb-driver-monitoring-sdamsubscriber.topolo..> 29-May-2024 00:07                4847
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 00:07                3243
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 00:07                3559
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 00:07                3311
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 00:07                3636
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 00:07                3359
mongodb-driver-monitoring-serverclosedevent.get..> 29-May-2024 00:07                3205
mongodb-driver-monitoring-serverclosedevent.get..> 29-May-2024 00:07                3255
mongodb-driver-monitoring-serverclosedevent.get..> 29-May-2024 00:07                3315
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 00:07                3691
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 00:07                3543
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 00:07                3380
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 00:07                3409
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 00:07                3765
mongodb-driver-monitoring-serverheartbeatstarte..> 29-May-2024 00:07                3385
mongodb-driver-monitoring-serverheartbeatstarte..> 29-May-2024 00:07                3427
mongodb-driver-monitoring-serverheartbeatstarte..> 29-May-2024 00:07                3785
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 00:07                3743
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 00:07                3452
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 00:07                3461
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 00:07                4290
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 00:07                3801
mongodb-driver-monitoring-serveropeningevent.ge..> 29-May-2024 00:07                3223
mongodb-driver-monitoring-serveropeningevent.ge..> 29-May-2024 00:07                3273
mongodb-driver-monitoring-serveropeningevent.ge..> 29-May-2024 00:07                3347
mongodb-driver-monitoring-topologychangedevent...> 29-May-2024 00:07                3628
mongodb-driver-monitoring-topologychangedevent...> 29-May-2024 00:07                3706
mongodb-driver-monitoring-topologychangedevent...> 29-May-2024 00:07                3367
mongodb-driver-monitoring-topologyclosedevent.g..> 29-May-2024 00:07                3312
mongodb-driver-monitoring-topologyopeningevent...> 29-May-2024 00:07                3322
mongodb-driver-query.construct.php                 29-May-2024 00:07               32905
mongodb-driver-readconcern.bsonserialize.php       29-May-2024 00:07                6851
mongodb-driver-readconcern.construct.php           29-May-2024 00:07                5777
mongodb-driver-readconcern.getlevel.php            29-May-2024 00:07                5858
mongodb-driver-readconcern.isdefault.php           29-May-2024 00:07                8132
mongodb-driver-readconcern.serialize.php           29-May-2024 00:07                3734
mongodb-driver-readconcern.unserialize.php         29-May-2024 00:07                4538
mongodb-driver-readpreference.bsonserialize.php    29-May-2024 00:07               10491
mongodb-driver-readpreference.construct.php        29-May-2024 00:07               18500
mongodb-driver-readpreference.gethedge.php         29-May-2024 00:07                3489
mongodb-driver-readpreference.getmaxstalenessse..> 29-May-2024 00:07                8230
mongodb-driver-readpreference.getmode.php          29-May-2024 00:07                7554
mongodb-driver-readpreference.getmodestring.php    29-May-2024 00:07                7760
mongodb-driver-readpreference.gettagsets.php       29-May-2024 00:07                8115
mongodb-driver-readpreference.serialize.php        29-May-2024 00:07                3811
mongodb-driver-readpreference.unserialize.php      29-May-2024 00:07                4617
mongodb-driver-runtimeexception.haserrorlabel.php  29-May-2024 00:07                4332
mongodb-driver-server.construct.php                29-May-2024 00:07                3432
mongodb-driver-server.executebulkwrite.php         29-May-2024 00:07               11565
mongodb-driver-server.executecommand.php           29-May-2024 00:07               13402
mongodb-driver-server.executequery.php             29-May-2024 00:07                9001
mongodb-driver-server.executereadcommand.php       29-May-2024 00:07               10831
mongodb-driver-server.executereadwritecommand.php  29-May-2024 00:07               11836
mongodb-driver-server.executewritecommand.php      29-May-2024 00:07               11894
mongodb-driver-server.gethost.php                  29-May-2024 00:07                5521
mongodb-driver-server.getinfo.php                  29-May-2024 00:07               10684
mongodb-driver-server.getlatency.php               29-May-2024 00:07                7194
mongodb-driver-server.getport.php                  29-May-2024 00:07                5563
mongodb-driver-server.getserverdescription.php     29-May-2024 00:07                3483
mongodb-driver-server.gettags.php                  29-May-2024 00:07                3850
mongodb-driver-server.gettype.php                  29-May-2024 00:07                3886
mongodb-driver-server.isarbiter.php                29-May-2024 00:07                3703
mongodb-driver-server.ishidden.php                 29-May-2024 00:07                3697
mongodb-driver-server.ispassive.php                29-May-2024 00:07                3765
mongodb-driver-server.isprimary.php                29-May-2024 00:07                3710
mongodb-driver-server.issecondary.php              29-May-2024 00:07                3745
mongodb-driver-serverapi.bsonserialize.php         29-May-2024 00:07                3372
mongodb-driver-serverapi.construct.php             29-May-2024 00:07                5262
mongodb-driver-serverapi.serialize.php             29-May-2024 00:07                3687
mongodb-driver-serverapi.unserialize.php           29-May-2024 00:07                4505
mongodb-driver-serverdescription.gethellorespon..> 29-May-2024 00:07                5266
mongodb-driver-serverdescription.gethost.php       29-May-2024 00:07                3512
mongodb-driver-serverdescription.getlastupdatet..> 29-May-2024 00:07                3663
mongodb-driver-serverdescription.getport.php       29-May-2024 00:07                3567
mongodb-driver-serverdescription.getroundtripti..> 29-May-2024 00:07                3966
mongodb-driver-serverdescription.gettype.php       29-May-2024 00:07                3902
mongodb-driver-session.aborttransaction.php        29-May-2024 00:07                4266
mongodb-driver-session.advanceclustertime.php      29-May-2024 00:07                4936
mongodb-driver-session.advanceoperationtime.php    29-May-2024 00:07                4876
mongodb-driver-session.committransaction.php       29-May-2024 00:07                5622
mongodb-driver-session.construct.php               29-May-2024 00:07                2955
mongodb-driver-session.endsession.php              29-May-2024 00:07                4403
mongodb-driver-session.getclustertime.php          29-May-2024 00:07                4040
mongodb-driver-session.getlogicalsessionid.php     29-May-2024 00:07                3193
mongodb-driver-session.getoperationtime.php        29-May-2024 00:07                4120
mongodb-driver-session.getserver.php               29-May-2024 00:07                4008
mongodb-driver-session.gettransactionoptions.php   29-May-2024 00:07                3895
mongodb-driver-session.gettransactionstate.php     29-May-2024 00:07                3799
mongodb-driver-session.isdirty.php                 29-May-2024 00:07                3078
mongodb-driver-session.isintransaction.php         29-May-2024 00:07                3861
mongodb-driver-session.starttransaction.php        29-May-2024 00:07                9138
mongodb-driver-topologydescription.getservers.php  29-May-2024 00:07                3520
mongodb-driver-topologydescription.gettype.php     29-May-2024 00:07                3568
mongodb-driver-topologydescription.hasreadables..> 29-May-2024 00:07                4007
mongodb-driver-topologydescription.haswritables..> 29-May-2024 00:07                3288
mongodb-driver-writeconcern.bsonserialize.php      29-May-2024 00:07                7296
mongodb-driver-writeconcern.construct.php          29-May-2024 00:07               10580
mongodb-driver-writeconcern.getjournal.php         29-May-2024 00:07                6044
mongodb-driver-writeconcern.getw.php               29-May-2024 00:07                5334
mongodb-driver-writeconcern.getwtimeout.php        29-May-2024 00:07                5962
mongodb-driver-writeconcern.isdefault.php          29-May-2024 00:07                7919
mongodb-driver-writeconcern.serialize.php          29-May-2024 00:07                3759
mongodb-driver-writeconcern.unserialize.php        29-May-2024 00:07                4577
mongodb-driver-writeconcernerror.getcode.php       29-May-2024 00:07                6382
mongodb-driver-writeconcernerror.getinfo.php       29-May-2024 00:07                6708
mongodb-driver-writeconcernerror.getmessage.php    29-May-2024 00:07                6473
mongodb-driver-writeerror.getcode.php              29-May-2024 00:07                5720
mongodb-driver-writeerror.getindex.php             29-May-2024 00:07                6253
mongodb-driver-writeerror.getinfo.php              29-May-2024 00:07                3190
mongodb-driver-writeerror.getmessage.php           29-May-2024 00:07                5856
mongodb-driver-writeexception.getwriteresult.php   29-May-2024 00:07                7982
mongodb-driver-writeresult.getdeletedcount.php     29-May-2024 00:07                8213
mongodb-driver-writeresult.getinsertedcount.php    29-May-2024 00:07                8295
mongodb-driver-writeresult.getmatchedcount.php     29-May-2024 00:07                8858
mongodb-driver-writeresult.getmodifiedcount.php    29-May-2024 00:07                9156
mongodb-driver-writeresult.getserver.php           29-May-2024 00:07                6588
mongodb-driver-writeresult.getupsertedcount.php    29-May-2024 00:07                8384
mongodb-driver-writeresult.getupsertedids.php      29-May-2024 00:07                8870
mongodb-driver-writeresult.getwriteconcernerror..> 29-May-2024 00:07                7260
mongodb-driver-writeresult.getwriteerrors.php      29-May-2024 00:07               13079
mongodb-driver-writeresult.isacknowledged.php      29-May-2024 00:07                8235
mongodb.architecture.php                           29-May-2024 00:07                1982
mongodb.configuration.php                          29-May-2024 00:07                4076
mongodb.connection-handling.php                    29-May-2024 00:07                8746
mongodb.constants.php                              29-May-2024 00:07                2189
mongodb.exceptions.php                             29-May-2024 00:07                5209
mongodb.exceptions.tree.php                        29-May-2024 00:07                5633
mongodb.installation.homebrew.php                  29-May-2024 00:07                2030
mongodb.installation.manual.php                    29-May-2024 00:07                6180
mongodb.installation.pecl.php                      29-May-2024 00:07                4955
mongodb.installation.php                           29-May-2024 00:07                1829
mongodb.installation.windows.php                   29-May-2024 00:07                4436
mongodb.monitoring.php                             29-May-2024 00:07               19450
mongodb.overview.php                               29-May-2024 00:07                4673
mongodb.persistence.deserialization.php            29-May-2024 00:07               21843