Index of /pub/php/manual/ja/


../
feeds/                                             24-May-2024 16:05                   -
images/                                            24-May-2024 16:05                   -
styles/                                            24-May-2024 16:04                   -
toc/                                               24-May-2024 16:05                   -
about.formats.php                                  24-May-2024 16:05                5252
about.generate.php                                 24-May-2024 16:05                3140
about.howtohelp.php                                24-May-2024 16:05                4006
about.more.php                                     24-May-2024 16:05                2252
about.notes.php                                    24-May-2024 16:05                2718
about.php                                          24-May-2024 16:05                2013
about.phpversions.php                              24-May-2024 16:05                4162
about.prototypes.php                               24-May-2024 16:05                7964
about.translations.php                             24-May-2024 16:05                3615
aliases.php                                        24-May-2024 16:05               29720
allowdynamicproperties.construct.php               24-May-2024 16:04                2318
apache.configuration.php                           24-May-2024 16:05                5703
apache.constants.php                               24-May-2024 16:05                1183
apache.installation.php                            24-May-2024 16:05                1339
apache.requirements.php                            24-May-2024 16:05                1217
apache.resources.php                               24-May-2024 16:05                1218
apache.setup.php                                   24-May-2024 16:05                1619
apcu.configuration.php                             24-May-2024 16:04               18609
apcu.constants.php                                 24-May-2024 16:04                7470
apcu.installation.php                              24-May-2024 16:04                3668
apcu.requirements.php                              24-May-2024 16:04                1203
apcu.resources.php                                 24-May-2024 16:04                1204
apcu.setup.php                                     24-May-2024 16:04                1577
apcuiterator.construct.php                         24-May-2024 16:04                6997
apcuiterator.current.php                           24-May-2024 16:04                3113
apcuiterator.gettotalcount.php                     24-May-2024 16:04                3335
apcuiterator.gettotalhits.php                      24-May-2024 16:04                3505
apcuiterator.gettotalsize.php                      24-May-2024 16:04                3378
apcuiterator.key.php                               24-May-2024 16:04                2896
apcuiterator.next.php                              24-May-2024 16:04                3161
apcuiterator.rewind.php                            24-May-2024 16:04                2765
apcuiterator.valid.php                             24-May-2024 16:04                3041
appendices.php                                     24-May-2024 16:05               13187
appenditerator.append.php                          24-May-2024 16:05                5472
appenditerator.construct.php                       24-May-2024 16:05               10288
appenditerator.current.php                         24-May-2024 16:05                3559
appenditerator.getarrayiterator.php                24-May-2024 16:05                3153
appenditerator.getiteratorindex.php                24-May-2024 16:05                6774
appenditerator.key.php                             24-May-2024 16:05                7265
appenditerator.next.php                            24-May-2024 16:05                3438
appenditerator.rewind.php                          24-May-2024 16:05                3430
appenditerator.valid.php                           24-May-2024 16:05                3458
array.configuration.php                            24-May-2024 16:05                1236
array.constants.php                                24-May-2024 16:05               12326
array.installation.php                             24-May-2024 16:05                1270
array.requirements.php                             24-May-2024 16:05                1210
array.resources.php                                24-May-2024 16:05                1211
array.setup.php                                    24-May-2024 16:05                1584
array.sorting.php                                  24-May-2024 16:05                7101
arrayaccess.offsetexists.php                       24-May-2024 16:04                9292
arrayaccess.offsetget.php                          24-May-2024 16:04                5155
arrayaccess.offsetset.php                          24-May-2024 16:04                5378
arrayaccess.offsetunset.php                        24-May-2024 16:04                2931
arrayiterator.append.php                           24-May-2024 16:05                3555
arrayiterator.asort.php                            24-May-2024 16:05                7617
arrayiterator.construct.php                        24-May-2024 16:05                3839
arrayiterator.count.php                            24-May-2024 16:05                3019
arrayiterator.current.php                          24-May-2024 16:05                5099
arrayiterator.getarraycopy.php                     24-May-2024 16:05                3110
arrayiterator.getflags.php                         24-May-2024 16:05                3201
arrayiterator.key.php                              24-May-2024 16:05                3981
arrayiterator.ksort.php                            24-May-2024 16:05                7574
arrayiterator.natcasesort.php                      24-May-2024 16:05                5057
arrayiterator.natsort.php                          24-May-2024 16:05                4933
arrayiterator.next.php                             24-May-2024 16:05                4705
arrayiterator.offsetexists.php                     24-May-2024 16:05                3528
arrayiterator.offsetget.php                        24-May-2024 16:05                3476
arrayiterator.offsetset.php                        24-May-2024 16:05                3751
arrayiterator.offsetunset.php                      24-May-2024 16:05                3963
arrayiterator.rewind.php                           24-May-2024 16:05                4627
arrayiterator.seek.php                             24-May-2024 16:05                2666
arrayiterator.serialize.php                        24-May-2024 16:05                3024
arrayiterator.setflags.php                         24-May-2024 16:05                4291
arrayiterator.uasort.php                           24-May-2024 16:05                6746
arrayiterator.uksort.php                           24-May-2024 16:05                6652
arrayiterator.unserialize.php                      24-May-2024 16:05                3231
arrayiterator.valid.php                            24-May-2024 16:05                4726
arrayobject.append.php                             24-May-2024 16:05                5556
arrayobject.asort.php                              24-May-2024 16:05               10205
arrayobject.construct.php                          24-May-2024 16:05                6209
arrayobject.count.php                              24-May-2024 16:05                5471
arrayobject.exchangearray.php                      24-May-2024 16:05                6043
arrayobject.getarraycopy.php                       24-May-2024 16:05                5375
arrayobject.getflags.php                           24-May-2024 16:05                6261
arrayobject.getiterator.php                        24-May-2024 16:05                5372
arrayobject.getiteratorclass.php                   24-May-2024 16:05                6711
arrayobject.ksort.php                              24-May-2024 16:05               10162
arrayobject.natcasesort.php                        24-May-2024 16:05                8581
arrayobject.natsort.php                            24-May-2024 16:05                8287
arrayobject.offsetexists.php                       24-May-2024 16:05                5058
arrayobject.offsetget.php                          24-May-2024 16:05                5217
arrayobject.offsetset.php                          24-May-2024 16:05                6809
arrayobject.offsetunset.php                        24-May-2024 16:05                4309
arrayobject.serialize.php                          24-May-2024 16:05                5231
arrayobject.setflags.php                           24-May-2024 16:05                6857
arrayobject.setiteratorclass.php                   24-May-2024 16:05                5922
arrayobject.uasort.php                             24-May-2024 16:05               11289
arrayobject.uksort.php                             24-May-2024 16:05               10711
arrayobject.unserialize.php                        24-May-2024 16:05                3686
attribute.construct.php                            24-May-2024 16:04                2404
backedenum.from.php                                24-May-2024 16:04                6170
backedenum.tryfrom.php                             24-May-2024 16:04                6782
bc.configuration.php                               24-May-2024 16:04                2547
bc.constants.php                                   24-May-2024 16:04                1157
bc.installation.php                                24-May-2024 16:04                1628
bc.requirements.php                                24-May-2024 16:04                1189
bc.resources.php                                   24-May-2024 16:04                1190
bc.setup.php                                       24-May-2024 16:04                1579
book.apache.php                                    24-May-2024 16:05                3424
book.apcu.php                                      24-May-2024 16:04                4796
book.array.php                                     24-May-2024 16:05               12430
book.bc.php                                        24-May-2024 16:04                2910
book.bson.php                                      24-May-2024 16:04               24562
book.bzip2.php                                     24-May-2024 16:04                3006
book.calendar.php                                  24-May-2024 16:04                4197
book.classobj.php                                  24-May-2024 16:05                4833
book.cmark.php                                     24-May-2024 16:05                8792
book.com.php                                       24-May-2024 16:05                8484
book.componere.php                                 24-May-2024 16:04                6182
book.ctype.php                                     24-May-2024 16:05                3116
book.cubrid.php                                    24-May-2024 16:04               13837
book.curl.php                                      24-May-2024 16:05                7475
book.datetime.php                                  24-May-2024 16:04               18365
book.dba.php                                       24-May-2024 16:04                3705
book.dbase.php                                     24-May-2024 16:04                3219
book.dio.php                                       24-May-2024 16:04                3151
book.dir.php                                       24-May-2024 16:04                3387
book.dom.php                                       24-May-2024 16:05               22916
book.ds.php                                        24-May-2024 16:05               25149
book.eio.php                                       24-May-2024 16:04                8953
book.enchant.php                                   24-May-2024 16:04                5642
book.errorfunc.php                                 24-May-2024 16:04                3615
book.ev.php                                        24-May-2024 16:04               13916
book.event.php                                     24-May-2024 16:05               23177
book.exec.php                                      24-May-2024 16:04                3410
book.exif.php                                      24-May-2024 16:04                2545
book.expect.php                                    24-May-2024 16:04                2563
book.fann.php                                      24-May-2024 16:04               23102
book.fdf.php                                       24-May-2024 16:04                6273
book.ffi.php                                       24-May-2024 16:04                5640
book.fileinfo.php                                  24-May-2024 16:04                3156
book.filesystem.php                                24-May-2024 16:04               11212
book.filter.php                                    24-May-2024 16:05                3625
book.fpm.php                                       24-May-2024 16:05                2081
book.ftp.php                                       24-May-2024 16:05                6606
book.funchand.php                                  24-May-2024 16:05                3744
book.gearman.php                                   24-May-2024 16:05               14810
book.gender.php                                    24-May-2024 16:04                2644
book.geoip.php                                     24-May-2024 16:04                4608
book.gettext.php                                   24-May-2024 16:04                3021
book.gmagick.php                                   24-May-2024 16:04               24453
book.gmp.php                                       24-May-2024 16:04                6961
book.gnupg.php                                     24-May-2024 16:04                5271
book.hash.php                                      24-May-2024 16:04                4575
book.hrtime.php                                    24-May-2024 16:04                3528
book.ibase.php                                     24-May-2024 16:04               13241
book.ibm-db2.php                                   24-May-2024 16:04                9341
book.iconv.php                                     24-May-2024 16:04                3393
book.igbinary.php                                  24-May-2024 16:04                2196
book.image.php                                     24-May-2024 16:04               17228
book.imagick.php                                   24-May-2024 16:04               68691
book.imap.php                                      24-May-2024 16:04               11757
book.info.php                                      24-May-2024 16:04                8826
book.inotify.php                                   24-May-2024 16:04                2615
book.intl.php                                      24-May-2024 16:04               50840
book.json.php                                      24-May-2024 16:04                2978
book.ldap.php                                      24-May-2024 16:05                9933
book.libxml.php                                    24-May-2024 16:05                3429
book.lua.php                                       24-May-2024 16:04                2713
book.luasandbox.php                                24-May-2024 16:05                5576
book.lzf.php                                       24-May-2024 16:04                2213
book.mail.php                                      24-May-2024 16:04                2112
book.mailparse.php                                 24-May-2024 16:04                4260
book.math.php                                      24-May-2024 16:04                5844
book.mbstring.php                                  24-May-2024 16:04               11115
book.mcrypt.php                                    24-May-2024 16:04                6897
book.memcache.php                                  24-May-2024 16:05                4531
book.memcached.php                                 24-May-2024 16:05                9024
book.mhash.php                                     24-May-2024 16:04                2521
book.misc.php                                      24-May-2024 16:05                5787
book.mongodb.php                                   24-May-2024 16:04               26860
book.mqseries.php                                  24-May-2024 16:05                3197
book.mysql-xdevapi.php                             24-May-2024 16:04               32830
book.mysql.php                                     24-May-2024 16:04                8411
book.mysqli.php                                    24-May-2024 16:04               19950
book.mysqlnd.php                                   24-May-2024 16:04                2510
book.network.php                                   24-May-2024 16:05                6522
book.oauth.php                                     24-May-2024 16:05                7830
book.oci8.php                                      24-May-2024 16:04               18595
book.opcache.php                                   24-May-2024 16:04                2858
book.openal.php                                    24-May-2024 16:04                4807
book.openssl.php                                   24-May-2024 16:04               11866
book.outcontrol.php                                24-May-2024 16:04                5651
book.parallel.php                                  24-May-2024 16:04                5722
book.parle.php                                     24-May-2024 16:05                8804
book.password.php                                  24-May-2024 16:04                2705
book.pcntl.php                                     24-May-2024 16:04                5453
book.pcre.php                                      24-May-2024 16:05                3873
book.pdo.php                                       24-May-2024 16:04                8514
book.pgsql.php                                     24-May-2024 16:04               13799
book.phar.php                                      24-May-2024 16:04               18038
book.phpdbg.php                                    24-May-2024 16:04                3050
book.posix.php                                     24-May-2024 16:04                7252
book.ps.php                                        24-May-2024 16:04               10165
book.pspell.php                                    24-May-2024 16:04                4701
book.pthreads.php                                  24-May-2024 16:04                5442
book.quickhash.php                                 24-May-2024 16:05                8889
book.radius.php                                    24-May-2024 16:04                5714
book.random.php                                    24-May-2024 16:05                9738
book.rar.php                                       24-May-2024 16:04                5846
book.readline.php                                  24-May-2024 16:04                3817
book.recode.php                                    24-May-2024 16:04                2359
book.reflection.php                                24-May-2024 16:05               41191
book.rnp.php                                       24-May-2024 16:04                6023
book.rpminfo.php                                   24-May-2024 16:04                2490
book.rrd.php                                       24-May-2024 16:05                5102
book.runkit7.php                                   24-May-2024 16:04                4220
book.scoutapm.php                                  24-May-2024 16:05                2216
book.seaslog.php                                   24-May-2024 16:05                5190
book.sem.php                                       24-May-2024 16:04                4431
book.session.php                                   24-May-2024 16:05                8744
book.shmop.php                                     24-May-2024 16:04                2922
book.simdjson.php                                  24-May-2024 16:04                2671
book.simplexml.php                                 24-May-2024 16:05                5688
book.snmp.php                                      24-May-2024 16:05                6458
book.soap.php                                      24-May-2024 16:05                6498
book.sockets.php                                   24-May-2024 16:05                7843
book.sodium.php                                    24-May-2024 16:04               19088
book.solr.php                                      24-May-2024 16:05               53992
book.spl.php                                       24-May-2024 16:05               10396
book.sqlite3.php                                   24-May-2024 16:04                7568
book.sqlsrv.php                                    24-May-2024 16:04                5336
book.ssdeep.php                                    24-May-2024 16:05                2318
book.ssh2.php                                      24-May-2024 16:05                6078
book.stats.php                                     24-May-2024 16:04               11789
book.stomp.php                                     24-May-2024 16:05                4143
book.stream.php                                    24-May-2024 16:05               13740
book.strings.php                                   24-May-2024 16:05               14333
book.svm.php                                       24-May-2024 16:05                3776
book.svn.php                                       24-May-2024 16:05                8435
book.swoole.php                                    24-May-2024 16:05               37318
book.sync.php                                      24-May-2024 16:04                4757
book.taint.php                                     24-May-2024 16:05                2557
book.tcpwrap.php                                   24-May-2024 16:05                2073
book.tidy.php                                      24-May-2024 16:05                7343
book.tokenizer.php                                 24-May-2024 16:05                3203
book.trader.php                                    24-May-2024 16:04               17489
book.ui.php                                        24-May-2024 16:05               27956
book.uodbc.php                                     24-May-2024 16:04                7661
book.uopz.php                                      24-May-2024 16:04                5230
book.url.php                                       24-May-2024 16:05                3201
book.v8js.php                                      24-May-2024 16:05                3142
book.var.php                                       24-May-2024 16:05                5891
book.var_representation.php                        24-May-2024 16:05                2150
book.varnish.php                                   24-May-2024 16:05                5824
book.wddx.php                                      24-May-2024 16:05                2886
book.win32service.php                              24-May-2024 16:05                4172
book.wincache.php                                  24-May-2024 16:04                6233
book.wkhtmltox.php                                 24-May-2024 16:04                3313
book.xattr.php                                     24-May-2024 16:04                2474
book.xdiff.php                                     24-May-2024 16:04                4491
book.xhprof.php                                    24-May-2024 16:04                2544
book.xlswriter.php                                 24-May-2024 16:04                4426
book.xml.php                                       24-May-2024 16:05                5750
book.xmldiff.php                                   24-May-2024 16:05                3123
book.xmlreader.php                                 24-May-2024 16:05                5262
book.xmlrpc.php                                    24-May-2024 16:05                3985
book.xmlwriter.php                                 24-May-2024 16:05                7182
book.xsl.php                                       24-May-2024 16:05                3955
book.yac.php                                       24-May-2024 16:04                2583
book.yaconf.php                                    24-May-2024 16:05                2147
book.yaf.php                                       24-May-2024 16:05               37043
book.yaml.php                                      24-May-2024 16:05                2875
book.yar.php                                       24-May-2024 16:05                3680
book.yaz.php                                       24-May-2024 16:05                4590
book.zip.php                                       24-May-2024 16:04               11641
book.zlib.php                                      24-May-2024 16:04                5686
book.zmq.php                                       24-May-2024 16:05                5520
book.zookeeper.php                                 24-May-2024 16:05                6653
bzip2.configuration.php                            24-May-2024 16:04                1236
bzip2.constants.php                                24-May-2024 16:04                1170
bzip2.examples.php                                 24-May-2024 16:04                4179
bzip2.installation.php                             24-May-2024 16:04                1488
bzip2.requirements.php                             24-May-2024 16:04                1479
bzip2.resources.php                                24-May-2024 16:04                1316
bzip2.setup.php                                    24-May-2024 16:04                1605
cachingiterator.construct.php                      24-May-2024 16:05                2922
cachingiterator.count.php                          24-May-2024 16:05                2580
cachingiterator.current.php                        24-May-2024 16:05                2874
cachingiterator.getcache.php                       24-May-2024 16:05                5877
cachingiterator.getflags.php                       24-May-2024 16:05                2627
cachingiterator.hasnext.php                        24-May-2024 16:05                2739
cachingiterator.key.php                            24-May-2024 16:05                2286
cachingiterator.next.php                           24-May-2024 16:05                2523
cachingiterator.offsetexists.php                   24-May-2024 16:05                3072
cachingiterator.offsetget.php                      24-May-2024 16:05                2762
cachingiterator.offsetset.php                      24-May-2024 16:05                3137
cachingiterator.offsetunset.php                    24-May-2024 16:05                2821
cachingiterator.rewind.php                         24-May-2024 16:05                2536
cachingiterator.setflags.php                       24-May-2024 16:05                2878
cachingiterator.tostring.php                       24-May-2024 16:05                2606
cachingiterator.valid.php                          24-May-2024 16:05                2795
calendar.configuration.php                         24-May-2024 16:04                1257
calendar.constants.php                             24-May-2024 16:04               13193
calendar.installation.php                          24-May-2024 16:04                1656
calendar.requirements.php                          24-May-2024 16:04                1231
calendar.resources.php                             24-May-2024 16:04                1232
calendar.setup.php                                 24-May-2024 16:04                1650
callbackfilteriterator.accept.php                  24-May-2024 16:05                3772
callbackfilteriterator.construct.php               24-May-2024 16:05                4149
cc.license.php                                     24-May-2024 16:05               20746
changelog.misc.php                                 24-May-2024 16:05                1351
changelog.mysql.php                                24-May-2024 16:04                2655
changelog.mysql_xdevapi.php                        24-May-2024 16:04                2427
changelog.mysqli.php                               24-May-2024 16:04                1389
changelog.strings.php                              24-May-2024 16:05                1398
class.addressinfo.php                              24-May-2024 16:05                1800
class.allowdynamicproperties.php                   24-May-2024 16:04                5222
class.apcuiterator.php                             24-May-2024 16:04                7728
class.appenditerator.php                           24-May-2024 16:05                8013
class.argumentcounterror.php                       24-May-2024 16:04                8703
class.arithmeticerror.php                          24-May-2024 16:04                8869
class.arrayaccess.php                              24-May-2024 16:04               11900
class.arrayiterator.php                            24-May-2024 16:05               17421
class.arrayobject.php                              24-May-2024 16:05               17294
class.assertionerror.php                           24-May-2024 16:04                8556
class.attribute.php                                24-May-2024 16:04                8884
class.backedenum.php                               24-May-2024 16:04                4584
class.badfunctioncallexception.php                 24-May-2024 16:05                8640
class.badmethodcallexception.php                   24-May-2024 16:05                8670
class.cachingiterator.php                          24-May-2024 16:05               17596
class.callbackfilteriterator.php                   24-May-2024 16:05               11835
class.closedgeneratorexception.php                 24-May-2024 16:04                8789
class.closure.php                                  24-May-2024 16:04                7282
class.collator.php                                 24-May-2024 16:04               38113
class.collectable.php                              24-May-2024 16:04                2574
class.com-exception.php                            24-May-2024 16:05                8436
class.com-safearray-proxy.php                      24-May-2024 16:05                1951
class.com.php                                      24-May-2024 16:05               12914
class.commonmark-cql.php                           24-May-2024 16:05                7356
class.commonmark-interfaces-ivisitable.php         24-May-2024 16:05                2999
class.commonmark-interfaces-ivisitor.php           24-May-2024 16:05                4594
class.commonmark-node-blockquote.php               24-May-2024 16:05                8473
class.commonmark-node-bulletlist.php               24-May-2024 16:05               10642
class.commonmark-node-code.php                     24-May-2024 16:05                9467
class.commonmark-node-codeblock.php                24-May-2024 16:05               10846
class.commonmark-node-customblock.php              24-May-2024 16:05                9226
class.commonmark-node-custominline.php             24-May-2024 16:05                9206
class.commonmark-node-document.php                 24-May-2024 16:05                8428
class.commonmark-node-heading.php                  24-May-2024 16:05                9823
class.commonmark-node-htmlblock.php                24-May-2024 16:05                9525
class.commonmark-node-htmlinline.php               24-May-2024 16:05                9501
class.commonmark-node-image.php                    24-May-2024 16:05               10731
class.commonmark-node-item.php                     24-May-2024 16:05                8440
class.commonmark-node-linebreak.php                24-May-2024 16:05                8454
class.commonmark-node-link.php                     24-May-2024 16:05               10724
class.commonmark-node-orderedlist.php              24-May-2024 16:05               11608
class.commonmark-node-paragraph.php                24-May-2024 16:05                8479
class.commonmark-node-softbreak.php                24-May-2024 16:05                8472
class.commonmark-node-text-emphasis.php            24-May-2024 16:05                8501
class.commonmark-node-text-strong.php              24-May-2024 16:05                8490
class.commonmark-node-text.php                     24-May-2024 16:05                9861
class.commonmark-node-thematicbreak.php            24-May-2024 16:05                8501
class.commonmark-node.php                          24-May-2024 16:05                9378
class.commonmark-parser.php                        24-May-2024 16:05                3856
class.compersisthelper.php                         24-May-2024 16:05                7764
class.compileerror.php                             24-May-2024 16:04                8489
class.componere-abstract-definition.php            24-May-2024 16:04                4768
class.componere-definition.php                     24-May-2024 16:04               10273
class.componere-method.php                         24-May-2024 16:04                4348
class.componere-patch.php                          24-May-2024 16:04                8368
class.componere-value.php                          24-May-2024 16:04                5451
class.countable.php                                24-May-2024 16:05                2672
class.curlfile.php                                 24-May-2024 16:05                8565
class.curlhandle.php                               24-May-2024 16:05                1806
class.curlmultihandle.php                          24-May-2024 16:05                1845
class.curlsharehandle.php                          24-May-2024 16:05                1841
class.curlstringfile.php                           24-May-2024 16:05                5847
class.dateerror.php                                24-May-2024 16:04                9265
class.dateexception.php                            24-May-2024 16:04                9761
class.dateinterval.php                             24-May-2024 16:04               14540
class.dateinvalidoperationexception.php            24-May-2024 16:04                9273
class.dateinvalidtimezoneexception.php             24-May-2024 16:04                8765
class.datemalformedintervalstringexception.php     24-May-2024 16:04                8861
class.datemalformedperiodstringexception.php       24-May-2024 16:04                8843
class.datemalformedstringexception.php             24-May-2024 16:04                9194
class.dateobjecterror.php                          24-May-2024 16:04                9018
class.dateperiod.php                               24-May-2024 16:04               22858
class.daterangeerror.php                           24-May-2024 16:04                9192
class.datetime.php                                 24-May-2024 16:04               23884
class.datetimeimmutable.php                        24-May-2024 16:04               23821
class.datetimeinterface.php                        24-May-2024 16:04               20448
class.datetimezone.php                             24-May-2024 16:04               15884
class.deflatecontext.php                           24-May-2024 16:04                1860
class.directory.php                                24-May-2024 16:04                5671
class.directoryiterator.php                        24-May-2024 16:05               20312
class.divisionbyzeroerror.php                      24-May-2024 16:04                8509
class.domainexception.php                          24-May-2024 16:05                8557
class.domattr.php                                  24-May-2024 16:05               28634
class.domcdatasection.php                          24-May-2024 16:05               32179
class.domcharacterdata.php                         24-May-2024 16:05               33672
class.domchildnode.php                             24-May-2024 16:05                4330
class.domcomment.php                               24-May-2024 16:05               30857
class.domdocument.php                              24-May-2024 16:05               69999
class.domdocumentfragment.php                      24-May-2024 16:05               29354
class.domdocumenttype.php                          24-May-2024 16:05               27281
class.domelement.php                               24-May-2024 16:05               53651
class.domentity.php                                24-May-2024 16:05               28393
class.domentityreference.php                       24-May-2024 16:05               23437
class.domexception.php                             24-May-2024 16:05                9396
class.domimplementation.php                        24-May-2024 16:05                6136
class.domnamednodemap.php                          24-May-2024 16:05                7654
class.domnamespacenode.php                         24-May-2024 16:05                9570
class.domnode.php                                  24-May-2024 16:05               33115
class.domnodelist.php                              24-May-2024 16:05                6173
class.domnotation.php                              24-May-2024 16:05               23700
class.domparentnode.php                            24-May-2024 16:05                3977
class.domprocessinginstruction.php                 24-May-2024 16:05               24976
class.domtext.php                                  24-May-2024 16:05               33950
class.domxpath.php                                 24-May-2024 16:05                8836
class.dotnet.php                                   24-May-2024 16:05                7650
class.ds-collection.php                            24-May-2024 16:05                6033
class.ds-deque.php                                 24-May-2024 16:05               22117
class.ds-hashable.php                              24-May-2024 16:05                4139
class.ds-map.php                                   24-May-2024 16:05               23057
class.ds-pair.php                                  24-May-2024 16:05                4600
class.ds-priorityqueue.php                         24-May-2024 16:05                8369
class.ds-queue.php                                 24-May-2024 16:05                7860
class.ds-sequence.php                              24-May-2024 16:05               23647
class.ds-set.php                                   24-May-2024 16:05               18588
class.ds-stack.php                                 24-May-2024 16:05                7197
class.ds-vector.php                                24-May-2024 16:05               21653
class.emptyiterator.php                            24-May-2024 16:05                4122
class.enchantbroker.php                            24-May-2024 16:04                1872
class.enchantdictionary.php                        24-May-2024 16:04                1862
class.error.php                                    24-May-2024 16:04               10979
class.errorexception.php                           24-May-2024 16:04               14630
class.ev.php                                       24-May-2024 16:04               45219
class.evcheck.php                                  24-May-2024 16:04               11425
class.evchild.php                                  24-May-2024 16:04               12955
class.evembed.php                                  24-May-2024 16:04               10163
class.event.php                                    24-May-2024 16:05               18483
class.eventbase.php                                24-May-2024 16:05               14906
class.eventbuffer.php                              24-May-2024 16:05               23397
class.eventbufferevent.php                         24-May-2024 16:05               37899
class.eventconfig.php                              24-May-2024 16:05                7841
class.eventdnsbase.php                             24-May-2024 16:05               14276
class.eventexception.php                           24-May-2024 16:05                8563
class.eventhttp.php                                24-May-2024 16:05                9714
class.eventhttpconnection.php                      24-May-2024 16:05               10530
class.eventhttprequest.php                         24-May-2024 16:05               22862
class.eventlistener.php                            24-May-2024 16:05               12803
class.eventsslcontext.php                          24-May-2024 16:05               19168
class.eventutil.php                                24-May-2024 16:05               25561
class.evfork.php                                   24-May-2024 16:04                9216
class.evidle.php                                   24-May-2024 16:04                9858
class.evio.php                                     24-May-2024 16:04               12653
class.evloop.php                                   24-May-2024 16:04               31544
class.evperiodic.php                               24-May-2024 16:04               14968
class.evprepare.php                                24-May-2024 16:04               11567
class.evsignal.php                                 24-May-2024 16:04               11957
class.evstat.php                                   24-May-2024 16:04               14433
class.evtimer.php                                  24-May-2024 16:04               14346
class.evwatcher.php                                24-May-2024 16:04               10005
class.exception.php                                24-May-2024 16:04               11082
class.fannconnection.php                           24-May-2024 16:04                6576
class.ffi-cdata.php                                24-May-2024 16:04                6178
class.ffi-ctype.php                                24-May-2024 16:04               31259
class.ffi-exception.php                            24-May-2024 16:04                8249
class.ffi-parserexception.php                      24-May-2024 16:04                8304
class.ffi.php                                      24-May-2024 16:04               18393
class.fiber.php                                    24-May-2024 16:04                8027
class.fibererror.php                               24-May-2024 16:04                8221
class.filesystemiterator.php                       24-May-2024 16:05               32184
class.filteriterator.php                           24-May-2024 16:05                7550
class.finfo.php                                    24-May-2024 16:04                6332
class.ftp-connection.php                           24-May-2024 16:05                1840
class.gdfont.php                                   24-May-2024 16:04                1758
class.gdimage.php                                  24-May-2024 16:04                1755
class.gearmanclient.php                            24-May-2024 16:05               37790
class.gearmanexception.php                         24-May-2024 16:05                7253
class.gearmanjob.php                               24-May-2024 16:05                9252
class.gearmantask.php                              24-May-2024 16:05                8895
class.gearmanworker.php                            24-May-2024 16:05               13466
class.gender.php                                   24-May-2024 16:04               42286
class.generator.php                                24-May-2024 16:04                6712
class.globiterator.php                             24-May-2024 16:05               26575
class.gmagick.php                                  24-May-2024 16:04               88752
class.gmagickdraw.php                              24-May-2024 16:04               24832
class.gmagickpixel.php                             24-May-2024 16:04                5958
class.gmp.php                                      24-May-2024 16:04                4398
class.hashcontext.php                              24-May-2024 16:04                3419
class.hrtime-performancecounter.php                24-May-2024 16:04                3850
class.hrtime-stopwatch.php                         24-May-2024 16:04                7072
class.hrtime-unit.php                              24-May-2024 16:04                4429
class.imagick.php                                  24-May-2024 16:04              290556
class.imagickdraw.php                              24-May-2024 16:04               84230
class.imagickkernel.php                            24-May-2024 16:04                6562
class.imagickpixel.php                             24-May-2024 16:04               14030
class.imagickpixeliterator.php                     24-May-2024 16:04                9751
class.imap-connection.php                          24-May-2024 16:04                1845
class.infiniteiterator.php                         24-May-2024 16:05                5385
class.inflatecontext.php                           24-May-2024 16:04                1828
class.internaliterator.php                         24-May-2024 16:04                4866
class.intlbreakiterator.php                        24-May-2024 16:04               31225
class.intlcalendar.php                             24-May-2024 16:04               74006
class.intlchar.php                                 24-May-2024 16:04              474645
class.intlcodepointbreakiterator.php               24-May-2024 16:04               21627
class.intldateformatter.php                        24-May-2024 16:04               33308
class.intldatepatterngenerator.php                 24-May-2024 16:04                4832
class.intlexception.php                            24-May-2024 16:04                8719
class.intlgregoriancalendar.php                    24-May-2024 16:04               53405
class.intliterator.php                             24-May-2024 16:04                5358
class.intlpartsiterator.php                        24-May-2024 16:04                7274
class.intlrulebasedbreakiterator.php               24-May-2024 16:04               24672
class.intltimezone.php                             24-May-2024 16:04               28964
class.invalidargumentexception.php                 24-May-2024 16:05                8595
class.iterator.php                                 24-May-2024 16:04               11608
class.iteratoraggregate.php                        24-May-2024 16:04                6352
class.iteratoriterator.php                         24-May-2024 16:05                6598
class.jsonexception.php                            24-May-2024 16:04                9094
class.jsonserializable.php                         24-May-2024 16:04                2891
class.ldap-connection.php                          24-May-2024 16:05                1859
class.ldap-result-entry.php                        24-May-2024 16:05                1878
class.ldap-result.php                              24-May-2024 16:05                1852
class.lengthexception.php                          24-May-2024 16:05                8505
class.libxmlerror.php                              24-May-2024 16:05                5799
class.limititerator.php                            24-May-2024 16:05               11509
class.locale.php                                   24-May-2024 16:04               29335
class.logicexception.php                           24-May-2024 16:05                8591
class.lua.php                                      24-May-2024 16:04                7815
class.luaclosure.php                               24-May-2024 16:04                2742
class.luasandbox.php                               24-May-2024 16:04               14168
class.luasandboxerror.php                          24-May-2024 16:05               10119
class.luasandboxerrorerror.php                     24-May-2024 16:05                7662
class.luasandboxfatalerror.php                     24-May-2024 16:05                7784
class.luasandboxfunction.php                       24-May-2024 16:05                3959
class.luasandboxmemoryerror.php                    24-May-2024 16:05                7969
class.luasandboxruntimeerror.php                   24-May-2024 16:05                7804
class.luasandboxsyntaxerror.php                    24-May-2024 16:05                7666
class.luasandboxtimeouterror.php                   24-May-2024 16:05                7957
class.memcache.php                                 24-May-2024 16:05               19478
class.memcached.php                                24-May-2024 16:05               48475
class.memcachedexception.php                       24-May-2024 16:05                7545
class.messageformatter.php                         24-May-2024 16:04               12842
class.mongodb-bson-binary.php                      24-May-2024 16:04               16917
class.mongodb-bson-binaryinterface.php             24-May-2024 16:04                4750
class.mongodb-bson-dbpointer.php                   24-May-2024 16:04                6071
class.mongodb-bson-decimal128.php                  24-May-2024 16:04                7852
class.mongodb-bson-decimal128interface.php         24-May-2024 16:04                3877
class.mongodb-bson-document.php                    24-May-2024 16:04               11346
class.mongodb-bson-int64.php                       24-May-2024 16:04                7541
class.mongodb-bson-iterator.php                    24-May-2024 16:04                5024
class.mongodb-bson-javascript.php                  24-May-2024 16:04                8800
class.mongodb-bson-javascriptinterface.php         24-May-2024 16:04                4980
class.mongodb-bson-maxkey.php                      24-May-2024 16:04                5899
class.mongodb-bson-maxkeyinterface.php             24-May-2024 16:04                2244
class.mongodb-bson-minkey.php                      24-May-2024 16:04                5890
class.mongodb-bson-minkeyinterface.php             24-May-2024 16:04                2225
class.mongodb-bson-objectid.php                    24-May-2024 16:04                9262
class.mongodb-bson-objectidinterface.php           24-May-2024 16:04                4367
class.mongodb-bson-packedarray.php                 24-May-2024 16:04                9132
class.mongodb-bson-persistable.php                 24-May-2024 16:04                6199
class.mongodb-bson-regex.php                       24-May-2024 16:04                8231
class.mongodb-bson-regexinterface.php              24-May-2024 16:04                4769
class.mongodb-bson-serializable.php                24-May-2024 16:04                4279
class.mongodb-bson-symbol.php                      24-May-2024 16:04                5959
class.mongodb-bson-timestamp.php                   24-May-2024 16:04                8478
class.mongodb-bson-timestampinterface.php          24-May-2024 16:04                4927
class.mongodb-bson-type.php                        24-May-2024 16:04                2085
class.mongodb-bson-undefined.php                   24-May-2024 16:04                6047
class.mongodb-bson-unserializable.php              24-May-2024 16:04                4022
class.mongodb-bson-utcdatetime.php                 24-May-2024 16:04                8081
class.mongodb-bson-utcdatetimeinterface.php        24-May-2024 16:04                4440
class.mongodb-driver-bulkwrite.php                 24-May-2024 16:04               24158
class.mongodb-driver-clientencryption.php          24-May-2024 16:04               23484
class.mongodb-driver-command.php                   24-May-2024 16:04               14267
class.mongodb-driver-cursor.php                    24-May-2024 16:04               25850
class.mongodb-driver-cursorid.php                  24-May-2024 16:04                5590
class.mongodb-driver-cursorinterface.php           24-May-2024 16:04                6228
class.mongodb-driver-exception-authenticationex..> 24-May-2024 16:04                9216
class.mongodb-driver-exception-bulkwriteexcepti..> 24-May-2024 16:04               10070
class.mongodb-driver-exception-commandexception..> 24-May-2024 16:04               10975
class.mongodb-driver-exception-connectionexcept..> 24-May-2024 16:04                9285
class.mongodb-driver-exception-connectiontimeou..> 24-May-2024 16:04                9673
class.mongodb-driver-exception-encryptionexcept..> 24-May-2024 16:04                9219
class.mongodb-driver-exception-exception.php       24-May-2024 16:04                2239
class.mongodb-driver-exception-executiontimeout..> 24-May-2024 16:04               10329
class.mongodb-driver-exception-invalidargumente..> 24-May-2024 16:04                8245
class.mongodb-driver-exception-logicexception.php  24-May-2024 16:04                8129
class.mongodb-driver-exception-runtimeexception..> 24-May-2024 16:04               11729
class.mongodb-driver-exception-serverexception.php 24-May-2024 16:04                9296
class.mongodb-driver-exception-sslconnectionexc..> 24-May-2024 16:04                9562
class.mongodb-driver-exception-unexpectedvaluee..> 24-May-2024 16:04                8262
class.mongodb-driver-exception-writeexception.php  24-May-2024 16:04               12247
class.mongodb-driver-manager.php                   24-May-2024 16:04               21859
class.mongodb-driver-monitoring-commandfailedev..> 24-May-2024 16:04                8678
class.mongodb-driver-monitoring-commandstartede..> 24-May-2024 16:04                7601
class.mongodb-driver-monitoring-commandsubscrib..> 24-May-2024 16:04                6328
class.mongodb-driver-monitoring-commandsucceede..> 24-May-2024 16:04                8269
class.mongodb-driver-monitoring-logsubscriber.php  24-May-2024 16:04               10166
class.mongodb-driver-monitoring-sdamsubscriber.php 24-May-2024 16:04               11678
class.mongodb-driver-monitoring-serverchangedev..> 24-May-2024 16:04                5791
class.mongodb-driver-monitoring-serverclosedeve..> 24-May-2024 16:04                4438
class.mongodb-driver-monitoring-serverheartbeat..> 24-May-2024 16:04                5789
class.mongodb-driver-monitoring-serverheartbeat..> 24-May-2024 16:04                4616
class.mongodb-driver-monitoring-serverheartbeat..> 24-May-2024 16:04                5861
class.mongodb-driver-monitoring-serveropeningev..> 24-May-2024 16:04                4458
class.mongodb-driver-monitoring-subscriber.php     24-May-2024 16:04                2700
class.mongodb-driver-monitoring-topologychanged..> 24-May-2024 16:04                4786
class.mongodb-driver-monitoring-topologyclosede..> 24-May-2024 16:04                3397
class.mongodb-driver-monitoring-topologyopening..> 24-May-2024 16:04                3411
class.mongodb-driver-query.php                     24-May-2024 16:04                3470
class.mongodb-driver-readconcern.php               24-May-2024 16:04               17738
class.mongodb-driver-readpreference.php            24-May-2024 16:04               21948
class.mongodb-driver-server.php                    24-May-2024 16:04               27218
class.mongodb-driver-serverapi.php                 24-May-2024 16:04               14129
class.mongodb-driver-serverdescription.php         24-May-2024 16:04               16917
class.mongodb-driver-session.php                   24-May-2024 16:04               15576
class.mongodb-driver-topologydescription.php       24-May-2024 16:04               11681
class.mongodb-driver-writeconcern.php              24-May-2024 16:04               10333
class.mongodb-driver-writeconcernerror.php         24-May-2024 16:04                4429
class.mongodb-driver-writeerror.php                24-May-2024 16:04                4753
class.mongodb-driver-writeresult.php               24-May-2024 16:04                8731
class.multipleiterator.php                         24-May-2024 16:05               12019
class.mysql-xdevapi-baseresult.php                 24-May-2024 16:04                3122
class.mysql-xdevapi-client.php                     24-May-2024 16:04                3294
class.mysql-xdevapi-collection.php                 24-May-2024 16:04               11276
class.mysql-xdevapi-collectionadd.php              24-May-2024 16:04                3029
class.mysql-xdevapi-collectionfind.php             24-May-2024 16:04                9070
class.mysql-xdevapi-collectionmodify.php           24-May-2024 16:04               10565
class.mysql-xdevapi-collectionremove.php           24-May-2024 16:04                5342
class.mysql-xdevapi-columnresult.php               24-May-2024 16:04                7077
class.mysql-xdevapi-crudoperationbindable.php      24-May-2024 16:04                3073
class.mysql-xdevapi-crudoperationlimitable.php     24-May-2024 16:04                3058
class.mysql-xdevapi-crudoperationskippable.php     24-May-2024 16:04                3066
class.mysql-xdevapi-crudoperationsortable.php      24-May-2024 16:04                3052
class.mysql-xdevapi-databaseobject.php             24-May-2024 16:04                3707
class.mysql-xdevapi-docresult.php                  24-May-2024 16:04                4183
class.mysql-xdevapi-exception.php                  24-May-2024 16:04                2259
class.mysql-xdevapi-executable.php                 24-May-2024 16:04                2708
class.mysql-xdevapi-executionstatus.php            24-May-2024 16:04                4935
class.mysql-xdevapi-expression.php                 24-May-2024 16:04                3328
class.mysql-xdevapi-result.php                     24-May-2024 16:04                4603
class.mysql-xdevapi-rowresult.php                  24-May-2024 16:04                5355
class.mysql-xdevapi-schema.php                     24-May-2024 16:04                8021
class.mysql-xdevapi-schemaobject.php               24-May-2024 16:04                2896
class.mysql-xdevapi-session.php                    24-May-2024 16:04               10186
class.mysql-xdevapi-sqlstatement.php               24-May-2024 16:04                6818
class.mysql-xdevapi-sqlstatementresult.php         24-May-2024 16:04                7617
class.mysql-xdevapi-statement.php                  24-May-2024 16:04                5131
class.mysql-xdevapi-table.php                      24-May-2024 16:04                7774
class.mysql-xdevapi-tabledelete.php                24-May-2024 16:04                5386
class.mysql-xdevapi-tableinsert.php                24-May-2024 16:04                3651
class.mysql-xdevapi-tableselect.php                24-May-2024 16:04                8615
class.mysql-xdevapi-tableupdate.php                24-May-2024 16:04                6331
class.mysql-xdevapi-warning.php                    24-May-2024 16:04                3825
class.mysqli-driver.php                            24-May-2024 16:04                8510
class.mysqli-result.php                            24-May-2024 16:04               16555
class.mysqli-sql-exception.php                     24-May-2024 16:04               10129
class.mysqli-stmt.php                              24-May-2024 16:04               19461
class.mysqli-warning.php                           24-May-2024 16:04                4502
class.mysqli.php                                   24-May-2024 16:04               46151
class.norewinditerator.php                         24-May-2024 16:05                6916
class.normalizer.php                               24-May-2024 16:04               13807
class.numberformatter.php                          24-May-2024 16:04               76362
class.oauth.php                                    24-May-2024 16:05               20205
class.oauthexception.php                           24-May-2024 16:05                8669
class.oauthprovider.php                            24-May-2024 16:05               13328
class.ocicollection.php                            24-May-2024 16:04                7286
class.ocilob.php                                   24-May-2024 16:04               15974
class.opensslasymmetrickey.php                     24-May-2024 16:04                1949
class.opensslcertificate.php                       24-May-2024 16:04                1939
class.opensslcertificatesigningrequest.php         24-May-2024 16:04                2026
class.outeriterator.php                            24-May-2024 16:05                4453
class.outofboundsexception.php                     24-May-2024 16:05                8634
class.outofrangeexception.php                      24-May-2024 16:05                8636
class.overflowexception.php                        24-May-2024 16:05                8563
class.override.php                                 24-May-2024 16:04                4109
class.parallel-channel.php                         24-May-2024 16:04                8245
class.parallel-events-event-type.php               24-May-2024 16:04                3415
class.parallel-events-event.php                    24-May-2024 16:04                3568
class.parallel-events-input.php                    24-May-2024 16:04                4793
class.parallel-events.php                          24-May-2024 16:04                7165
class.parallel-future.php                          24-May-2024 16:04                7858
class.parallel-runtime.php                         24-May-2024 16:04                6442
class.parallel-sync.php                            24-May-2024 16:04                5266
class.parentiterator.php                           24-May-2024 16:05                9800
class.parle-errorinfo.php                          24-May-2024 16:05                3915
class.parle-lexer.php                              24-May-2024 16:05               13232
class.parle-lexerexception.php                     24-May-2024 16:05                7803
class.parle-parser.php                             24-May-2024 16:05               18160
class.parle-parserexception.php                    24-May-2024 16:05                7785
class.parle-rlexer.php                             24-May-2024 16:05               15467
class.parle-rparser.php                            24-May-2024 16:05               18333
class.parle-stack.php                              24-May-2024 16:05                4872
class.parle-token.php                              24-May-2024 16:05                4973
class.parseerror.php                               24-May-2024 16:04                9089
class.pdo.php                                      24-May-2024 16:04               43066
class.pdoexception.php                             24-May-2024 16:04               10562
class.pdorow.php                                   24-May-2024 16:04                4626
class.pdostatement.php                             24-May-2024 16:04               23443
class.pgsql-connection.php                         24-May-2024 16:04                1882
class.pgsql-lob.php                                24-May-2024 16:04                1823
class.pgsql-result.php                             24-May-2024 16:04                1855
class.phar.php                                     24-May-2024 16:04               75563
class.phardata.php                                 24-May-2024 16:04               50377
class.pharexception.php                            24-May-2024 16:04                8517
class.pharfileinfo.php                             24-May-2024 16:04               22094
class.php-user-filter.php                          24-May-2024 16:05                6652
class.phptoken.php                                 24-May-2024 16:05                9199
class.pool.php                                     24-May-2024 16:04                7758
class.pspell-config.php                            24-May-2024 16:04                1854
class.pspell-dictionary.php                        24-May-2024 16:04                1891
class.quickhashinthash.php                         24-May-2024 16:05               15133
class.quickhashintset.php                          24-May-2024 16:05               12906
class.quickhashintstringhash.php                   24-May-2024 16:05               16029
class.quickhashstringinthash.php                   24-May-2024 16:05               13698
class.random-brokenrandomengineerror.php           24-May-2024 16:05                8667
class.random-cryptosafeengine.php                  24-May-2024 16:05                2589
class.random-engine-mt19937.php                    24-May-2024 16:05                5525
class.random-engine-pcgoneseq128xslrr64.php        24-May-2024 16:05                6401
class.random-engine-secure.php                     24-May-2024 16:05                3654
class.random-engine-xoshiro256starstar.php         24-May-2024 16:05                6567
class.random-engine.php                            24-May-2024 16:05                4368
class.random-randomerror.php                       24-May-2024 16:05                8543
class.random-randomexception.php                   24-May-2024 16:05                8657
class.random-randomizer.php                        24-May-2024 16:05               10908
class.rangeexception.php                           24-May-2024 16:05                8827
class.rararchive.php                               24-May-2024 16:04                8198
class.rarentry.php                                 24-May-2024 16:04               50151
class.rarexception.php                             24-May-2024 16:04                8570
class.recursivearrayiterator.php                   24-May-2024 16:05               16139
class.recursivecachingiterator.php                 24-May-2024 16:05               14202
class.recursivecallbackfilteriterator.php          24-May-2024 16:05               13669
class.recursivedirectoryiterator.php               24-May-2024 16:05               30076
class.recursivefilteriterator.php                  24-May-2024 16:05                8389
class.recursiveiterator.php                        24-May-2024 16:05                5018
class.recursiveiteratoriterator.php                24-May-2024 16:05               14932
class.recursiveregexiterator.php                   24-May-2024 16:05               14877
class.recursivetreeiterator.php                    24-May-2024 16:05               25905
class.reflection.php                               24-May-2024 16:05                3532
class.reflectionattribute.php                      24-May-2024 16:05                6675
class.reflectionclass.php                          24-May-2024 16:05               38869
class.reflectionclassconstant.php                  24-May-2024 16:05               16927
class.reflectionenum.php                           24-May-2024 16:05               31652
class.reflectionenumbackedcase.php                 24-May-2024 16:05               13096
class.reflectionenumunitcase.php                   24-May-2024 16:05               12771
class.reflectionexception.php                      24-May-2024 16:05                8475
class.reflectionextension.php                      24-May-2024 16:05               11005
class.reflectionfiber.php                          24-May-2024 16:05                5341
class.reflectionfunction.php                       24-May-2024 16:05               21449
class.reflectionfunctionabstract.php               24-May-2024 16:05               20485
class.reflectiongenerator.php                      24-May-2024 16:05                6586
class.reflectionintersectiontype.php               24-May-2024 16:05                3487
class.reflectionmethod.php                         24-May-2024 16:05               33659
class.reflectionnamedtype.php                      24-May-2024 16:05                3824
class.reflectionobject.php                         24-May-2024 16:05               29319
class.reflectionparameter.php                      24-May-2024 16:05               17105
class.reflectionproperty.php                       24-May-2024 16:05               23180
class.reflectionreference.php                      24-May-2024 16:05                4275
class.reflectiontype.php                           24-May-2024 16:05                4678
class.reflectionuniontype.php                      24-May-2024 16:05                3375
class.reflectionzendextension.php                  24-May-2024 16:05                8113
class.reflector.php                                24-May-2024 16:05                4166
class.regexiterator.php                            24-May-2024 16:05               18035
class.resourcebundle.php                           24-May-2024 16:04               11320
class.returntypewillchange.php                     24-May-2024 16:04                3355
class.rnpffi.php                                   24-May-2024 16:04                1688
class.rrdcreator.php                               24-May-2024 16:05                4539
class.rrdgraph.php                                 24-May-2024 16:05                3986
class.rrdupdater.php                               24-May-2024 16:05                3356
class.runtimeexception.php                         24-May-2024 16:05                8512
class.seaslog.php                                  24-May-2024 16:05               21985
class.seekableiterator.php                         24-May-2024 16:05               11470
class.sensitiveparameter.php                       24-May-2024 16:04                6448
class.sensitiveparametervalue.php                  24-May-2024 16:04                5135
class.serializable.php                             24-May-2024 16:04                8495
class.sessionhandler.php                           24-May-2024 16:05               26561
class.sessionhandlerinterface.php                  24-May-2024 16:05               16223
class.sessionidinterface.php                       24-May-2024 16:05                3389
class.sessionupdatetimestamphandlerinterface.php   24-May-2024 16:05                4653
class.shmop.php                                    24-May-2024 16:04                1756
class.simdjsonexception.php                        24-May-2024 16:04                5069
class.simdjsonvalueerror.php                       24-May-2024 16:04                8383
class.simplexmlelement.php                         24-May-2024 16:05               18871
class.simplexmliterator.php                        24-May-2024 16:05               16766
class.snmp.php                                     24-May-2024 16:05               29295
class.snmpexception.php                            24-May-2024 16:05                9187
class.soapclient.php                               24-May-2024 16:05               34523
class.soapfault.php                                24-May-2024 16:05               14387
class.soapheader.php                               24-May-2024 16:05                6104
class.soapparam.php                                24-May-2024 16:05                3789
class.soapserver.php                               24-May-2024 16:05               10185
class.soapvar.php                                  24-May-2024 16:05                7917
class.socket.php                                   24-May-2024 16:05                1823
class.sodiumexception.php                          24-May-2024 16:04                8455
class.solrclient.php                               24-May-2024 16:05               24770
class.solrclientexception.php                      24-May-2024 16:05                9748
class.solrcollapsefunction.php                     24-May-2024 16:05               11803
class.solrdismaxquery.php                          24-May-2024 16:05              111919
class.solrdocument.php                             24-May-2024 16:05               23627
class.solrdocumentfield.php                        24-May-2024 16:05                4738
class.solrexception.php                            24-May-2024 16:05               10217
class.solrgenericresponse.php                      24-May-2024 16:05               12789
class.solrillegalargumentexception.php             24-May-2024 16:05                9904
class.solrillegaloperationexception.php            24-May-2024 16:05                9971
class.solrinputdocument.php                        24-May-2024 16:05               19652
class.solrmissingmandatoryparameterexception.php   24-May-2024 16:05                9037
class.solrmodifiableparams.php                     24-May-2024 16:05                9043
class.solrobject.php                               24-May-2024 16:05                6035
class.solrparams.php                               24-May-2024 16:05                9339
class.solrpingresponse.php                         24-May-2024 16:05               11428
class.solrquery.php                                24-May-2024 16:05              119047
class.solrqueryresponse.php                        24-May-2024 16:05               12723
class.solrresponse.php                             24-May-2024 16:05               14721
class.solrserverexception.php                      24-May-2024 16:05                9788
class.solrupdateresponse.php                       24-May-2024 16:05               12763
class.solrutils.php                                24-May-2024 16:05                5077
class.spldoublylinkedlist.php                      24-May-2024 16:05               17818
class.splfileinfo.php                              24-May-2024 16:05               18699
class.splfileobject.php                            24-May-2024 16:05               38074
class.splfixedarray.php                            24-May-2024 16:05               20311
class.splheap.php                                  24-May-2024 16:05                7865
class.splmaxheap.php                               24-May-2024 16:05                7212
class.splminheap.php                               24-May-2024 16:05                7222
class.splobjectstorage.php                         24-May-2024 16:05               21717
class.splobserver.php                              24-May-2024 16:05                2935
class.splpriorityqueue.php                         24-May-2024 16:05               11994
class.splqueue.php                                 24-May-2024 16:05               17261
class.splstack.php                                 24-May-2024 16:05               14459
class.splsubject.php                               24-May-2024 16:05                3831
class.spltempfileobject.php                        24-May-2024 16:05               31901
class.spoofchecker.php                             24-May-2024 16:04               18029
class.sqlite3.php                                  24-May-2024 16:04               40067
class.sqlite3exception.php                         24-May-2024 16:04                8431
class.sqlite3result.php                            24-May-2024 16:04                5890
class.sqlite3stmt.php                              24-May-2024 16:04                8536
class.stdclass.php                                 24-May-2024 16:04                7097
class.stomp.php                                    24-May-2024 16:05               21691
class.stompexception.php                           24-May-2024 16:05                5891
class.stompframe.php                               24-May-2024 16:05                4382
class.streamwrapper.php                            24-May-2024 16:05               21103
class.stringable.php                               24-May-2024 16:04                8664
class.svm.php                                      24-May-2024 16:05               18486
class.svmmodel.php                                 24-May-2024 16:05                7048
class.swoole-async.php                             24-May-2024 16:05                8039
class.swoole-atomic.php                            24-May-2024 16:05                5068
class.swoole-buffer.php                            24-May-2024 16:05                7523
class.swoole-channel.php                           24-May-2024 16:05                3966
class.swoole-client.php                            24-May-2024 16:05               16535
class.swoole-connection-iterator.php               24-May-2024 16:05                7519
class.swoole-coroutine.php                         24-May-2024 16:05               18655
class.swoole-event.php                             24-May-2024 16:05                7462
class.swoole-exception.php                         24-May-2024 16:05                4584
class.swoole-http-client.php                       24-May-2024 16:05               14791
class.swoole-http-request.php                      24-May-2024 16:05                3031
class.swoole-http-response.php                     24-May-2024 16:05               10907
class.swoole-http-server.php                       24-May-2024 16:05               26441
class.swoole-lock.php                              24-May-2024 16:05                4676
class.swoole-mmap.php                              24-May-2024 16:05                3077
class.swoole-mysql-exception.php                   24-May-2024 16:05                4625
class.swoole-mysql.php                             24-May-2024 16:05                5415
class.swoole-process.php                           24-May-2024 16:05               13659
class.swoole-redis-server.php                      24-May-2024 16:05               32068
class.swoole-serialize.php                         24-May-2024 16:05                3609
class.swoole-server.php                            24-May-2024 16:05               29574
class.swoole-table.php                             24-May-2024 16:05               12709
class.swoole-timer.php                             24-May-2024 16:05                4997
class.swoole-websocket-frame.php                   24-May-2024 16:05                1957
class.swoole-websocket-server.php                  24-May-2024 16:05                7834
class.syncevent.php                                24-May-2024 16:04                4895
class.syncmutex.php                                24-May-2024 16:04                4214
class.syncreaderwriter.php                         24-May-2024 16:04                5204
class.syncsemaphore.php                            24-May-2024 16:04                4652
class.syncsharedmemory.php                         24-May-2024 16:04                5502
class.sysvmessagequeue.php                         24-May-2024 16:04                1873
class.sysvsemaphore.php                            24-May-2024 16:04                1859
class.sysvsharedmemory.php                         24-May-2024 16:04                1864
class.thread.php                                   24-May-2024 16:04               11562
class.threaded.php                                 24-May-2024 16:04                8836
class.throwable.php                                24-May-2024 16:04                7524
class.tidy.php                                     24-May-2024 16:05               19334
class.tidynode.php                                 24-May-2024 16:05               11929
class.transliterator.php                           24-May-2024 16:04               10390
class.traversable.php                              24-May-2024 16:04                4843
class.typeerror.php                                24-May-2024 16:04                9646
class.uconverter.php                               24-May-2024 16:04               41387
class.ui-area.php                                  24-May-2024 16:05               12249
class.ui-control.php                               24-May-2024 16:05                5474
class.ui-controls-box.php                          24-May-2024 16:05               10124
class.ui-controls-button.php                       24-May-2024 16:05                6682
class.ui-controls-check.php                        24-May-2024 16:05                7526
class.ui-controls-colorbutton.php                  24-May-2024 16:05                6561
class.ui-controls-combo.php                        24-May-2024 16:05                6650
class.ui-controls-editablecombo.php                24-May-2024 16:05                6762
class.ui-controls-entry.php                        24-May-2024 16:05                9639
class.ui-controls-form.php                         24-May-2024 16:05                8058
class.ui-controls-grid.php                         24-May-2024 16:05               13155
class.ui-controls-group.php                        24-May-2024 16:05                8366
class.ui-controls-label.php                        24-May-2024 16:05                6433
class.ui-controls-multilineentry.php               24-May-2024 16:05                9882
class.ui-controls-picker.php                       24-May-2024 16:05                7565
class.ui-controls-progress.php                     24-May-2024 16:05                5934
class.ui-controls-radio.php                        24-May-2024 16:05                6629
class.ui-controls-separator.php                    24-May-2024 16:05                7069
class.ui-controls-slider.php                       24-May-2024 16:05                7017
class.ui-controls-spin.php                         24-May-2024 16:05                6887
class.ui-controls-tab.php                          24-May-2024 16:05                9164
class.ui-draw-brush-gradient.php                   24-May-2024 16:05                7342
class.ui-draw-brush-lineargradient.php             24-May-2024 16:05                6590
class.ui-draw-brush-radialgradient.php             24-May-2024 16:05                6776
class.ui-draw-brush.php                            24-May-2024 16:05                4434
class.ui-draw-color.php                            24-May-2024 16:05                8585
class.ui-draw-line-cap.php                         24-May-2024 16:05                3738
class.ui-draw-line-join.php                        24-May-2024 16:05                3722
class.ui-draw-matrix.php                           24-May-2024 16:05                5624
class.ui-draw-path.php                             24-May-2024 16:05               10755
class.ui-draw-pen.php                              24-May-2024 16:05                8131
class.ui-draw-stroke.php                           24-May-2024 16:05                6882
class.ui-draw-text-font-descriptor.php             24-May-2024 16:05                6044
class.ui-draw-text-font-italic.php                 24-May-2024 16:05                4097
class.ui-draw-text-font-stretch.php                24-May-2024 16:05                8293
class.ui-draw-text-font-weight.php                 24-May-2024 16:05                8895
class.ui-draw-text-font.php                        24-May-2024 16:05                4873
class.ui-draw-text-layout.php                      24-May-2024 16:05                5283
class.ui-exception-invalidargumentexception.php    24-May-2024 16:05                7815
class.ui-exception-runtimeexception.php            24-May-2024 16:05                7738
class.ui-executor.php                              24-May-2024 16:05                5434
class.ui-key.php                                   24-May-2024 16:05               21337
class.ui-menu.php                                  24-May-2024 16:05                6292
class.ui-menuitem.php                              24-May-2024 16:05                3762
class.ui-point.php                                 24-May-2024 16:05                6327
class.ui-size.php                                  24-May-2024 16:05                6411
class.ui-window.php                                24-May-2024 16:05               13108
class.underflowexception.php                       24-May-2024 16:05                8595
class.unexpectedvalueexception.php                 24-May-2024 16:05                8867
class.unhandledmatcherror.php                      24-May-2024 16:04                8559
class.unitenum.php                                 24-May-2024 16:04                3027
class.v8js.php                                     24-May-2024 16:05                9294
class.v8jsexception.php                            24-May-2024 16:05               11332
class.valueerror.php                               24-May-2024 16:04                8589
class.variant.php                                  24-May-2024 16:05                5892
class.varnishadmin.php                             24-May-2024 16:05               11888
class.varnishlog.php                               24-May-2024 16:05               34837
class.varnishstat.php                              24-May-2024 16:05                3058
class.volatile.php                                 24-May-2024 16:04               11772
class.vtiful-kernel-excel.php                      24-May-2024 16:04               12037
class.vtiful-kernel-format.php                     24-May-2024 16:04               16072
class.weakmap.php                                  24-May-2024 16:04                9718
class.weakreference.php                            24-May-2024 16:04                5818
class.win32serviceexception.php                    24-May-2024 16:05                7870
class.wkhtmltox-image-converter.php                24-May-2024 16:04                4177
class.wkhtmltox-pdf-converter.php                  24-May-2024 16:04                4491
class.wkhtmltox-pdf-object.php                     24-May-2024 16:04                2995
class.worker.php                                   24-May-2024 16:04                8736
class.xmldiff-base.php                             24-May-2024 16:05                4135
class.xmldiff-dom.php                              24-May-2024 16:05                5085
class.xmldiff-file.php                             24-May-2024 16:05                5061
class.xmldiff-memory.php                           24-May-2024 16:05                5093
class.xmlparser.php                                24-May-2024 16:05                1838
class.xmlreader.php                                24-May-2024 16:05               41605
class.xmlwriter.php                                24-May-2024 16:05               33116
class.xsltprocessor.php                            24-May-2024 16:05               11762
class.yac.php                                      24-May-2024 16:04                9565
class.yaconf.php                                   24-May-2024 16:05                3486
class.yaf-action-abstract.php                      24-May-2024 16:05               12891
class.yaf-application.php                          24-May-2024 16:05               13093
class.yaf-bootstrap-abstract.php                   24-May-2024 16:05                5748
class.yaf-config-abstract.php                      24-May-2024 16:05                5287
class.yaf-config-ini.php                           24-May-2024 16:05               18080
class.yaf-config-simple.php                        24-May-2024 16:05               13270
class.yaf-controller-abstract.php                  24-May-2024 16:05               19912
class.yaf-dispatcher.php                           24-May-2024 16:05               20888
class.yaf-exception-dispatchfailed.php             24-May-2024 16:05                2678
class.yaf-exception-loadfailed-action.php          24-May-2024 16:05                2749
class.yaf-exception-loadfailed-controller.php      24-May-2024 16:05                2774
class.yaf-exception-loadfailed-module.php          24-May-2024 16:05                2738
class.yaf-exception-loadfailed-view.php            24-May-2024 16:05                2678
class.yaf-exception-loadfailed.php                 24-May-2024 16:05                2652
class.yaf-exception-routerfailed.php               24-May-2024 16:05                2663
class.yaf-exception-startuperror.php               24-May-2024 16:05                2661
class.yaf-exception-typeerror.php                  24-May-2024 16:05                2632
class.yaf-exception.php                            24-May-2024 16:05                8511
class.yaf-loader.php                               24-May-2024 16:05               20074
class.yaf-plugin-abstract.php                      24-May-2024 16:05               16311
class.yaf-registry.php                             24-May-2024 16:05                6266
class.yaf-request-abstract.php                     24-May-2024 16:05               24069
class.yaf-request-http.php                         24-May-2024 16:05               23658
class.yaf-request-simple.php                       24-May-2024 16:05               22859
class.yaf-response-abstract.php                    24-May-2024 16:05               12006
class.yaf-route-interface.php                      24-May-2024 16:05                3833
class.yaf-route-map.php                            24-May-2024 16:05                6781
class.yaf-route-regex.php                          24-May-2024 16:05                8483
class.yaf-route-rewrite.php                        24-May-2024 16:05                7577
class.yaf-route-simple.php                         24-May-2024 16:05                6806
class.yaf-route-static.php                         24-May-2024 16:05                5238
class.yaf-route-supervar.php                       24-May-2024 16:05                4773
class.yaf-router.php                               24-May-2024 16:05               13045
class.yaf-session.php                              24-May-2024 16:05               12692
class.yaf-view-interface.php                       24-May-2024 16:05                6174
class.yaf-view-simple.php                          24-May-2024 16:05               11571
class.yar-client-exception.php                     24-May-2024 16:05                6654
class.yar-client.php                               24-May-2024 16:05                5851
class.yar-concurrent-client.php                    24-May-2024 16:05                6651
class.yar-server-exception.php                     24-May-2024 16:05                7111
class.yar-server.php                               24-May-2024 16:05                3496
class.ziparchive.php                               24-May-2024 16:04               91621
class.zmq.php                                      24-May-2024 16:05               41094
class.zmqcontext.php                               24-May-2024 16:05                5621
class.zmqdevice.php                                24-May-2024 16:05                7070
class.zmqpoll.php                                  24-May-2024 16:05                5206
class.zmqsocket.php                                24-May-2024 16:05               11501
class.zookeeper.php                                24-May-2024 16:05               56110
class.zookeeperauthenticationexception.php         24-May-2024 16:05                7745
class.zookeeperconfig.php                          24-May-2024 16:05                6454
class.zookeeperconnectionexception.php             24-May-2024 16:05                7740
class.zookeeperexception.php                       24-May-2024 16:05                7606
class.zookeepermarshallingexception.php            24-May-2024 16:05                7761
class.zookeepernonodeexception.php                 24-May-2024 16:05                7728
class.zookeeperoperationtimeoutexception.php       24-May-2024 16:05                7771
class.zookeepersessionexception.php                24-May-2024 16:05                7709
classobj.configuration.php                         24-May-2024 16:05                1257
classobj.constants.php                             24-May-2024 16:05                1214
classobj.examples.php                              24-May-2024 16:05               13676
classobj.installation.php                          24-May-2024 16:05                1291
classobj.requirements.php                          24-May-2024 16:05                1231
classobj.resources.php                             24-May-2024 16:05                1232
classobj.setup.php                                 24-May-2024 16:05                1642
closure.bind.php                                   24-May-2024 16:04                8379
closure.bindto.php                                 24-May-2024 16:04               10267
closure.call.php                                   24-May-2024 16:04                6332
closure.construct.php                              24-May-2024 16:04                2575
closure.fromcallable.php                           24-May-2024 16:04                3995
cmark.constants.php                                24-May-2024 16:05                4274
cmark.installation.php                             24-May-2024 16:05                1994
cmark.requirements.php                             24-May-2024 16:05                1329
cmark.setup.php                                    24-May-2024 16:05                1462
collator.asort.php                                 24-May-2024 16:04                9685
collator.compare.php                               24-May-2024 16:04               10752
collator.construct.php                             24-May-2024 16:04                5779
collator.create.php                                24-May-2024 16:04                5560
collator.getattribute.php                          24-May-2024 16:04                6140
collator.geterrorcode.php                          24-May-2024 16:04                5361
collator.geterrormessage.php                       24-May-2024 16:04                5438
collator.getlocale.php                             24-May-2024 16:04                6955
collator.getsortkey.php                            24-May-2024 16:04                7215
collator.getstrength.php                           24-May-2024 16:04                4926
collator.setattribute.php                          24-May-2024 16:04                6732
collator.setstrength.php                           24-May-2024 16:04               14671
collator.sort.php                                  24-May-2024 16:04                8512
collator.sortwithsortkeys.php                      24-May-2024 16:04                6687
collectable.isgarbage.php                          24-May-2024 16:04                3519
com.configuration.php                              24-May-2024 16:05                8967
com.constants.php                                  24-May-2024 16:05               27483
com.construct.php                                  24-May-2024 16:05               10328
com.error-handling.php                             24-May-2024 16:05                1675
com.examples.arrays.php                            24-May-2024 16:05                2414
com.examples.foreach.php                           24-May-2024 16:05                2980
com.examples.php                                   24-May-2024 16:05                1468
com.installation.php                               24-May-2024 16:05                1632
com.requirements.php                               24-May-2024 16:05                1313
com.resources.php                                  24-May-2024 16:05                1197
com.setup.php                                      24-May-2024 16:05                1581
commonmark-cql.construct.php                       24-May-2024 16:05                2236
commonmark-cql.invoke.php                          24-May-2024 16:05                3912
commonmark-interfaces-ivisitable.accept.php        24-May-2024 16:05                3148
commonmark-interfaces-ivisitor.enter.php           24-May-2024 16:05                4173
commonmark-interfaces-ivisitor.leave.php           24-May-2024 16:05                4175
commonmark-node-bulletlist.construct.php           24-May-2024 16:05                3274
commonmark-node-codeblock.construct.php            24-May-2024 16:05                2907
commonmark-node-heading.construct.php              24-May-2024 16:05                2715
commonmark-node-image.construct.php                24-May-2024 16:05                3350
commonmark-node-link.construct.php                 24-May-2024 16:05                3347
commonmark-node-orderedlist.construct.php          24-May-2024 16:05                4235
commonmark-node-text.construct.php                 24-May-2024 16:05                2735
commonmark-node.accept.php                         24-May-2024 16:05                2888
commonmark-node.appendchild.php                    24-May-2024 16:05                2771
commonmark-node.insertafter.php                    24-May-2024 16:05                2796
commonmark-node.insertbefore.php                   24-May-2024 16:05                2794
commonmark-node.prependchild.php                   24-May-2024 16:05                2798
commonmark-node.replace.php                        24-May-2024 16:05                2742
commonmark-node.unlink.php                         24-May-2024 16:05                2461
commonmark-parser.construct.php                    24-May-2024 16:05                3880
commonmark-parser.finish.php                       24-May-2024 16:05                2491
commonmark-parser.parse.php                        24-May-2024 16:05                2701
compersisthelper.construct.php                     24-May-2024 16:05                3822
compersisthelper.getcurfilename.php                24-May-2024 16:05                3303
compersisthelper.getmaxstreamsize.php              24-May-2024 16:05                3377
compersisthelper.initnew.php                       24-May-2024 16:05                3278
compersisthelper.loadfromfile.php                  24-May-2024 16:05                4568
compersisthelper.loadfromstream.php                24-May-2024 16:05                3717
compersisthelper.savetofile.php                    24-May-2024 16:05                6632
compersisthelper.savetostream.php                  24-May-2024 16:05                3743
componere-abstract-definition.addinterface.php     24-May-2024 16:04                3280
componere-abstract-definition.addmethod.php        24-May-2024 16:04                4006
componere-abstract-definition.addtrait.php         24-May-2024 16:04                3232
componere-abstract-definition.getreflector.php     24-May-2024 16:04                2409
componere-definition.addconstant.php               24-May-2024 16:04                4329
componere-definition.addproperty.php               24-May-2024 16:04                3738
componere-definition.construct.php                 24-May-2024 16:04                5975
componere-definition.getclosure.php                24-May-2024 16:04                3444
componere-definition.getclosures.php               24-May-2024 16:04                2691
componere-definition.isregistered.php              24-May-2024 16:04                2291
componere-definition.register.php                  24-May-2024 16:04                2444
componere-method.construct.php                     24-May-2024 16:04                2232
componere-method.getreflector.php                  24-May-2024 16:04                2212
componere-method.setprivate.php                    24-May-2024 16:04                2440
componere-method.setprotected.php                  24-May-2024 16:04                2455
componere-method.setstatic.php                     24-May-2024 16:04                2037
componere-patch.apply.php                          24-May-2024 16:04                1902
componere-patch.construct.php                      24-May-2024 16:04                3644
componere-patch.derive.php                         24-May-2024 16:04                3137
componere-patch.getclosure.php                     24-May-2024 16:04                3074
componere-patch.getclosures.php                    24-May-2024 16:04                2212
componere-patch.isapplied.php                      24-May-2024 16:04                1856
componere-patch.revert.php                         24-May-2024 16:04                1899
componere-value.construct.php                      24-May-2024 16:04                2665
componere-value.hasdefault.php                     24-May-2024 16:04                1900
componere-value.isprivate.php                      24-May-2024 16:04                1921
componere-value.isprotected.php                    24-May-2024 16:04                1931
componere-value.isstatic.php                       24-May-2024 16:04                1915
componere-value.setprivate.php                     24-May-2024 16:04                2463
componere-value.setprotected.php                   24-May-2024 16:04                2477
componere-value.setstatic.php                      24-May-2024 16:04                2054
componere.cast.php                                 24-May-2024 16:04                4895
componere.cast_by_ref.php                          24-May-2024 16:04                5071
componere.installation.php                         24-May-2024 16:04                1389
componere.requirements.php                         24-May-2024 16:04                1219
componere.setup.php                                24-May-2024 16:04                1501
configuration.changes.modes.php                    24-May-2024 16:04                4273
configuration.changes.php                          24-May-2024 16:04                9924
configuration.file.per-user.php                    24-May-2024 16:04                3488
configuration.file.php                             24-May-2024 16:04               11635
configuration.php                                  24-May-2024 16:04                1665
configure.about.php                                24-May-2024 16:05               14114
configure.php                                      24-May-2024 16:05                1495
context.ftp.php                                    24-May-2024 16:04                4761
context.http.php                                   24-May-2024 16:04               16955
context.params.php                                 24-May-2024 16:04                2686
context.phar.php                                   24-May-2024 16:04                2968
context.php                                        24-May-2024 16:04                3376
context.socket.php                                 24-May-2024 16:04               10201
context.ssl.php                                    24-May-2024 16:04               13743
context.zip.php                                    24-May-2024 16:04                4421
context.zlib.php                                   24-May-2024 16:04                2630
control-structures.alternative-syntax.php          24-May-2024 16:04                7046
control-structures.break.php                       24-May-2024 16:04                4722
control-structures.continue.php                    24-May-2024 16:04                8329
control-structures.declare.php                     24-May-2024 16:04               10693
control-structures.do.while.php                    24-May-2024 16:04                5193
control-structures.else.php                        24-May-2024 16:04                5119
control-structures.elseif.php                      24-May-2024 16:04                7743
control-structures.for.php                         24-May-2024 16:04               12212
control-structures.foreach.php                     24-May-2024 16:04               21262
control-structures.goto.php                        24-May-2024 16:04                7385
control-structures.if.php                          24-May-2024 16:04                4902
control-structures.intro.php                       24-May-2024 16:04                2553
control-structures.match.php                       24-May-2024 16:04               18034
control-structures.switch.php                      24-May-2024 16:04               19429
control-structures.while.php                       24-May-2024 16:04                4640
copyright.php                                      24-May-2024 16:04                2439
countable.count.php                                24-May-2024 16:05                5510
ctype.configuration.php                            24-May-2024 16:05                1236
ctype.constants.php                                24-May-2024 16:05                1174
ctype.installation.php                             24-May-2024 16:05                1688
ctype.requirements.php                             24-May-2024 16:05                1244
ctype.resources.php                                24-May-2024 16:05                1211
ctype.setup.php                                    24-May-2024 16:05                1589
cubrid.configuration.php                           24-May-2024 16:04                1229
cubrid.constants.php                               24-May-2024 16:04               13867
cubrid.examples.php                                24-May-2024 16:04               13830
cubrid.installation.php                            24-May-2024 16:04                2250
cubrid.requirements.php                            24-May-2024 16:04                1295
cubrid.resources.php                               24-May-2024 16:04                3109
cubrid.setup.php                                   24-May-2024 16:04                1602
cubridmysql.cubrid.php                             24-May-2024 16:04                4933
curl.configuration.php                             24-May-2024 16:05                2590
curl.constants.php                                 24-May-2024 16:05              202093
curl.examples-basic.php                            24-May-2024 16:05                4659
curl.examples.php                                  24-May-2024 16:05                1403
curl.installation.php                              24-May-2024 16:05                2870
curl.requirements.php                              24-May-2024 16:05                1527
curl.resources.php                                 24-May-2024 16:05                1387
curl.setup.php                                     24-May-2024 16:05                1598
curlfile.construct.php                             24-May-2024 16:05               21547
curlfile.getfilename.php                           24-May-2024 16:05                2207
curlfile.getmimetype.php                           24-May-2024 16:05                2211
curlfile.getpostfilename.php                       24-May-2024 16:05                2267
curlfile.setmimetype.php                           24-May-2024 16:05                2474
curlfile.setpostfilename.php                       24-May-2024 16:05                2519
curlstringfile.construct.php                       24-May-2024 16:05                7173
dateinterval.construct.php                         24-May-2024 16:04               14025
dateinterval.createfromdatestring.php              24-May-2024 16:04               15882
dateinterval.format.php                            24-May-2024 16:04               14790
dateperiod.construct.php                           24-May-2024 16:04               20464
dateperiod.createfromiso8601string.php             24-May-2024 16:04                8397
dateperiod.getdateinterval.php                     24-May-2024 16:04                4812
dateperiod.getenddate.php                          24-May-2024 16:04                7632
dateperiod.getrecurrences.php                      24-May-2024 16:04                8969
dateperiod.getstartdate.php                        24-May-2024 16:04                5314
datetime.add.php                                   24-May-2024 16:04                5018
datetime.configuration.php                         24-May-2024 16:04                6619
datetime.constants.php                             24-May-2024 16:04                2919
datetime.construct.php                             24-May-2024 16:04                6650
datetime.createfromformat.php                      24-May-2024 16:04                7691
datetime.createfromimmutable.php                   24-May-2024 16:04                5126
datetime.createfrominterface.php                   24-May-2024 16:04                4988
datetime.diff.php                                  24-May-2024 16:04               17382
datetime.error.tree.php                            24-May-2024 16:04                3366
datetime.examples-arithmetic.php                   24-May-2024 16:04               15550
datetime.examples.php                              24-May-2024 16:04                1441
datetime.format.php                                24-May-2024 16:04               27842
datetime.formats.php                               24-May-2024 16:04               59257
datetime.getlasterrors.php                         24-May-2024 16:04                1916
datetime.getoffset.php                             24-May-2024 16:04                7928
datetime.gettimestamp.php                          24-May-2024 16:04               10427
datetime.gettimezone.php                           24-May-2024 16:04                7869
datetime.installation.php                          24-May-2024 16:04                1708
datetime.modify.php                                24-May-2024 16:04               14559
datetime.requirements.php                          24-May-2024 16:04                1231
datetime.resources.php                             24-May-2024 16:04                1232
datetime.set-state.php                             24-May-2024 16:04                2953
datetime.setdate.php                               24-May-2024 16:04                5726
datetime.setisodate.php                            24-May-2024 16:04                5876
datetime.settime.php                               24-May-2024 16:04                7353
datetime.settimestamp.php                          24-May-2024 16:04                5142
datetime.settimezone.php                           24-May-2024 16:04                9507
datetime.setup.php                                 24-May-2024 16:04                1654
datetime.sub.php                                   24-May-2024 16:04                6453
datetime.wakeup.php                                24-May-2024 16:04                3090
datetimeimmutable.add.php                          24-May-2024 16:04               10546
datetimeimmutable.construct.php                    24-May-2024 16:04               18977
datetimeimmutable.createfromformat.php             24-May-2024 16:04               49897
datetimeimmutable.createfrominterface.php          24-May-2024 16:04                5242
datetimeimmutable.createfrommutable.php            24-May-2024 16:04                5282
datetimeimmutable.getlasterrors.php                24-May-2024 16:04                5837
datetimeimmutable.modify.php                       24-May-2024 16:04                9541
datetimeimmutable.set-state.php                    24-May-2024 16:04                2833
datetimeimmutable.setdate.php                      24-May-2024 16:04                9313
datetimeimmutable.setisodate.php                   24-May-2024 16:04               12852
datetimeimmutable.settime.php                      24-May-2024 16:04               12206
datetimeimmutable.settimestamp.php                 24-May-2024 16:04                5739
datetimeimmutable.settimezone.php                  24-May-2024 16:04                6176
datetimeimmutable.sub.php                          24-May-2024 16:04               12182
datetimezone.construct.php                         24-May-2024 16:04               11209
datetimezone.getlocation.php                       24-May-2024 16:04                5919
datetimezone.getname.php                           24-May-2024 16:04                3856
datetimezone.getoffset.php                         24-May-2024 16:04                7367
datetimezone.gettransitions.php                    24-May-2024 16:04               12437
datetimezone.listabbreviations.php                 24-May-2024 16:04                6373
datetimezone.listidentifiers.php                   24-May-2024 16:04               14932
dba.configuration.php                              24-May-2024 16:04                2326
dba.constants.php                                  24-May-2024 16:04                2303
dba.example.php                                    24-May-2024 16:04                6496
dba.examples.php                                   24-May-2024 16:04                1348
dba.installation.php                               24-May-2024 16:04               10933
dba.requirements.php                               24-May-2024 16:04                8213
dba.resources.php                                  24-May-2024 16:04                1564
dba.setup.php                                      24-May-2024 16:04                1584
dbase.configuration.php                            24-May-2024 16:04                1236
dbase.constants.php                                24-May-2024 16:04                3714
dbase.installation.php                             24-May-2024 16:04                1698
dbase.requirements.php                             24-May-2024 16:04                1210
dbase.resources.php                                24-May-2024 16:04                1485
dbase.setup.php                                    24-May-2024 16:04                1606
debugger-about.php                                 24-May-2024 16:05                1685
debugger.php                                       24-May-2024 16:05                1437
dio.configuration.php                              24-May-2024 16:04                1222
dio.constants.php                                  24-May-2024 16:04               11093
dio.installation.php                               24-May-2024 16:04                2161
dio.requirements.php                               24-May-2024 16:04                1196
dio.resources.php                                  24-May-2024 16:04                1403
dio.setup.php                                      24-May-2024 16:04                1594
dir.configuration.php                              24-May-2024 16:04                1222
dir.constants.php                                  24-May-2024 16:04                2854
dir.installation.php                               24-May-2024 16:04                1256
dir.requirements.php                               24-May-2024 16:04                1196
dir.resources.php                                  24-May-2024 16:04                1197
dir.setup.php                                      24-May-2024 16:04                1593
directory.close.php                                24-May-2024 16:04                2319
directory.read.php                                 24-May-2024 16:04                2455
directory.rewind.php                               24-May-2024 16:04                2330
directoryiterator.construct.php                    24-May-2024 16:05                6006
directoryiterator.current.php                      24-May-2024 16:05                6216
directoryiterator.getbasename.php                  24-May-2024 16:05                6532
directoryiterator.getextension.php                 24-May-2024 16:05                6095
directoryiterator.getfilename.php                  24-May-2024 16:05                5232
directoryiterator.isdot.php                        24-May-2024 16:05                5529
directoryiterator.key.php                          24-May-2024 16:05                6666
directoryiterator.next.php                         24-May-2024 16:05                5525
directoryiterator.rewind.php                       24-May-2024 16:05                5420
directoryiterator.seek.php                         24-May-2024 16:05                5362
directoryiterator.tostring.php                     24-May-2024 16:05                4757
directoryiterator.valid.php                        24-May-2024 16:05                5926
doc.changelog.php                                  24-May-2024 16:05                1323
dom.configuration.php                              24-May-2024 16:05                1222
dom.constants.php                                  24-May-2024 16:05               20329
dom.examples.php                                   24-May-2024 16:05                3007
dom.installation.php                               24-May-2024 16:05                1401
dom.requirements.php                               24-May-2024 16:05                1670
dom.resources.php                                  24-May-2024 16:05                1197
dom.setup.php                                      24-May-2024 16:05                1573
domattr.construct.php                              24-May-2024 16:05                5806
domattr.isid.php                                   24-May-2024 16:05                5197
domcdatasection.construct.php                      24-May-2024 16:05                5303
domcharacterdata.after.php                         24-May-2024 16:05                8242
domcharacterdata.appenddata.php                    24-May-2024 16:05                4498
domcharacterdata.before.php                        24-May-2024 16:05                7694
domcharacterdata.deletedata.php                    24-May-2024 16:05                5262
domcharacterdata.insertdata.php                    24-May-2024 16:05                4957
domcharacterdata.remove.php                        24-May-2024 16:05                5483
domcharacterdata.replacedata.php                   24-May-2024 16:05                5616
domcharacterdata.replacewith.php                   24-May-2024 16:05                8155
domcharacterdata.substringdata.php                 24-May-2024 16:05                5111
domchildnode.after.php                             24-May-2024 16:05                6173
domchildnode.before.php                            24-May-2024 16:05                5412
domchildnode.remove.php                            24-May-2024 16:05                3196
domchildnode.replacewith.php                       24-May-2024 16:05                5602
domcomment.construct.php                           24-May-2024 16:05                5197
domdocument.adoptnode.php                          24-May-2024 16:05                6830
domdocument.append.php                             24-May-2024 16:05                7181
domdocument.construct.php                          24-May-2024 16:05                4472
domdocument.createattribute.php                    24-May-2024 16:05                6157
domdocument.createattributens.php                  24-May-2024 16:05                8903
domdocument.createcdatasection.php                 24-May-2024 16:05                5745
domdocument.createcomment.php                      24-May-2024 16:05                6205
domdocument.createdocumentfragment.php             24-May-2024 16:05                6057
domdocument.createelement.php                      24-May-2024 16:05               11875
domdocument.createelementns.php                    24-May-2024 16:05               14425
domdocument.createentityreference.php              24-May-2024 16:05                6509
domdocument.createprocessinginstruction.php        24-May-2024 16:05                6771
domdocument.createtextnode.php                     24-May-2024 16:05                6196
domdocument.getelementbyid.php                     24-May-2024 16:05                7808
domdocument.getelementsbytagname.php               24-May-2024 16:05                6172
domdocument.getelementsbytagnamens.php             24-May-2024 16:05                7887
domdocument.importnode.php                         24-May-2024 16:05                9330
domdocument.load.php                               24-May-2024 16:05                6973
domdocument.loadhtml.php                           24-May-2024 16:05                8139
domdocument.loadhtmlfile.php                       24-May-2024 16:05                8337
domdocument.loadxml.php                            24-May-2024 16:05                6590
domdocument.normalizedocument.php                  24-May-2024 16:05                3089
domdocument.prepend.php                            24-May-2024 16:05                7244
domdocument.registernodeclass.php                  24-May-2024 16:05               21375
domdocument.relaxngvalidate.php                    24-May-2024 16:05                4137
domdocument.relaxngvalidatesource.php              24-May-2024 16:05                4186
domdocument.replacechildren.php                    24-May-2024 16:05                7483
domdocument.save.php                               24-May-2024 16:05                7787
domdocument.savehtml.php                           24-May-2024 16:05                7664
domdocument.savehtmlfile.php                       24-May-2024 16:05                8128
domdocument.savexml.php                            24-May-2024 16:05               10101
domdocument.schemavalidate.php                     24-May-2024 16:05                4584
domdocument.schemavalidatesource.php               24-May-2024 16:05                4648
domdocument.validate.php                           24-May-2024 16:05                6272
domdocument.xinclude.php                           24-May-2024 16:05                7375
domdocumentfragment.append.php                     24-May-2024 16:05                7843
domdocumentfragment.appendxml.php                  24-May-2024 16:05                5691
domdocumentfragment.construct.php                  24-May-2024 16:05                2183
domdocumentfragment.prepend.php                    24-May-2024 16:05                7923
domdocumentfragment.replacechildren.php            24-May-2024 16:05                8206
domelement.after.php                               24-May-2024 16:05                7904
domelement.append.php                              24-May-2024 16:05                7457
domelement.before.php                              24-May-2024 16:05                7310
domelement.construct.php                           24-May-2024 16:05                6933
domelement.getattribute.php                        24-May-2024 16:05                3603
domelement.getattributenames.php                   24-May-2024 16:05                4018
domelement.getattributenode.php                    24-May-2024 16:05                4180
domelement.getattributenodens.php                  24-May-2024 16:05                4695
domelement.getattributens.php                      24-May-2024 16:05                4173
domelement.getelementsbytagname.php                24-May-2024 16:05                3782
domelement.getelementsbytagnamens.php              24-May-2024 16:05                4904
domelement.hasattribute.php                        24-May-2024 16:05                3907
domelement.hasattributens.php                      24-May-2024 16:05                4390
domelement.insertadjacentelement.php               24-May-2024 16:05                6768
domelement.insertadjacenttext.php                  24-May-2024 16:05                6556
domelement.prepend.php                             24-May-2024 16:05                7520
domelement.remove.php                              24-May-2024 16:05                5099
domelement.removeattribute.php                     24-May-2024 16:05                4127
domelement.removeattributenode.php                 24-May-2024 16:05                4492
domelement.removeattributens.php                   24-May-2024 16:05                4420
domelement.replacechildren.php                     24-May-2024 16:05                8031
domelement.replacewith.php                         24-May-2024 16:05                8117
domelement.setattribute.php                        24-May-2024 16:05                6320
domelement.setattributenode.php                    24-May-2024 16:05                4909
domelement.setattributenodens.php                  24-May-2024 16:05                4984
domelement.setattributens.php                      24-May-2024 16:05                5381
domelement.setidattribute.php                      24-May-2024 16:05                4816
domelement.setidattributenode.php                  24-May-2024 16:05                4798
domelement.setidattributens.php                    24-May-2024 16:05                5261
domelement.toggleattribute.php                     24-May-2024 16:05                6567
domentityreference.construct.php                   24-May-2024 16:05                4911
domimplementation.construct.php                    24-May-2024 16:05                2230
domimplementation.createdocument.php               24-May-2024 16:05                7753
domimplementation.createdocumenttype.php           24-May-2024 16:05               10267
domimplementation.hasfeature.php                   24-May-2024 16:05                9575
domnamednodemap.count.php                          24-May-2024 16:05                2513
domnamednodemap.getiterator.php                    24-May-2024 16:05                3331
domnamednodemap.getnameditem.php                   24-May-2024 16:05                3541
domnamednodemap.getnameditemns.php                 24-May-2024 16:05                4048
domnamednodemap.item.php                           24-May-2024 16:05                3167
domnode.appendchild.php                            24-May-2024 16:05                9075
domnode.c14n.php                                   24-May-2024 16:05                8206
domnode.c14nfile.php                               24-May-2024 16:05                5949
domnode.clonenode.php                              24-May-2024 16:05                2942
domnode.contains.php                               24-May-2024 16:05                5482
domnode.getlineno.php                              24-May-2024 16:05                5025
domnode.getnodepath.php                            24-May-2024 16:05                5237
domnode.getrootnode.php                            24-May-2024 16:05                4496
domnode.hasattributes.php                          24-May-2024 16:05                3141
domnode.haschildnodes.php                          24-May-2024 16:05                2967
domnode.insertbefore.php                           24-May-2024 16:05                5795
domnode.isdefaultnamespace.php                     24-May-2024 16:05                3028
domnode.isequalnode.php                            24-May-2024 16:05                4765
domnode.issamenode.php                             24-May-2024 16:05                2894
domnode.issupported.php                            24-May-2024 16:05                3961
domnode.lookupnamespaceuri.php                     24-May-2024 16:05                3784
domnode.lookupprefix.php                           24-May-2024 16:05                3373
domnode.normalize.php                              24-May-2024 16:05                2894
domnode.removechild.php                            24-May-2024 16:05                7144
domnode.replacechild.php                           24-May-2024 16:05                6092
domnodelist.count.php                              24-May-2024 16:05                2443
domnodelist.getiterator.php                        24-May-2024 16:05                3221
domnodelist.item.php                               24-May-2024 16:05                7191
domparentnode.append.php                           24-May-2024 16:05                5072
domparentnode.prepend.php                          24-May-2024 16:05                5127
domparentnode.replacechildren.php                  24-May-2024 16:05                6869
domprocessinginstruction.construct.php             24-May-2024 16:05                6891
domtext.construct.php                              24-May-2024 16:05                4888
domtext.iselementcontentwhitespace.php             24-May-2024 16:05                2722
domtext.iswhitespaceinelementcontent.php           24-May-2024 16:05                2980
domtext.splittext.php                              24-May-2024 16:05                3489
domxpath.construct.php                             24-May-2024 16:05                3679
domxpath.evaluate.php                              24-May-2024 16:05                8199
domxpath.query.php                                 24-May-2024 16:05               12658
domxpath.registernamespace.php                     24-May-2024 16:05                3371
domxpath.registerphpfunctions.php                  24-May-2024 16:05               13804
dotnet.construct.php                               24-May-2024 16:05                3262
ds-collection.clear.php                            24-May-2024 16:05                3940
ds-collection.copy.php                             24-May-2024 16:05                4347
ds-collection.isempty.php                          24-May-2024 16:05                4275
ds-collection.toarray.php                          24-May-2024 16:05                4266
ds-deque.allocate.php                              24-May-2024 16:05                4677
ds-deque.apply.php                                 24-May-2024 16:05                4973
ds-deque.capacity.php                              24-May-2024 16:05                3974
ds-deque.clear.php                                 24-May-2024 16:05                3857
ds-deque.construct.php                             24-May-2024 16:05                4330
ds-deque.contains.php                              24-May-2024 16:05                7093
ds-deque.copy.php                                  24-May-2024 16:05                4213
ds-deque.count.php                                 24-May-2024 16:05                1620
ds-deque.filter.php                                24-May-2024 16:05                7632
ds-deque.find.php                                  24-May-2024 16:05                5432
ds-deque.first.php                                 24-May-2024 16:05                3784
ds-deque.get.php                                   24-May-2024 16:05                6608
ds-deque.insert.php                                24-May-2024 16:05                6673
ds-deque.isempty.php                               24-May-2024 16:05                4161
ds-deque.join.php                                  24-May-2024 16:05                5757
ds-deque.jsonserialize.php                         24-May-2024 16:05                1876
ds-deque.last.php                                  24-May-2024 16:05                3772
ds-deque.map.php                                   24-May-2024 16:05                5328
ds-deque.merge.php                                 24-May-2024 16:05                4878
ds-deque.pop.php                                   24-May-2024 16:05                4269
ds-deque.push.php                                  24-May-2024 16:05                4677
ds-deque.reduce.php                                24-May-2024 16:05                8003
ds-deque.remove.php                                24-May-2024 16:05                4875
ds-deque.reverse.php                               24-May-2024 16:05                3693
ds-deque.reversed.php                              24-May-2024 16:05                4040
ds-deque.rotate.php                                24-May-2024 16:05                5063
ds-deque.set.php                                   24-May-2024 16:05                6081
ds-deque.shift.php                                 24-May-2024 16:05                4370
ds-deque.slice.php                                 24-May-2024 16:05                7154
ds-deque.sort.php                                  24-May-2024 16:05                7530
ds-deque.sorted.php                                24-May-2024 16:05                7551
ds-deque.sum.php                                   24-May-2024 16:05                5299
ds-deque.toarray.php                               24-May-2024 16:05                4152
ds-deque.unshift.php                               24-May-2024 16:05                4758
ds-hashable.equals.php                             24-May-2024 16:05                3698
ds-hashable.hash.php                               24-May-2024 16:05                7468
ds-map.allocate.php                                24-May-2024 16:05                4543
ds-map.apply.php                                   24-May-2024 16:05                5669
ds-map.capacity.php                                24-May-2024 16:05                3264
ds-map.clear.php                                   24-May-2024 16:05                4333
ds-map.construct.php                               24-May-2024 16:05                4832
ds-map.copy.php                                    24-May-2024 16:05                4073
ds-map.count.php                                   24-May-2024 16:05                1581
ds-map.diff.php                                    24-May-2024 16:05                5450
ds-map.filter.php                                  24-May-2024 16:05                8416
ds-map.first.php                                   24-May-2024 16:05                4083
ds-map.get.php                                     24-May-2024 16:05                8432
ds-map.haskey.php                                  24-May-2024 16:05                4689
ds-map.hasvalue.php                                24-May-2024 16:05                4733
ds-map.intersect.php                               24-May-2024 16:05                5973
ds-map.isempty.php                                 24-May-2024 16:05                4383
ds-map.jsonserialize.php                           24-May-2024 16:05                1854
ds-map.keys.php                                    24-May-2024 16:05                3974
ds-map.ksort.php                                   24-May-2024 16:05                8217
ds-map.ksorted.php                                 24-May-2024 16:05                8300
ds-map.last.php                                    24-May-2024 16:05                4068
ds-map.map.php                                     24-May-2024 16:05                6309
ds-map.merge.php                                   24-May-2024 16:05                5860
ds-map.pairs.php                                   24-May-2024 16:05                4389
ds-map.put.php                                     24-May-2024 16:05               13957
ds-map.putall.php                                  24-May-2024 16:05                5544
ds-map.reduce.php                                  24-May-2024 16:05                8938
ds-map.remove.php                                  24-May-2024 16:05                6974
ds-map.reverse.php                                 24-May-2024 16:05                4145
ds-map.reversed.php                                24-May-2024 16:05                4250
ds-map.skip.php                                    24-May-2024 16:05                4625
ds-map.slice.php                                   24-May-2024 16:05                8006
ds-map.sort.php                                    24-May-2024 16:05                8140
ds-map.sorted.php                                  24-May-2024 16:05                8279
ds-map.sum.php                                     24-May-2024 16:05                5766
ds-map.toarray.php                                 24-May-2024 16:05                5147
ds-map.union.php                                   24-May-2024 16:05                5957
ds-map.values.php                                  24-May-2024 16:05                3973
ds-map.xor.php                                     24-May-2024 16:05                5516
ds-pair.clear.php                                  24-May-2024 16:05                3762
ds-pair.construct.php                              24-May-2024 16:05                2603
ds-pair.copy.php                                   24-May-2024 16:05                4127
ds-pair.isempty.php                                24-May-2024 16:05                4111
ds-pair.jsonserialize.php                          24-May-2024 16:05                1874
ds-pair.toarray.php                                24-May-2024 16:05                4086
ds-priorityqueue.allocate.php                      24-May-2024 16:05                4843
ds-priorityqueue.capacity.php                      24-May-2024 16:05                3473
ds-priorityqueue.clear.php                         24-May-2024 16:05                4514
ds-priorityqueue.construct.php                     24-May-2024 16:05                2933
ds-priorityqueue.copy.php                          24-May-2024 16:05                4516
ds-priorityqueue.count.php                         24-May-2024 16:05                1729
ds-priorityqueue.isempty.php                       24-May-2024 16:05                5071
ds-priorityqueue.jsonserialize.php                 24-May-2024 16:05                1994
ds-priorityqueue.peek.php                          24-May-2024 16:05                4762
ds-priorityqueue.pop.php                           24-May-2024 16:05                5534
ds-priorityqueue.push.php                          24-May-2024 16:05                5603
ds-priorityqueue.toarray.php                       24-May-2024 16:05                5253
ds-queue.allocate.php                              24-May-2024 16:05                4872
ds-queue.capacity.php                              24-May-2024 16:05                3980
ds-queue.clear.php                                 24-May-2024 16:05                3842
ds-queue.construct.php                             24-May-2024 16:05                4328
ds-queue.copy.php                                  24-May-2024 16:05                4315
ds-queue.count.php                                 24-May-2024 16:05                1617
ds-queue.isempty.php                               24-May-2024 16:05                4177
ds-queue.jsonserialize.php                         24-May-2024 16:05                1882
ds-queue.peek.php                                  24-May-2024 16:05                4366
ds-queue.pop.php                                   24-May-2024 16:05                4900
ds-queue.push.php                                  24-May-2024 16:05                4712
ds-queue.toarray.php                               24-May-2024 16:05                4318
ds-sequence.allocate.php                           24-May-2024 16:05                4579
ds-sequence.apply.php                              24-May-2024 16:05                5088
ds-sequence.capacity.php                           24-May-2024 16:05                4529
ds-sequence.contains.php                           24-May-2024 16:05                7220
ds-sequence.filter.php                             24-May-2024 16:05                7771
ds-sequence.find.php                               24-May-2024 16:05                5544
ds-sequence.first.php                              24-May-2024 16:05                3899
ds-sequence.get.php                                24-May-2024 16:05                6736
ds-sequence.insert.php                             24-May-2024 16:05                6792
ds-sequence.join.php                               24-May-2024 16:05                5853
ds-sequence.last.php                               24-May-2024 16:05                3866
ds-sequence.map.php                                24-May-2024 16:05                5457
ds-sequence.merge.php                              24-May-2024 16:05                5004
ds-sequence.pop.php                                24-May-2024 16:05                4381
ds-sequence.push.php                               24-May-2024 16:05                4799
ds-sequence.reduce.php                             24-May-2024 16:05                8122
ds-sequence.remove.php                             24-May-2024 16:05                4987
ds-sequence.reverse.php                            24-May-2024 16:05                3806
ds-sequence.reversed.php                           24-May-2024 16:05                4163
ds-sequence.rotate.php                             24-May-2024 16:05                5200
ds-sequence.set.php                                24-May-2024 16:05                6205
ds-sequence.shift.php                              24-May-2024 16:05                4482
ds-sequence.slice.php                              24-May-2024 16:05                7319
ds-sequence.sort.php                               24-May-2024 16:05                7657
ds-sequence.sorted.php                             24-May-2024 16:05                7678
ds-sequence.sum.php                                24-May-2024 16:05                5424
ds-sequence.unshift.php                            24-May-2024 16:05                4869
ds-set.add.php                                     24-May-2024 16:05               12188
ds-set.allocate.php                                24-May-2024 16:05                4552
ds-set.capacity.php                                24-May-2024 16:05                3932
ds-set.clear.php                                   24-May-2024 16:05                3788
ds-set.construct.php                               24-May-2024 16:05                4282
ds-set.contains.php                                24-May-2024 16:05                7287
ds-set.copy.php                                    24-May-2024 16:05                4254
ds-set.count.php                                   24-May-2024 16:05                1581
ds-set.diff.php                                    24-May-2024 16:05                4740
ds-set.filter.php                                  24-May-2024 16:05                7580
ds-set.first.php                                   24-May-2024 16:05                3737
ds-set.get.php                                     24-May-2024 16:05                6552
ds-set.intersect.php                               24-May-2024 16:05                4971
ds-set.isempty.php                                 24-May-2024 16:05                4119
ds-set.join.php                                    24-May-2024 16:05                5703
ds-set.jsonserialize.php                           24-May-2024 16:05                1848
ds-set.last.php                                    24-May-2024 16:05                3738
ds-set.merge.php                                   24-May-2024 16:05                4804
ds-set.reduce.php                                  24-May-2024 16:05                7949
ds-set.remove.php                                  24-May-2024 16:05                4983
ds-set.reverse.php                                 24-May-2024 16:05                3641
ds-set.reversed.php                                24-May-2024 16:05                3978
ds-set.slice.php                                   24-May-2024 16:05                7068
ds-set.sort.php                                    24-May-2024 16:05                7466
ds-set.sorted.php                                  24-May-2024 16:05                7487
ds-set.sum.php                                     24-May-2024 16:05                5239
ds-set.toarray.php                                 24-May-2024 16:05                4098
ds-set.union.php                                   24-May-2024 16:05                4934
ds-set.xor.php                                     24-May-2024 16:05                4910
ds-stack.allocate.php                              24-May-2024 16:05                2855
ds-stack.capacity.php                              24-May-2024 16:05                2207
ds-stack.clear.php                                 24-May-2024 16:05                3838
ds-stack.construct.php                             24-May-2024 16:05                4294
ds-stack.copy.php                                  24-May-2024 16:05                4315
ds-stack.count.php                                 24-May-2024 16:05                1617
ds-stack.isempty.php                               24-May-2024 16:05                4177
ds-stack.jsonserialize.php                         24-May-2024 16:05                1882
ds-stack.peek.php                                  24-May-2024 16:05                4360
ds-stack.pop.php                                   24-May-2024 16:05                4894
ds-stack.push.php                                  24-May-2024 16:05                4712
ds-stack.toarray.php                               24-May-2024 16:05                4143
ds-vector.allocate.php                             24-May-2024 16:05                4496
ds-vector.apply.php                                24-May-2024 16:05                4999
ds-vector.capacity.php                             24-May-2024 16:05                4434
ds-vector.clear.php                                24-May-2024 16:05                3869
ds-vector.construct.php                            24-May-2024 16:05                4362
ds-vector.contains.php                             24-May-2024 16:05                7123
ds-vector.copy.php                                 24-May-2024 16:05                4339
ds-vector.count.php                                24-May-2024 16:05                1634
ds-vector.filter.php                               24-May-2024 16:05                7666
ds-vector.find.php                                 24-May-2024 16:05                5457
ds-vector.first.php                                24-May-2024 16:05                3810
ds-vector.get.php                                  24-May-2024 16:05                6639
ds-vector.insert.php                               24-May-2024 16:05                6703
ds-vector.isempty.php                              24-May-2024 16:05                4185
ds-vector.join.php                                 24-May-2024 16:05                5784
ds-vector.jsonserialize.php                        24-May-2024 16:05                1890
ds-vector.last.php                                 24-May-2024 16:05                3797
ds-vector.map.php                                  24-May-2024 16:05                5360
ds-vector.merge.php                                24-May-2024 16:05                4909
ds-vector.pop.php                                  24-May-2024 16:05                4294
ds-vector.push.php                                 24-May-2024 16:05                4706
ds-vector.reduce.php                               24-May-2024 16:05                8031
ds-vector.remove.php                               24-May-2024 16:05                4900
ds-vector.reverse.php                              24-May-2024 16:05                3719
ds-vector.reversed.php                             24-May-2024 16:05                4070
ds-vector.rotate.php                               24-May-2024 16:05                5097
ds-vector.set.php                                  24-May-2024 16:05                6112
ds-vector.shift.php                                24-May-2024 16:05                4395
ds-vector.slice.php                                24-May-2024 16:05                7200
ds-vector.sort.php                                 24-May-2024 16:05                7562
ds-vector.sorted.php                               24-May-2024 16:05                7583
ds-vector.sum.php                                  24-May-2024 16:05                5329
ds-vector.toarray.php                              24-May-2024 16:05                4177
ds-vector.unshift.php                              24-May-2024 16:05                4788
ds.constants.php                                   24-May-2024 16:05                1171
ds.examples.php                                    24-May-2024 16:05                4740
ds.installation.php                                24-May-2024 16:05                2542
ds.requirements.php                                24-May-2024 16:05                1220
ds.setup.php                                       24-May-2024 16:05                1438
eio.configuration.php                              24-May-2024 16:04                1220
eio.constants.php                                  24-May-2024 16:04               22125
eio.examples.php                                   24-May-2024 16:04               27771
eio.installation.php                               24-May-2024 16:04                1864
eio.requirements.php                               24-May-2024 16:04                1407
eio.resources.php                                  24-May-2024 16:04                1297
eio.setup.php                                      24-May-2024 16:04                1586
emptyiterator.current.php                          24-May-2024 16:05                2871
emptyiterator.key.php                              24-May-2024 16:05                2835
emptyiterator.next.php                             24-May-2024 16:05                2457
emptyiterator.rewind.php                           24-May-2024 16:05                2479
emptyiterator.valid.php                            24-May-2024 16:05                2781
enchant.configuration.php                          24-May-2024 16:04                1250
enchant.constants.php                              24-May-2024 16:04                3022
enchant.examples.php                               24-May-2024 16:04                5442
enchant.installation.php                           24-May-2024 16:04                3719
enchant.requirements.php                           24-May-2024 16:04                1932
enchant.resources.php                              24-May-2024 16:04                1425
enchant.setup.php                                  24-May-2024 16:04                1632
error.clone.php                                    24-May-2024 16:04                2946
error.construct.php                                24-May-2024 16:04                3525
error.getcode.php                                  24-May-2024 16:04                4110
error.getfile.php                                  24-May-2024 16:04                3828
error.getline.php                                  24-May-2024 16:04                4037
error.getmessage.php                               24-May-2024 16:04                3917
error.getprevious.php                              24-May-2024 16:04                6692
error.gettrace.php                                 24-May-2024 16:04                4408
error.gettraceasstring.php                         24-May-2024 16:04                4211
error.tostring.php                                 24-May-2024 16:04                4043
errorexception.construct.php                       24-May-2024 16:04                6302
errorexception.getseverity.php                     24-May-2024 16:04                4406
errorfunc.configuration.php                        24-May-2024 16:04               27361
errorfunc.constants.php                            24-May-2024 16:04               12096
errorfunc.examples.php                             24-May-2024 16:04               19247
errorfunc.installation.php                         24-May-2024 16:04                1298
errorfunc.requirements.php                         24-May-2024 16:04                1238
errorfunc.resources.php                            24-May-2024 16:04                1239
errorfunc.setup.php                                24-May-2024 16:04                1648
ev.backend.php                                     24-May-2024 16:04                3544
ev.configuration.php                               24-May-2024 16:04                1215
ev.depth.php                                       24-May-2024 16:04                3456
ev.embeddablebackends.php                          24-May-2024 16:04                6728
ev.examples.php                                    24-May-2024 16:04               42915
ev.feedsignal.php                                  24-May-2024 16:04                3625
ev.feedsignalevent.php                             24-May-2024 16:04                3300
ev.global.constants.php                            24-May-2024 16:04                1349
ev.installation.php                                24-May-2024 16:04                1858
ev.iteration.php                                   24-May-2024 16:04                2760
ev.now.php                                         24-May-2024 16:04                3147
ev.nowupdate.php                                   24-May-2024 16:04                3340
ev.periodic-modes.php                              24-May-2024 16:04                8514
ev.recommendedbackends.php                         24-May-2024 16:04                7726
ev.requirements.php                                24-May-2024 16:04                1331
ev.resources.php                                   24-May-2024 16:04                1197
ev.resume.php                                      24-May-2024 16:04                3916
ev.run.php                                         24-May-2024 16:04                5368
ev.setup.php                                       24-May-2024 16:04                1540
ev.sleep.php                                       24-May-2024 16:04                2451
ev.stop.php                                        24-May-2024 16:04                2971
ev.supportedbackends.php                           24-May-2024 16:04                6711
ev.suspend.php                                     24-May-2024 16:04                3625
ev.time.php                                        24-May-2024 16:04                2707
ev.verify.php                                      24-May-2024 16:04                2322
ev.watcher-callbacks.php                           24-May-2024 16:04                5119
ev.watchers.php                                    24-May-2024 16:04                3980
evcheck.construct.php                              24-May-2024 16:04                3781
evcheck.createstopped.php                          24-May-2024 16:04                3937
evchild.construct.php                              24-May-2024 16:04                7328
evchild.createstopped.php                          24-May-2024 16:04                5252
evchild.set.php                                    24-May-2024 16:04                3229
evembed.construct.php                              24-May-2024 16:04                8478
evembed.createstopped.php                          24-May-2024 16:04                4946
evembed.set.php                                    24-May-2024 16:04                2637
evembed.sweep.php                                  24-May-2024 16:04                3176
event.add.php                                      24-May-2024 16:05               10339
event.addsignal.php                                24-May-2024 16:05                1733
event.addtimer.php                                 24-May-2024 16:05                1742
event.callbacks.php                                24-May-2024 16:05                5714
event.configuration.php                            24-May-2024 16:05                1236
event.construct.php                                24-May-2024 16:05                4594
event.constructing.signal.events.php               24-May-2024 16:05                6069
event.del.php                                      24-May-2024 16:05                2683
event.delsignal.php                                24-May-2024 16:05                1733
event.deltimer.php                                 24-May-2024 16:05                1730
event.examples.php                                 24-May-2024 16:05              165036
event.flags.php                                    24-May-2024 16:05                2635
event.free.php                                     24-May-2024 16:05                3050
event.getsupportedmethods.php                      24-May-2024 16:05                2698
event.installation.php                             24-May-2024 16:05                1885
event.pending.php                                  24-May-2024 16:05                3136
event.persistence.php                              24-May-2024 16:05                2968
event.requirements.php                             24-May-2024 16:05                1493
event.resources.php                                24-May-2024 16:05                1195
event.set.php                                      24-May-2024 16:05                4734
event.setpriority.php                              24-May-2024 16:05                2650
event.settimer.php                                 24-May-2024 16:05                4157
event.setup.php                                    24-May-2024 16:05                1579
event.signal.php                                   24-May-2024 16:05                4321
event.timer.php                                    24-May-2024 16:05                3617
eventbase.construct.php                            24-May-2024 16:05                3069
eventbase.dispatch.php                             24-May-2024 16:05                3376
eventbase.exit.php                                 24-May-2024 16:05                3143
eventbase.free.php                                 24-May-2024 16:05                3405
eventbase.getfeatures.php                          24-May-2024 16:05                5790
eventbase.getmethod.php                            24-May-2024 16:05                4596
eventbase.gettimeofdaycached.php                   24-May-2024 16:05                2775
eventbase.gotexit.php                              24-May-2024 16:05                3389
eventbase.gotstop.php                              24-May-2024 16:05                3361
eventbase.loop.php                                 24-May-2024 16:05                3685
eventbase.priorityinit.php                         24-May-2024 16:05                3120
eventbase.reinit.php                               24-May-2024 16:05                2473
eventbase.stop.php                                 24-May-2024 16:05                2936
eventbuffer.add.php                                24-May-2024 16:05                3121
eventbuffer.addbuffer.php                          24-May-2024 16:05                3473
eventbuffer.appendfrom.php                         24-May-2024 16:05                4950
eventbuffer.construct.php                          24-May-2024 16:05                2018
eventbuffer.copyout.php                            24-May-2024 16:05                3995
eventbuffer.drain.php                              24-May-2024 16:05                3596
eventbuffer.enablelocking.php                      24-May-2024 16:05                2933
eventbuffer.expand.php                             24-May-2024 16:05                2923
eventbuffer.freeze.php                             24-May-2024 16:05                3169
eventbuffer.lock.php                               24-May-2024 16:05                3058
eventbuffer.prepend.php                            24-May-2024 16:05                3596
eventbuffer.prependbuffer.php                      24-May-2024 16:05                3758
eventbuffer.pullup.php                             24-May-2024 16:05                4702
eventbuffer.read.php                               24-May-2024 16:05                4975
eventbuffer.readfrom.php                           24-May-2024 16:05                4408
eventbuffer.readline.php                           24-May-2024 16:05                4329
eventbuffer.search.php                             24-May-2024 16:05                8475
eventbuffer.searcheol.php                          24-May-2024 16:05                5009
eventbuffer.substr.php                             24-May-2024 16:05                3615
eventbuffer.unfreeze.php                           24-May-2024 16:05                3183
eventbuffer.unlock.php                             24-May-2024 16:05                2911
eventbuffer.write.php                              24-May-2024 16:05                3521
eventbufferevent.about.callbacks.php               24-May-2024 16:05                6179
eventbufferevent.close.php                         24-May-2024 16:05                2628
eventbufferevent.connect.php                       24-May-2024 16:05               23987
eventbufferevent.connecthost.php                   24-May-2024 16:05               17870
eventbufferevent.construct.php                     24-May-2024 16:05                6916
eventbufferevent.createpair.php                    24-May-2024 16:05                4372
eventbufferevent.disable.php                       24-May-2024 16:05                3624
eventbufferevent.enable.php                        24-May-2024 16:05                4094
eventbufferevent.free.php                          24-May-2024 16:05                2849
eventbufferevent.getdnserrorstring.php             24-May-2024 16:05                3168
eventbufferevent.getenabled.php                    24-May-2024 16:05                3117
eventbufferevent.getinput.php                      24-May-2024 16:05                5048
eventbufferevent.getoutput.php                     24-May-2024 16:05                7929
eventbufferevent.read.php                          24-May-2024 16:05                3117
eventbufferevent.readbuffer.php                    24-May-2024 16:05                3310
eventbufferevent.setcallbacks.php                  24-May-2024 16:05                4607
eventbufferevent.setpriority.php                   24-May-2024 16:05                3032
eventbufferevent.settimeouts.php                   24-May-2024 16:05                3257
eventbufferevent.setwatermark.php                  24-May-2024 16:05                4145
eventbufferevent.sslerror.php                      24-May-2024 16:05                5932
eventbufferevent.sslfilter.php                     24-May-2024 16:05               34526
eventbufferevent.sslgetcipherinfo.php              24-May-2024 16:05                2987
eventbufferevent.sslgetciphername.php              24-May-2024 16:05                2890
eventbufferevent.sslgetcipherversion.php           24-May-2024 16:05                2919
eventbufferevent.sslgetprotocol.php                24-May-2024 16:05                2796
eventbufferevent.sslrenegotiate.php                24-May-2024 16:05                2884
eventbufferevent.sslsocket.php                     24-May-2024 16:05                5940
eventbufferevent.write.php                         24-May-2024 16:05                3306
eventbufferevent.writebuffer.php                   24-May-2024 16:05                3428
eventconfig.avoidmethod.php                        24-May-2024 16:05                4457
eventconfig.construct.php                          24-May-2024 16:05                4095
eventconfig.requirefeatures.php                    24-May-2024 16:05                6074
eventconfig.setflags.php                           24-May-2024 16:05                3423
eventconfig.setmaxdispatchinterval.php             24-May-2024 16:05                4627
eventdnsbase.addnameserverip.php                   24-May-2024 16:05                3059
eventdnsbase.addsearch.php                         24-May-2024 16:05                2603
eventdnsbase.clearsearch.php                       24-May-2024 16:05                2864
eventdnsbase.construct.php                         24-May-2024 16:05                7570
eventdnsbase.countnameservers.php                  24-May-2024 16:05                2601
eventdnsbase.loadhosts.php                         24-May-2024 16:05                2932
eventdnsbase.parseresolvconf.php                   24-May-2024 16:05                4308
eventdnsbase.setoption.php                         24-May-2024 16:05                3506
eventdnsbase.setsearchndots.php                    24-May-2024 16:05                2995
eventhttp.accept.php                               24-May-2024 16:05               12476
eventhttp.addserveralias.php                       24-May-2024 16:05                6499
eventhttp.bind.php                                 24-May-2024 16:05                7937
eventhttp.construct.php                            24-May-2024 16:05               17451
eventhttp.removeserveralias.php                    24-May-2024 16:05                3316
eventhttp.setallowedmethods.php                    24-May-2024 16:05                3442
eventhttp.setcallback.php                          24-May-2024 16:05               18136
eventhttp.setdefaultcallback.php                   24-May-2024 16:05                7917
eventhttp.setmaxbodysize.php                       24-May-2024 16:05                2951
eventhttp.setmaxheaderssize.php                    24-May-2024 16:05                2863
eventhttp.settimeout.php                           24-May-2024 16:05                2556
eventhttpconnection.construct.php                  24-May-2024 16:05                5166
eventhttpconnection.getbase.php                    24-May-2024 16:05                2676
eventhttpconnection.getpeer.php                    24-May-2024 16:05                3072
eventhttpconnection.makerequest.php                24-May-2024 16:05               11744
eventhttpconnection.setclosecallback.php           24-May-2024 16:05                9466
eventhttpconnection.setlocaladdress.php            24-May-2024 16:05                3250
eventhttpconnection.setlocalport.php               24-May-2024 16:05                3138
eventhttpconnection.setmaxbodysize.php             24-May-2024 16:05                3175
eventhttpconnection.setmaxheaderssize.php          24-May-2024 16:05                3196
eventhttpconnection.setretries.php                 24-May-2024 16:05                2786
eventhttpconnection.settimeout.php                 24-May-2024 16:05                2683
eventhttprequest.addheader.php                     24-May-2024 16:05                4038
eventhttprequest.cancel.php                        24-May-2024 16:05                2903
eventhttprequest.clearheaders.php                  24-May-2024 16:05                2849
eventhttprequest.closeconnection.php               24-May-2024 16:05                2458
eventhttprequest.construct.php                     24-May-2024 16:05               11439
eventhttprequest.findheader.php                    24-May-2024 16:05                3580
eventhttprequest.free.php                          24-May-2024 16:05                2366
eventhttprequest.getbufferevent.php                24-May-2024 16:05                3729
eventhttprequest.getcommand.php                    24-May-2024 16:05                2740
eventhttprequest.getconnection.php                 24-May-2024 16:05                4483
eventhttprequest.gethost.php                       24-May-2024 16:05                2911
eventhttprequest.getinputbuffer.php                24-May-2024 16:05                2813
eventhttprequest.getinputheaders.php               24-May-2024 16:05                2904
eventhttprequest.getoutputbuffer.php               24-May-2024 16:05                2872
eventhttprequest.getoutputheaders.php              24-May-2024 16:05                2855
eventhttprequest.getresponsecode.php               24-May-2024 16:05                3191
eventhttprequest.geturi.php                        24-May-2024 16:05                3104
eventhttprequest.removeheader.php                  24-May-2024 16:05                3540
eventhttprequest.senderror.php                     24-May-2024 16:05                5867
eventhttprequest.sendreply.php                     24-May-2024 16:05                4086
eventhttprequest.sendreplychunk.php                24-May-2024 16:05                3458
eventhttprequest.sendreplyend.php                  24-May-2024 16:05                3082
eventhttprequest.sendreplystart.php                24-May-2024 16:05                4345
eventlistener.construct.php                        24-May-2024 16:05               22445
eventlistener.disable.php                          24-May-2024 16:05                2887
eventlistener.enable.php                           24-May-2024 16:05                2873
eventlistener.getbase.php                          24-May-2024 16:05                2379
eventlistener.getsocketname.php                    24-May-2024 16:05                3427
eventlistener.setcallback.php                      24-May-2024 16:05                6064
eventlistener.seterrorcallback.php                 24-May-2024 16:05                4429
eventsslcontext.construct.php                      24-May-2024 16:05                5322
eventutil.construct.php                            24-May-2024 16:05                2212
eventutil.getlastsocketerrno.php                   24-May-2024 16:05                3329
eventutil.getlastsocketerror.php                   24-May-2024 16:05                3145
eventutil.getsocketfd.php                          24-May-2024 16:05                3253
eventutil.getsocketname.php                        24-May-2024 16:05                3830
eventutil.setsocketoption.php                      24-May-2024 16:05                5776
eventutil.sslrandpoll.php                          24-May-2024 16:05                2431
evfork.construct.php                               24-May-2024 16:04                3800
evfork.createstopped.php                           24-May-2024 16:04                4132
evidle.construct.php                               24-May-2024 16:04                3696
evidle.createstopped.php                           24-May-2024 16:04                4168
evio.construct.php                                 24-May-2024 16:04                4844
evio.createstopped.php                             24-May-2024 16:04                5174
evio.set.php                                       24-May-2024 16:04                2868
evloop.backend.php                                 24-May-2024 16:04                2762
evloop.check.php                                   24-May-2024 16:04                3341
evloop.child.php                                   24-May-2024 16:04                3823
evloop.construct.php                               24-May-2024 16:04                4063
evloop.defaultloop.php                             24-May-2024 16:04                4654
evloop.embed.php                                   24-May-2024 16:04                3856
evloop.fork.php                                    24-May-2024 16:04                3423
evloop.idle.php                                    24-May-2024 16:04                3427
evloop.invokepending.php                           24-May-2024 16:04                2273
evloop.io.php                                      24-May-2024 16:04                3863
evloop.loopfork.php                                24-May-2024 16:04                2611
evloop.now.php                                     24-May-2024 16:04                2878
evloop.nowupdate.php                               24-May-2024 16:04                3187
evloop.periodic.php                                24-May-2024 16:04                4001
evloop.prepare.php                                 24-May-2024 16:04                3445
evloop.resume.php                                  24-May-2024 16:04                2881
evloop.run.php                                     24-May-2024 16:04                5100
evloop.signal.php                                  24-May-2024 16:04                3730
evloop.stat.php                                    24-May-2024 16:04                3911
evloop.stop.php                                    24-May-2024 16:04                3018
evloop.suspend.php                                 24-May-2024 16:04                2868
evloop.timer.php                                   24-May-2024 16:04                3928
evloop.verify.php                                  24-May-2024 16:04                2617
evperiodic.again.php                               24-May-2024 16:04                2601
evperiodic.at.php                                  24-May-2024 16:04                2680
evperiodic.construct.php                           24-May-2024 16:04               10026
evperiodic.createstopped.php                       24-May-2024 16:04                5876
evperiodic.set.php                                 24-May-2024 16:04                3225
evprepare.construct.php                            24-May-2024 16:04                3756
evprepare.createstopped.php                        24-May-2024 16:04                4547
evsignal.construct.php                             24-May-2024 16:04                5510
evsignal.createstopped.php                         24-May-2024 16:04                4856
evsignal.set.php                                   24-May-2024 16:04                2525
evstat.attr.php                                    24-May-2024 16:04                8246
evstat.construct.php                               24-May-2024 16:04                7235
evstat.createstopped.php                           24-May-2024 16:04                5232
evstat.prev.php                                    24-May-2024 16:04                2969
evstat.set.php                                     24-May-2024 16:04                2884
evstat.stat.php                                    24-May-2024 16:04                3026
evtimer.again.php                                  24-May-2024 16:04                3096
evtimer.construct.php                              24-May-2024 16:04               12692
evtimer.createstopped.php                          24-May-2024 16:04                8361
evtimer.set.php                                    24-May-2024 16:04                3041
evwatcher.clear.php                                24-May-2024 16:04                2867
evwatcher.construct.php                            24-May-2024 16:04                2153
evwatcher.feed.php                                 24-May-2024 16:04                2638
evwatcher.getloop.php                              24-May-2024 16:04                2353
evwatcher.invoke.php                               24-May-2024 16:04                2645
evwatcher.keepalive.php                            24-May-2024 16:04                5348
evwatcher.setcallback.php                          24-May-2024 16:04                2600
evwatcher.start.php                                24-May-2024 16:04                2543
evwatcher.stop.php                                 24-May-2024 16:04                2512
example.xml-external-entity.php                    24-May-2024 16:05               21916
example.xml-map-tags.php                           24-May-2024 16:05                8358
example.xml-structure.php                          24-May-2024 16:05                6351
example.xmlwriter-namespace.php                    24-May-2024 16:05                5454
example.xmlwriter-oop.php                          24-May-2024 16:05                3473
example.xmlwriter-simple.php                       24-May-2024 16:05                8699
exception.clone.php                                24-May-2024 16:04                3168
exception.construct.php                            24-May-2024 16:04                3889
exception.getcode.php                              24-May-2024 16:04                4459
exception.getfile.php                              24-May-2024 16:04                3941
exception.getline.php                              24-May-2024 16:04                4140
exception.getmessage.php                           24-May-2024 16:04                4012
exception.getprevious.php                          24-May-2024 16:04                6939
exception.gettrace.php                             24-May-2024 16:04                4436
exception.gettraceasstring.php                     24-May-2024 16:04                4312
exception.tostring.php                             24-May-2024 16:04                4033
exec.configuration.php                             24-May-2024 16:04                1229
exec.constants.php                                 24-May-2024 16:04                1201
exec.installation.php                              24-May-2024 16:04                1263
exec.requirements.php                              24-May-2024 16:04                1203
exec.resources.php                                 24-May-2024 16:04                1403
exec.setup.php                                     24-May-2024 16:04                1606
exif.configuration.php                             24-May-2024 16:04                8139
exif.constants.php                                 24-May-2024 16:04                2165
exif.installation.php                              24-May-2024 16:04                1854
exif.requirements.php                              24-May-2024 16:04                2058
exif.resources.php                                 24-May-2024 16:04                1204
exif.setup.php                                     24-May-2024 16:04                1600
expect.configuration.php                           24-May-2024 16:04                5734
expect.constants.php                               24-May-2024 16:04                4042
expect.examples-usage.php                          24-May-2024 16:04               12443
expect.examples.php                                24-May-2024 16:04                1400
expect.installation.php                            24-May-2024 16:04                2599
expect.requirements.php                            24-May-2024 16:04                1387
expect.resources.php                               24-May-2024 16:04                1484
expect.setup.php                                   24-May-2024 16:04                1625
extensions.alphabetical.php                        24-May-2024 16:05               20996
extensions.membership.php                          24-May-2024 16:05               20844
extensions.php                                     24-May-2024 16:05                1746
extensions.state.php                               24-May-2024 16:05                2872
fann.configuration.php                             24-May-2024 16:04                1229
fann.constants.php                                 24-May-2024 16:04               23667
fann.examples-1.php                                24-May-2024 16:04                8496
fann.examples.php                                  24-May-2024 16:04                1358
fann.installation.php                              24-May-2024 16:04                4931
fann.requirements.php                              24-May-2024 16:04                1201
fann.resources.php                                 24-May-2024 16:04                1160
fann.setup.php                                     24-May-2024 16:04                1570
fannconnection.construct.php                       24-May-2024 16:04                3031
fannconnection.getfromneuron.php                   24-May-2024 16:04                2406
fannconnection.gettoneuron.php                     24-May-2024 16:04                2394
fannconnection.getweight.php                       24-May-2024 16:04                2329
fannconnection.setweight.php                       24-May-2024 16:04                2957
faq.build.php                                      24-May-2024 16:05               27046
faq.com.php                                        24-May-2024 16:05               14075
faq.databases.php                                  24-May-2024 16:05                9374
faq.general.php                                    24-May-2024 16:05                5459
faq.html.php                                       24-May-2024 16:05               22067
faq.installation.php                               24-May-2024 16:05               29473
faq.mailinglist.php                                24-May-2024 16:05               12350
faq.misc.php                                       24-May-2024 16:05                5128
faq.obtaining.php                                  24-May-2024 16:05               11868
faq.passwords.php                                  24-May-2024 16:05               11551
faq.php                                            24-May-2024 16:05                2125
faq.using.php                                      24-May-2024 16:05               23167
fdf.configuration.php                              24-May-2024 16:04                1222
fdf.constants.php                                  24-May-2024 16:04                9280
fdf.examples.php                                   24-May-2024 16:04                6137
fdf.installation.php                               24-May-2024 16:04                3972
fdf.requirements.php                               24-May-2024 16:04                1628
fdf.resources.php                                  24-May-2024 16:04                1817
fdf.setup.php                                      24-May-2024 16:04                1579
features.commandline.differences.php               24-May-2024 16:04               13370
features.commandline.ini.php                       24-May-2024 16:04                2438
features.commandline.interactive.php               24-May-2024 16:04                9955
features.commandline.io-streams.php                24-May-2024 16:04                6449
features.commandline.options.php                   24-May-2024 16:04               28561
features.commandline.php                           24-May-2024 16:04                8100
features.commandline.usage.php                     24-May-2024 16:04               16497
features.commandline.webserver.php                 24-May-2024 16:04               14685
features.connection-handling.php                   24-May-2024 16:04                6658
features.cookies.php                               24-May-2024 16:04                3284
features.dtrace.dtrace.php                         24-May-2024 16:04               15559
features.dtrace.introduction.php                   24-May-2024 16:04                3927
features.dtrace.php                                24-May-2024 16:04                1720
features.dtrace.systemtap.php                      24-May-2024 16:04                8471
features.file-upload.common-pitfalls.php           24-May-2024 16:04                5821
features.file-upload.errors.php                    24-May-2024 16:04                4239
features.file-upload.errors.seealso.php            24-May-2024 16:04                1412
features.file-upload.multiple.php                  24-May-2024 16:04                7464
features.file-upload.php                           24-May-2024 16:04                2003
features.file-upload.post-method.php               24-May-2024 16:04               18068
features.file-upload.put-method.php                24-May-2024 16:04                6516
features.gc.collecting-cycles.php                  24-May-2024 16:04                9736
features.gc.performance-considerations.php         24-May-2024 16:04               15436
features.gc.php                                    24-May-2024 16:04                1846
features.gc.refcounting-basics.php                 24-May-2024 16:04               23159
features.http-auth.php                             24-May-2024 16:04               24401
features.persistent-connections.php                24-May-2024 16:04               10214
features.php                                       24-May-2024 16:04                4207
features.remote-files.php                          24-May-2024 16:04                8382
features.session.security.management.php           24-May-2024 16:05               31263
features.sessions.php                              24-May-2024 16:04                1633
features.xforms.php                                24-May-2024 16:04                5913
ffi-ctype.getalignment.php                         24-May-2024 16:04                2424
ffi-ctype.getarrayelementtype.php                  24-May-2024 16:04                2510
ffi-ctype.getarraylength.php                       24-May-2024 16:04                2467
ffi-ctype.getattributes.php                        24-May-2024 16:04                2443
ffi-ctype.getenumkind.php                          24-May-2024 16:04                2419
ffi-ctype.getfuncabi.php                           24-May-2024 16:04                2427
ffi-ctype.getfuncparametercount.php                24-May-2024 16:04                2533
ffi-ctype.getfuncparametertype.php                 24-May-2024 16:04                2756
ffi-ctype.getfuncreturntype.php                    24-May-2024 16:04                2492
ffi-ctype.getkind.php                              24-May-2024 16:04                2381
ffi-ctype.getname.php                              24-May-2024 16:04                2387
ffi-ctype.getpointertype.php                       24-May-2024 16:04                2436
ffi-ctype.getsize.php                              24-May-2024 16:04                2399
ffi-ctype.getstructfieldnames.php                  24-May-2024 16:04                2509
ffi-ctype.getstructfieldoffset.php                 24-May-2024 16:04                2752
ffi-ctype.getstructfieldtype.php                   24-May-2024 16:04                2714
ffi.addr.php                                       24-May-2024 16:04                2799
ffi.alignof.php                                    24-May-2024 16:04                2929
ffi.arraytype.php                                  24-May-2024 16:04                4629
ffi.cast.php                                       24-May-2024 16:04                4842
ffi.cdef.php                                       24-May-2024 16:04                4464
ffi.configuration.php                              24-May-2024 16:04                4350
ffi.constants.php                                  24-May-2024 16:04                1154
ffi.examples-basic.php                             24-May-2024 16:04               15845
ffi.examples-callback.php                          24-May-2024 16:04                4952
ffi.examples-complete.php                          24-May-2024 16:04                5348
ffi.examples.php                                   24-May-2024 16:04                1515
ffi.free.php                                       24-May-2024 16:04                2439
ffi.installation.php                               24-May-2024 16:04                1455
ffi.isnull.php                                     24-May-2024 16:04                2542
ffi.load.php                                       24-May-2024 16:04                4306
ffi.memcmp.php                                     24-May-2024 16:04                4107
ffi.memcpy.php                                     24-May-2024 16:04                3291
ffi.memset.php                                     24-May-2024 16:04                3131
ffi.new.php                                        24-May-2024 16:04                5174
ffi.requirements.php                               24-May-2024 16:04                1297
ffi.resources.php                                  24-May-2024 16:04                1197
ffi.scope.php                                      24-May-2024 16:04                3145
ffi.setup.php                                      24-May-2024 16:04                1568
ffi.sizeof.php                                     24-May-2024 16:04                2770
ffi.string.php                                     24-May-2024 16:04                4211
ffi.type.php                                       24-May-2024 16:04                3588
ffi.typeof.php                                     24-May-2024 16:04                2863
fiber.construct.php                                24-May-2024 16:04                2455
fiber.getcurrent.php                               24-May-2024 16:04                2627
fiber.getreturn.php                                24-May-2024 16:04                2728
fiber.isrunning.php                                24-May-2024 16:04                2951
fiber.isstarted.php                                24-May-2024 16:04                2445
fiber.issuspended.php                              24-May-2024 16:04                2449
fiber.isterminated.php                             24-May-2024 16:04                2542
fiber.resume.php                                   24-May-2024 16:04                3620
fiber.start.php                                    24-May-2024 16:04                3259
fiber.suspend.php                                  24-May-2024 16:04                4567
fiber.throw.php                                    24-May-2024 16:04                3511
fibererror.construct.php                           24-May-2024 16:04                2304
fileinfo.configuration.php                         24-May-2024 16:04                1257
fileinfo.constants.php                             24-May-2024 16:04                6871
fileinfo.installation.php                          24-May-2024 16:04                1896
fileinfo.requirements.php                          24-May-2024 16:04                1231
fileinfo.resources.php                             24-May-2024 16:04                1482
fileinfo.setup.php                                 24-May-2024 16:04                1644
filesystem.configuration.php                       24-May-2024 16:04                8111
filesystem.constants.php                           24-May-2024 16:04               14358
filesystem.installation.php                        24-May-2024 16:04                1305
filesystem.requirements.php                        24-May-2024 16:04                1245
filesystem.resources.php                           24-May-2024 16:04                1479
filesystem.setup.php                               24-May-2024 16:04                1685
filesystemiterator.construct.php                   24-May-2024 16:05                7977
filesystemiterator.current.php                     24-May-2024 16:05                5547
filesystemiterator.getflags.php                    24-May-2024 16:05                3308
filesystemiterator.key.php                         24-May-2024 16:05                5241
filesystemiterator.next.php                        24-May-2024 16:05                4597
filesystemiterator.rewind.php                      24-May-2024 16:05                5166
filesystemiterator.setflags.php                    24-May-2024 16:05                6756
filter.configuration.php                           24-May-2024 16:05                5472
filter.constants.php                               24-May-2024 16:05               26233
filter.examples.php                                24-May-2024 16:05                1451
filter.examples.sanitization.php                   24-May-2024 16:05                5678
filter.examples.validation.php                     24-May-2024 16:05               10359
filter.filters.flags.php                           24-May-2024 16:05               17855
filter.filters.misc.php                            24-May-2024 16:05                2054
filter.filters.php                                 24-May-2024 16:05                1660
filter.filters.sanitize.php                        24-May-2024 16:05               14837
filter.filters.validate.php                        24-May-2024 16:05               15775
filter.installation.php                            24-May-2024 16:05                1423
filter.requirements.php                            24-May-2024 16:05                1217
filter.resources.php                               24-May-2024 16:05                1216
filter.setup.php                                   24-May-2024 16:05                1611
filteriterator.accept.php                          24-May-2024 16:05                5436
filteriterator.construct.php                       24-May-2024 16:05                3172
filteriterator.current.php                         24-May-2024 16:05                3087
filteriterator.key.php                             24-May-2024 16:05                3035
filteriterator.next.php                            24-May-2024 16:05                3037
filteriterator.rewind.php                          24-May-2024 16:05                3226
filteriterator.valid.php                           24-May-2024 16:05                3139
filters.compression.php                            24-May-2024 16:05               16677
filters.convert.php                                24-May-2024 16:05               12243
filters.encryption.php                             24-May-2024 16:05               41218
filters.php                                        24-May-2024 16:05                3784
filters.string.php                                 24-May-2024 16:05               10300
finfo.buffer.php                                   24-May-2024 16:04                2934
finfo.construct.php                                24-May-2024 16:04                3130
finfo.file.php                                     24-May-2024 16:04                2925
finfo.set-flags.php                                24-May-2024 16:04                2152
fpm.observability.php                              24-May-2024 16:05                1496
fpm.setup.php                                      24-May-2024 16:05                1371
fpm.status.php                                     24-May-2024 16:05               11685
ftp.configuration.php                              24-May-2024 16:05                1222
ftp.constants.php                                  24-May-2024 16:05                5560
ftp.examples-basic.php                             24-May-2024 16:05                4882
ftp.examples.php                                   24-May-2024 16:05                1374
ftp.installation.php                               24-May-2024 16:05                1640
ftp.requirements.php                               24-May-2024 16:05                1196
ftp.resources.php                                  24-May-2024 16:05                1594
ftp.setup.php                                      24-May-2024 16:05                1580
funchand.configuration.php                         24-May-2024 16:05                1257
funchand.constants.php                             24-May-2024 16:05                1209
funchand.installation.php                          24-May-2024 16:05                1291
funchand.requirements.php                          24-May-2024 16:05                1231
funchand.resources.php                             24-May-2024 16:05                1232
funchand.setup.php                                 24-May-2024 16:05                1626
funcref.php                                        24-May-2024 16:05               14343
function.abs.php                                   24-May-2024 16:04                5715
function.acos.php                                  24-May-2024 16:04                3679
function.acosh.php                                 24-May-2024 16:04                3516
function.addcslashes.php                           24-May-2024 16:05                8531
function.addslashes.php                            24-May-2024 16:05                6731
function.apache-child-terminate.php                24-May-2024 16:05                3595
function.apache-get-modules.php                    24-May-2024 16:05                3545
function.apache-get-version.php                    24-May-2024 16:05                3998
function.apache-getenv.php                         24-May-2024 16:05                5330
function.apache-lookup-uri.php                     24-May-2024 16:05                5993
function.apache-note.php                           24-May-2024 16:05                7500
function.apache-request-headers.php                24-May-2024 16:05                5989
function.apache-response-headers.php               24-May-2024 16:05                4560
function.apache-setenv.php                         24-May-2024 16:05                5853
function.apcu-add.php                              24-May-2024 16:04                8969
function.apcu-cache-info.php                       24-May-2024 16:04                7104
function.apcu-cas.php                              24-May-2024 16:04                8860
function.apcu-clear-cache.php                      24-May-2024 16:04                2701
function.apcu-dec.php                              24-May-2024 16:04                8290
function.apcu-delete.php                           24-May-2024 16:04                6057
function.apcu-enabled.php                          24-May-2024 16:04                2462
function.apcu-entry.php                            24-May-2024 16:04                9047
function.apcu-exists.php                           24-May-2024 16:04                6905
function.apcu-fetch.php                            24-May-2024 16:04                6021
function.apcu-inc.php                              24-May-2024 16:04                8281
function.apcu-key-info.php                         24-May-2024 16:04                5126
function.apcu-sma-info.php                         24-May-2024 16:04                4753
function.apcu-store.php                            24-May-2024 16:04                7783
function.array-change-key-case.php                 24-May-2024 16:05                5476
function.array-chunk.php                           24-May-2024 16:05                7935
function.array-column.php                          24-May-2024 16:05               17565
function.array-combine.php                         24-May-2024 16:05                7494
function.array-count-values.php                    24-May-2024 16:05                5926
function.array-diff-assoc.php                      24-May-2024 16:05               11686
function.array-diff-key.php                        24-May-2024 16:05               13076
function.array-diff-uassoc.php                     24-May-2024 16:05               12980
function.array-diff-ukey.php                       24-May-2024 16:05               12562
function.array-diff.php                            24-May-2024 16:05               12458
function.array-fill-keys.php                       24-May-2024 16:05                5443
function.array-fill.php                            24-May-2024 16:05                9696
function.array-filter.php                          24-May-2024 16:05               17163
function.array-flip.php                            24-May-2024 16:05                7236
function.array-intersect-assoc.php                 24-May-2024 16:05                9208
function.array-intersect-key.php                   24-May-2024 16:05               10439
function.array-intersect-uassoc.php                24-May-2024 16:05                9299
function.array-intersect-ukey.php                  24-May-2024 16:05               12341
function.array-intersect.php                       24-May-2024 16:05                7167
function.array-is-list.php                         24-May-2024 16:05                7101
function.array-key-exists.php                      24-May-2024 16:05               10373
function.array-key-first.php                       24-May-2024 16:05                7395
function.array-key-last.php                        24-May-2024 16:05                3498
function.array-keys.php                            24-May-2024 16:05                8568
function.array-map.php                             24-May-2024 16:05               28262
function.array-merge-recursive.php                 24-May-2024 16:05                7117
function.array-merge.php                           24-May-2024 16:05               12797
function.array-multisort.php                       24-May-2024 16:05               24658
function.array-pad.php                             24-May-2024 16:05                7739
function.array-pop.php                             24-May-2024 16:05                5769
function.array-product.php                         24-May-2024 16:05                5586
function.array-push.php                            24-May-2024 16:05                7430
function.array-rand.php                            24-May-2024 16:05               10714
function.array-reduce.php                          24-May-2024 16:05               10197
function.array-replace-recursive.php               24-May-2024 16:05               11387
function.array-replace.php                         24-May-2024 16:05                6970
function.array-reverse.php                         24-May-2024 16:05                6149
function.array-search.php                          24-May-2024 16:05                8729
function.array-shift.php                           24-May-2024 16:05                5851
function.array-slice.php                           24-May-2024 16:05               14093
function.array-splice.php                          24-May-2024 16:05               18168
function.array-sum.php                             24-May-2024 16:05                6326
function.array-udiff-assoc.php                     24-May-2024 16:05               18502
function.array-udiff-uassoc.php                    24-May-2024 16:05               19957
function.array-udiff.php                           24-May-2024 16:05               30700
function.array-uintersect-assoc.php                24-May-2024 16:05               12267
function.array-uintersect-uassoc.php               24-May-2024 16:05               12599
function.array-uintersect.php                      24-May-2024 16:05               11807
function.array-unique.php                          24-May-2024 16:05               10134
function.array-unshift.php                         24-May-2024 16:05               11376
function.array-values.php                          24-May-2024 16:05                4656
function.array-walk-recursive.php                  24-May-2024 16:05                7916
function.array-walk.php                            24-May-2024 16:05               14613
function.array.php                                 24-May-2024 16:05               12317
function.arsort.php                                24-May-2024 16:05                9740
function.asin.php                                  24-May-2024 16:04                3671
function.asinh.php                                 24-May-2024 16:04                3506
function.asort.php                                 24-May-2024 16:05                9739
function.assert-options.php                        24-May-2024 16:04               14824
function.assert.php                                24-May-2024 16:04               24151
function.atan.php                                  24-May-2024 16:04                3707
function.atan2.php                                 24-May-2024 16:04                3568
function.atanh.php                                 24-May-2024 16:04                3565
function.autoload.php                              24-May-2024 16:05                3278
function.base-convert.php                          24-May-2024 16:04                6853
function.base64-decode.php                         24-May-2024 16:05                5463
function.base64-encode.php                         24-May-2024 16:05                4953
function.basename.php                              24-May-2024 16:04                7848
function.bcadd.php                                 24-May-2024 16:04                5927
function.bccomp.php                                24-May-2024 16:04                5839
function.bcdiv.php                                 24-May-2024 16:04                5509
function.bcmod.php                                 24-May-2024 16:04                7618
function.bcmul.php                                 24-May-2024 16:04                7484
function.bcpow.php                                 24-May-2024 16:04                7537
function.bcpowmod.php                              24-May-2024 16:04                7662
function.bcscale.php                               24-May-2024 16:04                5883
function.bcsqrt.php                                24-May-2024 16:04                6596
function.bcsub.php                                 24-May-2024 16:04                5291
function.bin2hex.php                               24-May-2024 16:05                4566
function.bind-textdomain-codeset.php               24-May-2024 16:04                4850
function.bindec.php                                24-May-2024 16:04               15242
function.bindtextdomain.php                        24-May-2024 16:04                5805
function.boolval.php                               24-May-2024 16:05               10268
function.bzclose.php                               24-May-2024 16:04                3229
function.bzcompress.php                            24-May-2024 16:04                5284
function.bzdecompress.php                          24-May-2024 16:04                6803
function.bzerrno.php                               24-May-2024 16:04                3268
function.bzerror.php                               24-May-2024 16:04                4479
function.bzerrstr.php                              24-May-2024 16:04                3287
function.bzflush.php                               24-May-2024 16:04                3616
function.bzopen.php                                24-May-2024 16:04                5447
function.bzread.php                                24-May-2024 16:04                6836
function.bzwrite.php                               24-May-2024 16:04                6608
function.cal-days-in-month.php                     24-May-2024 16:04                4701
function.cal-from-jd.php                           24-May-2024 16:04                7221
function.cal-info.php                              24-May-2024 16:04                6223
function.cal-to-jd.php                             24-May-2024 16:04                6275
function.call-user-func-array.php                  24-May-2024 16:05               18037
function.call-user-func.php                        24-May-2024 16:05               14649
function.ceil.php                                  24-May-2024 16:04                5269
function.chdir.php                                 24-May-2024 16:04                5921
function.checkdate.php                             24-May-2024 16:04                5735
function.checkdnsrr.php                            24-May-2024 16:05                5401
function.chgrp.php                                 24-May-2024 16:04                7122
function.chmod.php                                 24-May-2024 16:04                9438
function.chop.php                                  24-May-2024 16:05                2086
function.chown.php                                 24-May-2024 16:04                7189
function.chr.php                                   24-May-2024 16:05                9457
function.chroot.php                                24-May-2024 16:04                4983
function.chunk-split.php                           24-May-2024 16:05                5346
function.class-alias.php                           24-May-2024 16:05                9551
function.class-exists.php                          24-May-2024 16:05                7248
function.class-implements.php                      24-May-2024 16:05                7722
function.class-parents.php                         24-May-2024 16:05                7313
function.class-uses.php                            24-May-2024 16:05                6557
function.clearstatcache.php                        24-May-2024 16:04               11373
function.cli-get-process-title.php                 24-May-2024 16:04                4698
function.cli-set-process-title.php                 24-May-2024 16:04                5744
function.closedir.php                              24-May-2024 16:04                5038
function.closelog.php                              24-May-2024 16:05                3024
function.com-create-guid.php                       24-May-2024 16:05                2972
function.com-event-sink.php                        24-May-2024 16:05               10998
function.com-get-active-object.php                 24-May-2024 16:05                6284
function.com-load-typelib.php                      24-May-2024 16:05                5753
function.com-message-pump.php                      24-May-2024 16:05                4357
function.com-print-typeinfo.php                    24-May-2024 16:05                5546
function.commonmark-parse.php                      24-May-2024 16:05                4167
function.commonmark-render-html.php                24-May-2024 16:05                4754
function.commonmark-render-latex.php               24-May-2024 16:05                5084
function.commonmark-render-man.php                 24-May-2024 16:05                5066
function.commonmark-render-xml.php                 24-May-2024 16:05                4711
function.commonmark-render.php                     24-May-2024 16:05                5012
function.compact.php                               24-May-2024 16:05                8347
function.connection-aborted.php                    24-May-2024 16:05                3243
function.connection-status.php                     24-May-2024 16:05                3382
function.constant.php                              24-May-2024 16:05                9445
function.convert-cyr-string.php                    24-May-2024 16:05                5329
function.convert-uudecode.php                      24-May-2024 16:05                4611
function.convert-uuencode.php                      24-May-2024 16:05                5643
function.copy.php                                  24-May-2024 16:04                6246
function.cos.php                                   24-May-2024 16:04                4059
function.cosh.php                                  24-May-2024 16:04                3439
function.count-chars.php                           24-May-2024 16:05                7607
function.count.php                                 24-May-2024 16:05               16619
function.crc32.php                                 24-May-2024 16:05                7504
function.create-function.php                       24-May-2024 16:05               31725
function.crypt.php                                 24-May-2024 16:05               14300
function.ctype-alnum.php                           24-May-2024 16:05                6898
function.ctype-alpha.php                           24-May-2024 16:05                7355
function.ctype-cntrl.php                           24-May-2024 16:05                6930
function.ctype-digit.php                           24-May-2024 16:05                9085
function.ctype-graph.php                           24-May-2024 16:05                7587
function.ctype-lower.php                           24-May-2024 16:05                7225
function.ctype-print.php                           24-May-2024 16:05                7620
function.ctype-punct.php                           24-May-2024 16:05                6948
function.ctype-space.php                           24-May-2024 16:05                7710
function.ctype-upper.php                           24-May-2024 16:05                7100
function.ctype-xdigit.php                          24-May-2024 16:05                6799
function.cubrid-affected-rows.php                  24-May-2024 16:04                9403
function.cubrid-bind.php                           24-May-2024 16:04               20728
function.cubrid-client-encoding.php                24-May-2024 16:04                5294
function.cubrid-close-prepare.php                  24-May-2024 16:04                6264
function.cubrid-close-request.php                  24-May-2024 16:04                6275
function.cubrid-close.php                          24-May-2024 16:04                6399
function.cubrid-col-get.php                        24-May-2024 16:04                8585
function.cubrid-col-size.php                       24-May-2024 16:04                8705
function.cubrid-column-names.php                   24-May-2024 16:04                8541
function.cubrid-column-types.php                   24-May-2024 16:04                8521
function.cubrid-commit.php                         24-May-2024 16:04               15369
function.cubrid-connect-with-url.php               24-May-2024 16:04               15124
function.cubrid-connect.php                        24-May-2024 16:04               12355
function.cubrid-current-oid.php                    24-May-2024 16:04                6022
function.cubrid-data-seek.php                      24-May-2024 16:04                7484
function.cubrid-db-name.php                        24-May-2024 16:04                6566
function.cubrid-disconnect.php                     24-May-2024 16:04                7160
function.cubrid-drop.php                           24-May-2024 16:04               11464
function.cubrid-errno.php                          24-May-2024 16:04                6823
function.cubrid-error-code-facility.php            24-May-2024 16:04                5859
function.cubrid-error-code.php                     24-May-2024 16:04                5795
function.cubrid-error-msg.php                      24-May-2024 16:04                5219
function.cubrid-error.php                          24-May-2024 16:04                6383
function.cubrid-execute.php                        24-May-2024 16:04               14404
function.cubrid-fetch-array.php                    24-May-2024 16:04                9824
function.cubrid-fetch-assoc.php                    24-May-2024 16:04                9058
function.cubrid-fetch-field.php                    24-May-2024 16:04               14096
function.cubrid-fetch-lengths.php                  24-May-2024 16:04                6148
function.cubrid-fetch-object.php                   24-May-2024 16:04               12003
function.cubrid-fetch-row.php                      24-May-2024 16:04                8982
function.cubrid-fetch.php                          24-May-2024 16:04                9964
function.cubrid-field-flags.php                    24-May-2024 16:04                7804
function.cubrid-field-len.php                      24-May-2024 16:04                8313
function.cubrid-field-name.php                     24-May-2024 16:04                7219
function.cubrid-field-seek.php                     24-May-2024 16:04               10971
function.cubrid-field-table.php                    24-May-2024 16:04                7424
function.cubrid-field-type.php                     24-May-2024 16:04                7500
function.cubrid-free-result.php                    24-May-2024 16:04                5983
function.cubrid-get-autocommit.php                 24-May-2024 16:04                3821
function.cubrid-get-charset.php                    24-May-2024 16:04                5034
function.cubrid-get-class-name.php                 24-May-2024 16:04                6364
function.cubrid-get-client-info.php                24-May-2024 16:04                8174
function.cubrid-get-db-parameter.php               24-May-2024 16:04               14357
function.cubrid-get-query-timeout.php              24-May-2024 16:04                6750
function.cubrid-get-server-info.php                24-May-2024 16:04                8465
function.cubrid-get.php                            24-May-2024 16:04                9874
function.cubrid-insert-id.php                      24-May-2024 16:04                7165
function.cubrid-is-instance.php                    24-May-2024 16:04                7198
function.cubrid-list-dbs.php                       24-May-2024 16:04                4566
function.cubrid-load-from-glo.php                  24-May-2024 16:04                6919
function.cubrid-lob-close.php                      24-May-2024 16:04                7279
function.cubrid-lob-export.php                     24-May-2024 16:04                7858
function.cubrid-lob-get.php                        24-May-2024 16:04                7651
function.cubrid-lob-send.php                       24-May-2024 16:04                7033
function.cubrid-lob-size.php                       24-May-2024 16:04                5849
function.cubrid-lob2-bind.php                      24-May-2024 16:04                9743
function.cubrid-lob2-close.php                     24-May-2024 16:04                3445
function.cubrid-lob2-export.php                    24-May-2024 16:04                8736
function.cubrid-lob2-import.php                    24-May-2024 16:04                8605
function.cubrid-lob2-new.php                       24-May-2024 16:04                3959
function.cubrid-lob2-read.php                      24-May-2024 16:04               13698
function.cubrid-lob2-seek.php                      24-May-2024 16:04               11267
function.cubrid-lob2-seek64.php                    24-May-2024 16:04               12689
function.cubrid-lob2-size.php                      24-May-2024 16:04                4340
function.cubrid-lob2-size64.php                    24-May-2024 16:04                4520
function.cubrid-lob2-tell.php                      24-May-2024 16:04                4359
function.cubrid-lob2-tell64.php                    24-May-2024 16:04                4557
function.cubrid-lob2-write.php                     24-May-2024 16:04               14023
function.cubrid-lock-read.php                      24-May-2024 16:04                9185
function.cubrid-lock-write.php                     24-May-2024 16:04                9573
function.cubrid-move-cursor.php                    24-May-2024 16:04                9557
function.cubrid-new-glo.php                        24-May-2024 16:04                6961
function.cubrid-next-result.php                    24-May-2024 16:04               16344
function.cubrid-num-cols.php                       24-May-2024 16:04                5995
function.cubrid-num-fields.php                     24-May-2024 16:04                5713
function.cubrid-num-rows.php                       24-May-2024 16:04                7179
function.cubrid-pconnect-with-url.php              24-May-2024 16:04               14451
function.cubrid-pconnect.php                       24-May-2024 16:04               12136
function.cubrid-ping.php                           24-May-2024 16:04                6087
function.cubrid-prepare.php                        24-May-2024 16:04               10291
function.cubrid-put.php                            24-May-2024 16:04               11406
function.cubrid-query.php                          24-May-2024 16:04               14713
function.cubrid-real-escape-string.php             24-May-2024 16:04                8234
function.cubrid-result.php                         24-May-2024 16:04                7444
function.cubrid-rollback.php                       24-May-2024 16:04               14664
function.cubrid-save-to-glo.php                    24-May-2024 16:04                6823
function.cubrid-schema.php                         24-May-2024 16:04               20496
function.cubrid-send-glo.php                       24-May-2024 16:04                6290
function.cubrid-seq-drop.php                       24-May-2024 16:04                9834
function.cubrid-seq-insert.php                     24-May-2024 16:04               10340
function.cubrid-seq-put.php                        24-May-2024 16:04               10267
function.cubrid-set-add.php                        24-May-2024 16:04                9606
function.cubrid-set-autocommit.php                 24-May-2024 16:04                4208
function.cubrid-set-db-parameter.php               24-May-2024 16:04                8223
function.cubrid-set-drop.php                       24-May-2024 16:04                9583
function.cubrid-set-query-timeout.php              24-May-2024 16:04                3596
function.cubrid-unbuffered-query.php               24-May-2024 16:04                7027
function.cubrid-version.php                        24-May-2024 16:04                8710
function.curl-close.php                            24-May-2024 16:05                6300
function.curl-copy-handle.php                      24-May-2024 16:05                6691
function.curl-errno.php                            24-May-2024 16:05                6204
function.curl-error.php                            24-May-2024 16:05                6125
function.curl-escape.php                           24-May-2024 16:05                7790
function.curl-exec.php                             24-May-2024 16:05                7794
function.curl-getinfo.php                          24-May-2024 16:05               39411
function.curl-init.php                             24-May-2024 16:05                7586
function.curl-multi-add-handle.php                 24-May-2024 16:05               10571
function.curl-multi-close.php                      24-May-2024 16:05                9842
function.curl-multi-errno.php                      24-May-2024 16:05                4080
function.curl-multi-exec.php                       24-May-2024 16:05               10560
function.curl-multi-getcontent.php                 24-May-2024 16:05                4723
function.curl-multi-info-read.php                  24-May-2024 16:05               12382
function.curl-multi-init.php                       24-May-2024 16:05                8932
function.curl-multi-remove-handle.php              24-May-2024 16:05                5711
function.curl-multi-select.php                     24-May-2024 16:05                4569
function.curl-multi-setopt.php                     24-May-2024 16:05               13665
function.curl-multi-strerror.php                   24-May-2024 16:05                7271
function.curl-pause.php                            24-May-2024 16:05                4088
function.curl-reset.php                            24-May-2024 16:05                6653
function.curl-setopt-array.php                     24-May-2024 16:05                7960
function.curl-setopt.php                           24-May-2024 16:05              186418
function.curl-share-close.php                      24-May-2024 16:05                8245
function.curl-share-errno.php                      24-May-2024 16:05                4065
function.curl-share-init.php                       24-May-2024 16:05                7806
function.curl-share-setopt.php                     24-May-2024 16:05               10609
function.curl-share-strerror.php                   24-May-2024 16:05                3551
function.curl-strerror.php                         24-May-2024 16:05                6363
function.curl-unescape.php                         24-May-2024 16:05                8292
function.curl-version.php                          24-May-2024 16:05                7022
function.curl_upkeep.php                           24-May-2024 16:05                7183
function.current.php                               24-May-2024 16:05               11660
function.date-add.php                              24-May-2024 16:04                1779
function.date-create-from-format.php               24-May-2024 16:04                1954
function.date-create-immutable-from-format.php     24-May-2024 16:04                2066
function.date-create-immutable.php                 24-May-2024 16:04                4440
function.date-create.php                           24-May-2024 16:04                4637
function.date-date-set.php                         24-May-2024 16:04                1838
function.date-default-timezone-get.php             24-May-2024 16:04                7247
function.date-default-timezone-set.php             24-May-2024 16:04                5891
function.date-diff.php                             24-May-2024 16:04                1798
function.date-format.php                           24-May-2024 16:04                1806
function.date-get-last-errors.php                  24-May-2024 16:04                1971
function.date-interval-create-from-date-string.php 24-May-2024 16:04                2082
function.date-interval-format.php                  24-May-2024 16:04                1933
function.date-isodate-set.php                      24-May-2024 16:04                1861
function.date-modify.php                           24-May-2024 16:04                1810
function.date-offset-get.php                       24-May-2024 16:04                1854
function.date-parse-from-format.php                24-May-2024 16:04               14518
function.date-parse.php                            24-May-2024 16:04               20242
function.date-sub.php                              24-May-2024 16:04                2313
function.date-sun-info.php                         24-May-2024 16:04               15992
function.date-sunrise.php                          24-May-2024 16:04               14641
function.date-sunset.php                           24-May-2024 16:04               14626
function.date-time-set.php                         24-May-2024 16:04                1824
function.date-timestamp-get.php                    24-May-2024 16:04                1883
function.date-timestamp-set.php                    24-May-2024 16:04                1891
function.date-timezone-get.php                     24-May-2024 16:04                1880
function.date-timezone-set.php                     24-May-2024 16:04                1852
function.date.php                                  24-May-2024 16:04               22793
function.db2-autocommit.php                        24-May-2024 16:04               11171
function.db2-bind-param.php                        24-May-2024 16:04               23949
function.db2-client-info.php                       24-May-2024 16:04               12386
function.db2-close.php                             24-May-2024 16:04                5810
function.db2-column-privileges.php                 24-May-2024 16:04                9666
function.db2-columns.php                           24-May-2024 16:04               11945
function.db2-commit.php                            24-May-2024 16:04                3917
function.db2-conn-error.php                        24-May-2024 16:04                7119
function.db2-conn-errormsg.php                     24-May-2024 16:04                6884
function.db2-connect.php                           24-May-2024 16:04               42059
function.db2-cursor-type.php                       24-May-2024 16:04                3510
function.db2-escape-string.php                     24-May-2024 16:04                7703
function.db2-exec.php                              24-May-2024 16:04               27020
function.db2-execute.php                           24-May-2024 16:04               26416
function.db2-fetch-array.php                       24-May-2024 16:04               11753
function.db2-fetch-assoc.php                       24-May-2024 16:04               11710
function.db2-fetch-both.php                        24-May-2024 16:04               12343
function.db2-fetch-object.php                      24-May-2024 16:04                9569
function.db2-fetch-row.php                         24-May-2024 16:04               16867
function.db2-field-display-size.php                24-May-2024 16:04                5207
function.db2-field-name.php                        24-May-2024 16:04                5082
function.db2-field-num.php                         24-May-2024 16:04                5088
function.db2-field-precision.php                   24-May-2024 16:04                5112
function.db2-field-scale.php                       24-May-2024 16:04                5082
function.db2-field-type.php                        24-May-2024 16:04                5104
function.db2-field-width.php                       24-May-2024 16:04                5322
function.db2-foreign-keys.php                      24-May-2024 16:04                9389
function.db2-free-result.php                       24-May-2024 16:04                3613
function.db2-free-stmt.php                         24-May-2024 16:04                3620
function.db2-get-option.php                        24-May-2024 16:04               25042
function.db2-last-insert-id.php                    24-May-2024 16:04                8163
function.db2-lob-read.php                          24-May-2024 16:04               16577
function.db2-next-result.php                       24-May-2024 16:04                9123
function.db2-num-fields.php                        24-May-2024 16:04                7391
function.db2-num-rows.php                          24-May-2024 16:04                5022
function.db2-pclose.php                            24-May-2024 16:04                5995
function.db2-pconnect.php                          24-May-2024 16:04               35131
function.db2-prepare.php                           24-May-2024 16:04               11327
function.db2-primary-keys.php                      24-May-2024 16:04                8032
function.db2-procedure-columns.php                 24-May-2024 16:04               12751
function.db2-procedures.php                        24-May-2024 16:04                8653
function.db2-result.php                            24-May-2024 16:04                8279
function.db2-rollback.php                          24-May-2024 16:04                9542
function.db2-server-info.php                       24-May-2024 16:04               23475
function.db2-set-option.php                        24-May-2024 16:04               70833
function.db2-special-columns.php                   24-May-2024 16:04               10481
function.db2-statistics.php                        24-May-2024 16:04               13529
function.db2-stmt-error.php                        24-May-2024 16:04                4747
function.db2-stmt-errormsg.php                     24-May-2024 16:04                4338
function.db2-table-privileges.php                  24-May-2024 16:04                9122
function.db2-tables.php                            24-May-2024 16:04                9476
function.dba-close.php                             24-May-2024 16:04                3342
function.dba-delete.php                            24-May-2024 16:04                4307
function.dba-exists.php                            24-May-2024 16:04                4348
function.dba-fetch.php                             24-May-2024 16:04                7742
function.dba-firstkey.php                          24-May-2024 16:04                3795
function.dba-handlers.php                          24-May-2024 16:04                5750
function.dba-insert.php                            24-May-2024 16:04                5005
function.dba-key-split.php                         24-May-2024 16:04                4016
function.dba-list.php                              24-May-2024 16:04                2392
function.dba-nextkey.php                           24-May-2024 16:04                3664
function.dba-open.php                              24-May-2024 16:04               14863
function.dba-optimize.php                          24-May-2024 16:04                3334
function.dba-popen.php                             24-May-2024 16:04                9625
function.dba-replace.php                           24-May-2024 16:04                4779
function.dba-sync.php                              24-May-2024 16:04                3409
function.dbase-add-record.php                      24-May-2024 16:04                6932
function.dbase-close.php                           24-May-2024 16:04                5272
function.dbase-create.php                          24-May-2024 16:04                8261
function.dbase-delete-record.php                   24-May-2024 16:04                5024
function.dbase-get-header-info.php                 24-May-2024 16:04                7003
function.dbase-get-record-with-names.php           24-May-2024 16:04                8921
function.dbase-get-record.php                      24-May-2024 16:04                5881
function.dbase-numfields.php                       24-May-2024 16:04                5966
function.dbase-numrecords.php                      24-May-2024 16:04                6914
function.dbase-open.php                            24-May-2024 16:04                6613
function.dbase-pack.php                            24-May-2024 16:04                6364
function.dbase-replace-record.php                  24-May-2024 16:04                9496
function.dcgettext.php                             24-May-2024 16:04                3544
function.dcngettext.php                            24-May-2024 16:04                4173
function.debug-backtrace.php                       24-May-2024 16:04               12442
function.debug-print-backtrace.php                 24-May-2024 16:04                6720
function.debug-zval-dump.php                       24-May-2024 16:05               10465
function.decbin.php                                24-May-2024 16:04                8918
function.dechex.php                                24-May-2024 16:04                7423
function.decoct.php                                24-May-2024 16:04                4988
function.define.php                                24-May-2024 16:05               12430
function.defined.php                               24-May-2024 16:05                8065
function.deflate-add.php                           24-May-2024 16:04                6337
function.deflate-init.php                          24-May-2024 16:04                8610
function.deg2rad.php                               24-May-2024 16:04                4036
function.delete.php                                24-May-2024 16:04                2605
function.dgettext.php                              24-May-2024 16:04                3268
function.die.php                                   24-May-2024 16:05                1585
function.dio-close.php                             24-May-2024 16:04                4079
function.dio-fcntl.php                             24-May-2024 16:04               10221
function.dio-open.php                              24-May-2024 16:04                9024
function.dio-read.php                              24-May-2024 16:04                3699
function.dio-seek.php                              24-May-2024 16:04                7542
function.dio-stat.php                              24-May-2024 16:04                4442
function.dio-tcsetattr.php                         24-May-2024 16:04                7156
function.dio-truncate.php                          24-May-2024 16:04                3956
function.dio-write.php                             24-May-2024 16:04                3983
function.dir.php                                   24-May-2024 16:04                7451
function.dirname.php                               24-May-2024 16:04               10181
function.disk-free-space.php                       24-May-2024 16:04                5829
function.disk-total-space.php                      24-May-2024 16:04                5516
function.diskfreespace.php                         24-May-2024 16:04                1831
function.dl.php                                    24-May-2024 16:04               10625
function.dngettext.php                             24-May-2024 16:04                3895
function.dns-check-record.php                      24-May-2024 16:05                1800
function.dns-get-mx.php                            24-May-2024 16:05                1770
function.dns-get-record.php                        24-May-2024 16:05               24956
function.dom-import-simplexml.php                  24-May-2024 16:05                7207
function.doubleval.php                             24-May-2024 16:05                1738
function.each.php                                  24-May-2024 16:05               11907
function.easter-date.php                           24-May-2024 16:04               14876
function.easter-days.php                           24-May-2024 16:04                7479
function.echo.php                                  24-May-2024 16:05               18360
function.eio-busy.php                              24-May-2024 16:04                5107
function.eio-cancel.php                            24-May-2024 16:04                7865
function.eio-chmod.php                             24-May-2024 16:04                6637
function.eio-chown.php                             24-May-2024 16:04                6817
function.eio-close.php                             24-May-2024 16:04                5990
function.eio-custom.php                            24-May-2024 16:04               10678
function.eio-dup2.php                              24-May-2024 16:04                6087
function.eio-event-loop.php                        24-May-2024 16:04                5928
function.eio-fallocate.php                         24-May-2024 16:04                8052
function.eio-fchmod.php                            24-May-2024 16:04                6607
function.eio-fchown.php                            24-May-2024 16:04                6910
function.eio-fdatasync.php                         24-May-2024 16:04                5922
function.eio-fstat.php                             24-May-2024 16:04               12050
function.eio-fstatvfs.php                          24-May-2024 16:04                6028
function.eio-fsync.php                             24-May-2024 16:04                6053
function.eio-ftruncate.php                         24-May-2024 16:04                6570
function.eio-futime.php                            24-May-2024 16:04                6884
function.eio-get-event-stream.php                  24-May-2024 16:04                8199
function.eio-get-last-error.php                    24-May-2024 16:04                3291
function.eio-grp-add.php                           24-May-2024 16:04               11926
function.eio-grp-cancel.php                        24-May-2024 16:04                3225
function.eio-grp-limit.php                         24-May-2024 16:04                3139
function.eio-grp.php                               24-May-2024 16:04               12226
function.eio-init.php                              24-May-2024 16:04                2721
function.eio-link.php                              24-May-2024 16:04               12793
function.eio-lstat.php                             24-May-2024 16:04               10272
function.eio-mkdir.php                             24-May-2024 16:04                9621
function.eio-mknod.php                             24-May-2024 16:04               12144
function.eio-nop.php                               24-May-2024 16:04                5594
function.eio-npending.php                          24-May-2024 16:04                3129
function.eio-nready.php                            24-May-2024 16:04                2779
function.eio-nreqs.php                             24-May-2024 16:04                5587
function.eio-nthreads.php                          24-May-2024 16:04                3525
function.eio-open.php                              24-May-2024 16:04               12095
function.eio-poll.php                              24-May-2024 16:04                5848
function.eio-read.php                              24-May-2024 16:04               13149
function.eio-readahead.php                         24-May-2024 16:04                6632
function.eio-readdir.php                           24-May-2024 16:04               18818
function.eio-readlink.php                          24-May-2024 16:04               12527
function.eio-realpath.php                          24-May-2024 16:04                5374
function.eio-rename.php                            24-May-2024 16:04                9620
function.eio-rmdir.php                             24-May-2024 16:04                8573
function.eio-seek.php                              24-May-2024 16:04                7361
function.eio-sendfile.php                          24-May-2024 16:04                7130
function.eio-set-max-idle.php                      24-May-2024 16:04                3186
function.eio-set-max-parallel.php                  24-May-2024 16:04                3226
function.eio-set-max-poll-reqs.php                 24-May-2024 16:04                2532
function.eio-set-max-poll-time.php                 24-May-2024 16:04                2607
function.eio-set-min-parallel.php                  24-May-2024 16:04                3216
function.eio-stat.php                              24-May-2024 16:04               10276
function.eio-statvfs.php                           24-May-2024 16:04                8715
function.eio-symlink.php                           24-May-2024 16:04               11204
function.eio-sync-file-range.php                   24-May-2024 16:04                7745
function.eio-sync.php                              24-May-2024 16:04                3000
function.eio-syncfs.php                            24-May-2024 16:04                5532
function.eio-truncate.php                          24-May-2024 16:04                6481
function.eio-unlink.php                            24-May-2024 16:04                5671
function.eio-utime.php                             24-May-2024 16:04                6507
function.eio-write.php                             24-May-2024 16:04                7303
function.empty.php                                 24-May-2024 16:05                9927
function.enchant-broker-describe.php               24-May-2024 16:04                6361
function.enchant-broker-dict-exists.php            24-May-2024 16:04                5986
function.enchant-broker-free-dict.php              24-May-2024 16:04                5089
function.enchant-broker-free.php                   24-May-2024 16:04                4623
function.enchant-broker-get-dict-path.php          24-May-2024 16:04                5626
function.enchant-broker-get-error.php              24-May-2024 16:04                3918
function.enchant-broker-init.php                   24-May-2024 16:04                3684
function.enchant-broker-list-dicts.php             24-May-2024 16:04                7174
function.enchant-broker-request-dict.php           24-May-2024 16:04                7412
function.enchant-broker-request-pwl-dict.php       24-May-2024 16:04                5796
function.enchant-broker-set-dict-path.php          24-May-2024 16:04                5901
function.enchant-broker-set-ordering.php           24-May-2024 16:04                5170
function.enchant-dict-add-to-personal.php          24-May-2024 16:04                2255
function.enchant-dict-add-to-session.php           24-May-2024 16:04                4703
function.enchant-dict-add.php                      24-May-2024 16:04                6617
function.enchant-dict-check.php                    24-May-2024 16:04                4496
function.enchant-dict-describe.php                 24-May-2024 16:04                6792
function.enchant-dict-get-error.php                24-May-2024 16:04                4141
function.enchant-dict-is-added.php                 24-May-2024 16:04                4767
function.enchant-dict-is-in-session.php            24-May-2024 16:04                2241
function.enchant-dict-quick-check.php              24-May-2024 16:04                8586
function.enchant-dict-store-replacement.php        24-May-2024 16:04                4983
function.enchant-dict-suggest.php                  24-May-2024 16:04                7613
function.end.php                                   24-May-2024 16:05                6936
function.enum-exists.php                           24-May-2024 16:05                5585
function.error-clear-last.php                      24-May-2024 16:04                4673
function.error-get-last.php                        24-May-2024 16:04                5070
function.error-log.php                             24-May-2024 16:04               11575
function.error-reporting.php                       24-May-2024 16:04                9585
function.escapeshellarg.php                        24-May-2024 16:04                5701
function.escapeshellcmd.php                        24-May-2024 16:04                8087
function.eval.php                                  24-May-2024 16:05               10148
function.exec.php                                  24-May-2024 16:04               11434
function.exif-imagetype.php                        24-May-2024 16:04               10161
function.exif-read-data.php                        24-May-2024 16:04               22817
function.exif-tagname.php                          24-May-2024 16:04                4801
function.exif-thumbnail.php                        24-May-2024 16:04                9487
function.exit.php                                  24-May-2024 16:05                9520
function.exp.php                                   24-May-2024 16:04                4277
function.expect-expectl.php                        24-May-2024 16:04               11598
function.expect-popen.php                          24-May-2024 16:04                4737
function.explode.php                               24-May-2024 16:05               15286
function.expm1.php                                 24-May-2024 16:04                3435
function.extension-loaded.php                      24-May-2024 16:04                5881
function.extract.php                               24-May-2024 16:05               14887
function.ezmlm-hash.php                            24-May-2024 16:04                4641
function.fann-cascadetrain-on-data.php             24-May-2024 16:04                6691
function.fann-cascadetrain-on-file.php             24-May-2024 16:04                5637
function.fann-clear-scaling-params.php             24-May-2024 16:04                2774
function.fann-copy.php                             24-May-2024 16:04                3297
function.fann-create-from-file.php                 24-May-2024 16:04                3291
function.fann-create-shortcut-array.php            24-May-2024 16:04                4164
function.fann-create-shortcut.php                  24-May-2024 16:04                5184
function.fann-create-sparse-array.php              24-May-2024 16:04                4803
function.fann-create-sparse.php                    24-May-2024 16:04                5561
function.fann-create-standard-array.php            24-May-2024 16:04                4477
function.fann-create-standard.php                  24-May-2024 16:04                5252
function.fann-create-train-from-callback.php       24-May-2024 16:04                9122
function.fann-create-train.php                     24-May-2024 16:04                4660
function.fann-descale-input.php                    24-May-2024 16:04                3828
function.fann-descale-output.php                   24-May-2024 16:04                3844
function.fann-descale-train.php                    24-May-2024 16:04                3795
function.fann-destroy-train.php                    24-May-2024 16:04                2731
function.fann-destroy.php                          24-May-2024 16:04                2761
function.fann-duplicate-train-data.php             24-May-2024 16:04                2916
function.fann-get-activation-function.php          24-May-2024 16:04                5264
function.fann-get-activation-steepness.php         24-May-2024 16:04                5677
function.fann-get-bias-array.php                   24-May-2024 16:04                2610
function.fann-get-bit-fail-limit.php               24-May-2024 16:04                3824
function.fann-get-bit-fail.php                     24-May-2024 16:04                4912
function.fann-get-cascade-activation-functions-..> 24-May-2024 16:04                3861
function.fann-get-cascade-activation-functions.php 24-May-2024 16:04                4677
function.fann-get-cascade-activation-steepnesse..> 24-May-2024 16:04                3917
function.fann-get-cascade-activation-steepnesse..> 24-May-2024 16:04                4068
function.fann-get-cascade-candidate-change-frac..> 24-May-2024 16:04                5174
function.fann-get-cascade-candidate-limit.php      24-May-2024 16:04                3564
function.fann-get-cascade-candidate-stagnation-..> 24-May-2024 16:04                4300
function.fann-get-cascade-max-cand-epochs.php      24-May-2024 16:04                3446
function.fann-get-cascade-max-out-epochs.php       24-May-2024 16:04                3367
function.fann-get-cascade-min-cand-epochs.php      24-May-2024 16:04                3792
function.fann-get-cascade-min-out-epochs.php       24-May-2024 16:04                3749
function.fann-get-cascade-num-candidate-groups.php 24-May-2024 16:04                3844
function.fann-get-cascade-num-candidates.php       24-May-2024 16:04                5978
function.fann-get-cascade-output-change-fractio..> 24-May-2024 16:04                5102
function.fann-get-cascade-output-stagnation-epo..> 24-May-2024 16:04                4243
function.fann-get-cascade-weight-multiplier.php    24-May-2024 16:04                3522
function.fann-get-connection-array.php             24-May-2024 16:04                2637
function.fann-get-connection-rate.php              24-May-2024 16:04                2760
function.fann-get-errno.php                        24-May-2024 16:04                3167
function.fann-get-errstr.php                       24-May-2024 16:04                3172
function.fann-get-layer-array.php                  24-May-2024 16:04                2711
function.fann-get-learning-momentum.php            24-May-2024 16:04                3941
function.fann-get-learning-rate.php                24-May-2024 16:04                3841
function.fann-get-mse.php                          24-May-2024 16:04                3227
function.fann-get-network-type.php                 24-May-2024 16:04                2730
function.fann-get-num-input.php                    24-May-2024 16:04                2617
function.fann-get-num-layers.php                   24-May-2024 16:04                2672
function.fann-get-num-output.php                   24-May-2024 16:04                2636
function.fann-get-quickprop-decay.php              24-May-2024 16:04                3379
function.fann-get-quickprop-mu.php                 24-May-2024 16:04                3272
function.fann-get-rprop-decrease-factor.php        24-May-2024 16:04                3333
function.fann-get-rprop-delta-max.php              24-May-2024 16:04                3395
function.fann-get-rprop-delta-min.php              24-May-2024 16:04                3206
function.fann-get-rprop-delta-zero.php             24-May-2024 16:04                3579
function.fann-get-rprop-increase-factor.php        24-May-2024 16:04                3358
function.fann-get-sarprop-step-error-shift.php     24-May-2024 16:04                3709
function.fann-get-sarprop-step-error-threshold-..> 24-May-2024 16:04                3861
function.fann-get-sarprop-temperature.php          24-May-2024 16:04                3623
function.fann-get-sarprop-weight-decay-shift.php   24-May-2024 16:04                3690
function.fann-get-total-connections.php            24-May-2024 16:04                2809
function.fann-get-total-neurons.php                24-May-2024 16:04                2856
function.fann-get-train-error-function.php         24-May-2024 16:04                3611
function.fann-get-train-stop-function.php          24-May-2024 16:04                3597
function.fann-get-training-algorithm.php           24-May-2024 16:04                3831
function.fann-init-weights.php                     24-May-2024 16:04                4446
function.fann-length-train-data.php                24-May-2024 16:04                2936
function.fann-merge-train-data.php                 24-May-2024 16:04                3247
function.fann-num-input-train-data.php             24-May-2024 16:04                3567
function.fann-num-output-train-data.php            24-May-2024 16:04                3565
function.fann-print-error.php                      24-May-2024 16:04                2921
function.fann-randomize-weights.php                24-May-2024 16:04                4018
function.fann-read-train-from-file.php             24-May-2024 16:04                5013
function.fann-reset-errno.php                      24-May-2024 16:04                3097
function.fann-reset-errstr.php                     24-May-2024 16:04                3078
function.fann-reset-mse.php                        24-May-2024 16:04                3505
function.fann-run.php                              24-May-2024 16:04                2926
function.fann-save-train.php                       24-May-2024 16:04                3572
function.fann-save.php                             24-May-2024 16:04                4381
function.fann-scale-input-train-data.php           24-May-2024 16:04                4199
function.fann-scale-input.php                      24-May-2024 16:04                3842
function.fann-scale-output-train-data.php          24-May-2024 16:04                4227
function.fann-scale-output.php                     24-May-2024 16:04                3846
function.fann-scale-train-data.php                 24-May-2024 16:04                4197
function.fann-scale-train.php                      24-May-2024 16:04                3813
function.fann-set-activation-function-hidden.php   24-May-2024 16:04                4537
function.fann-set-activation-function-layer.php    24-May-2024 16:04                5051
function.fann-set-activation-function-output.php   24-May-2024 16:04                4553
function.fann-set-activation-function.php          24-May-2024 16:04                6528
function.fann-set-activation-steepness-hidden.php  24-May-2024 16:04                4823
function.fann-set-activation-steepness-layer.php   24-May-2024 16:04                5288
function.fann-set-activation-steepness-output.php  24-May-2024 16:04                4804
function.fann-set-activation-steepness.php         24-May-2024 16:04                6184
function.fann-set-bit-fail-limit.php               24-May-2024 16:04                3526
function.fann-set-callback.php                     24-May-2024 16:04                5699
function.fann-set-cascade-activation-functions.php 24-May-2024 16:04                4182
function.fann-set-cascade-activation-steepnesse..> 24-May-2024 16:04                4395
function.fann-set-cascade-candidate-change-frac..> 24-May-2024 16:04                3877
function.fann-set-cascade-candidate-limit.php      24-May-2024 16:04                3684
function.fann-set-cascade-candidate-stagnation-..> 24-May-2024 16:04                3939
function.fann-set-cascade-max-cand-epochs.php      24-May-2024 16:04                3685
function.fann-set-cascade-max-out-epochs.php       24-May-2024 16:04                3636
function.fann-set-cascade-min-cand-epochs.php      24-May-2024 16:04                4036
function.fann-set-cascade-min-out-epochs.php       24-May-2024 16:04                4018
function.fann-set-cascade-num-candidate-groups.php 24-May-2024 16:04                3770
function.fann-set-cascade-output-change-fractio..> 24-May-2024 16:04                3834
function.fann-set-cascade-output-stagnation-epo..> 24-May-2024 16:04                3900
function.fann-set-cascade-weight-multiplier.php    24-May-2024 16:04                3669
function.fann-set-error-log.php                    24-May-2024 16:04                2948
function.fann-set-input-scaling-params.php         24-May-2024 16:04                4573
function.fann-set-learning-momentum.php            24-May-2024 16:04                3910
function.fann-set-learning-rate.php                24-May-2024 16:04                3836
function.fann-set-output-scaling-params.php        24-May-2024 16:04                4593
function.fann-set-quickprop-decay.php              24-May-2024 16:04                3597
function.fann-set-quickprop-mu.php                 24-May-2024 16:04                3452
function.fann-set-rprop-decrease-factor.php        24-May-2024 16:04                3654
function.fann-set-rprop-delta-max.php              24-May-2024 16:04                3766
function.fann-set-rprop-delta-min.php              24-May-2024 16:04                3572
function.fann-set-rprop-delta-zero.php             24-May-2024 16:04                3954
function.fann-set-rprop-increase-factor.php        24-May-2024 16:04                3680
function.fann-set-sarprop-step-error-shift.php     24-May-2024 16:04                4086
function.fann-set-sarprop-step-error-threshold-..> 24-May-2024 16:04                4280
function.fann-set-sarprop-temperature.php          24-May-2024 16:04                3997
function.fann-set-sarprop-weight-decay-shift.php   24-May-2024 16:04                4080
function.fann-set-scaling-params.php               24-May-2024 16:04                5610
function.fann-set-train-error-function.php         24-May-2024 16:04                3866
function.fann-set-train-stop-function.php          24-May-2024 16:04                3854
function.fann-set-training-algorithm.php           24-May-2024 16:04                3802
function.fann-set-weight-array.php                 24-May-2024 16:04                3316
function.fann-set-weight.php                       24-May-2024 16:04                3764
function.fann-shuffle-train-data.php               24-May-2024 16:04                2931
function.fann-subset-train-data.php                24-May-2024 16:04                4277
function.fann-test-data.php                        24-May-2024 16:04                4170
function.fann-test.php                             24-May-2024 16:04                4525
function.fann-train-epoch.php                      24-May-2024 16:04                4544
function.fann-train-on-data.php                    24-May-2024 16:04                6520
function.fann-train-on-file.php                    24-May-2024 16:04                6510
function.fann-train.php                            24-May-2024 16:04                4637
function.fastcgi-finish-request.php                24-May-2024 16:05                2804
function.fbird-add-user.php                        24-May-2024 16:04                2379
function.fbird-affected-rows.php                   24-May-2024 16:04                2397
function.fbird-backup.php                          24-May-2024 16:04                1810
function.fbird-blob-add.php                        24-May-2024 16:04                2720
function.fbird-blob-cancel.php                     24-May-2024 16:04                3749
function.fbird-blob-close.php                      24-May-2024 16:04                2751
function.fbird-blob-create.php                     24-May-2024 16:04                2751
function.fbird-blob-echo.php                       24-May-2024 16:04                2554
function.fbird-blob-get.php                        24-May-2024 16:04                2547
function.fbird-blob-import.php                     24-May-2024 16:04                2747
function.fbird-blob-info.php                       24-May-2024 16:04                1842
function.fbird-blob-open.php                       24-May-2024 16:04                2544
function.fbird-close.php                           24-May-2024 16:04                2320
function.fbird-commit-ret.php                      24-May-2024 16:04                1835
function.fbird-commit.php                          24-May-2024 16:04                1803
function.fbird-connect.php                         24-May-2024 16:04                2326
function.fbird-db-info.php                         24-May-2024 16:04                1816
function.fbird-delete-user.php                     24-May-2024 16:04                2394
function.fbird-drop-db.php                         24-May-2024 16:04                2342
function.fbird-errcode.php                         24-May-2024 16:04                2155
function.fbird-errmsg.php                          24-May-2024 16:04                2148
function.fbird-execute.php                         24-May-2024 16:04                2160
function.fbird-fetch-assoc.php                     24-May-2024 16:04                2410
function.fbird-fetch-object.php                    24-May-2024 16:04                2421
function.fbird-fetch-row.php                       24-May-2024 16:04                2398
function.fbird-field-info.php                      24-May-2024 16:04                2230
function.fbird-free-event-handler.php              24-May-2024 16:04                2334
function.fbird-free-query.php                      24-May-2024 16:04                1871
function.fbird-free-result.php                     24-May-2024 16:04                1856
function.fbird-gen-id.php                          24-May-2024 16:04                1813
function.fbird-maintain-db.php                     24-May-2024 16:04                1858
function.fbird-modify-user.php                     24-May-2024 16:04                2410
function.fbird-name-result.php                     24-May-2024 16:04                2393
function.fbird-num-fields.php                      24-May-2024 16:04                2219
function.fbird-num-params.php                      24-May-2024 16:04                2388
function.fbird-param-info.php                      24-May-2024 16:04                2393
function.fbird-pconnect.php                        24-May-2024 16:04                2343
function.fbird-prepare.php                         24-May-2024 16:04                1806
function.fbird-query.php                           24-May-2024 16:04                2679
function.fbird-restore.php                         24-May-2024 16:04                1813
function.fbird-rollback-ret.php                    24-May-2024 16:04                1865
function.fbird-rollback.php                        24-May-2024 16:04                1837
function.fbird-server-info.php                     24-May-2024 16:04                1868
function.fbird-service-attach.php                  24-May-2024 16:04                1907
function.fbird-service-detach.php                  24-May-2024 16:04                1919
function.fbird-set-event-handler.php               24-May-2024 16:04                2503
function.fbird-trans.php                           24-May-2024 16:04                1812
function.fbird-wait-event.php                      24-May-2024 16:04                2428
function.fclose.php                                24-May-2024 16:04                4652
function.fdatasync.php                             24-May-2024 16:04                6272
function.fdf-add-doc-javascript.php                24-May-2024 16:04                5707
function.fdf-add-template.php                      24-May-2024 16:04                2984
function.fdf-close.php                             24-May-2024 16:04                3165
function.fdf-create.php                            24-May-2024 16:04                5764
function.fdf-enum-values.php                       24-May-2024 16:04                2563
function.fdf-errno.php                             24-May-2024 16:04                2920
function.fdf-error.php                             24-May-2024 16:04                3319
function.fdf-get-ap.php                            24-May-2024 16:04                4483
function.fdf-get-attachment.php                    24-May-2024 16:04                6411
function.fdf-get-encoding.php                      24-May-2024 16:04                3509
function.fdf-get-file.php                          24-May-2024 16:04                3275
function.fdf-get-flags.php                         24-May-2024 16:04                2472
function.fdf-get-opt.php                           24-May-2024 16:04                2515
function.fdf-get-status.php                        24-May-2024 16:04                3270
function.fdf-get-value.php                         24-May-2024 16:04                4752
function.fdf-get-version.php                       24-May-2024 16:04                3800
function.fdf-header.php                            24-May-2024 16:04                2418
function.fdf-next-field-name.php                   24-May-2024 16:04                5516
function.fdf-open-string.php                       24-May-2024 16:04                5114
function.fdf-open.php                              24-May-2024 16:04                6191
function.fdf-remove-item.php                       24-May-2024 16:04                2499
function.fdf-save-string.php                       24-May-2024 16:04                5787
function.fdf-save.php                              24-May-2024 16:04                4281
function.fdf-set-ap.php                            24-May-2024 16:04                4752
function.fdf-set-encoding.php                      24-May-2024 16:04                3961
function.fdf-set-file.php                          24-May-2024 16:04                7042
function.fdf-set-flags.php                         24-May-2024 16:04                4525
function.fdf-set-javascript-action.php             24-May-2024 16:04                4744
function.fdf-set-on-import-javascript.php          24-May-2024 16:04                3319
function.fdf-set-opt.php                           24-May-2024 16:04                4820
function.fdf-set-status.php                        24-May-2024 16:04                3924
function.fdf-set-submit-form-action.php            24-May-2024 16:04                5048
function.fdf-set-target-frame.php                  24-May-2024 16:04                3927
function.fdf-set-value.php                         24-May-2024 16:04                5614
function.fdf-set-version.php                       24-May-2024 16:04                4289
function.fdiv.php                                  24-May-2024 16:04                6494
function.feof.php                                  24-May-2024 16:04                8170
function.fflush.php                                24-May-2024 16:04                5908
function.fgetc.php                                 24-May-2024 16:04                6911
function.fgetcsv.php                               24-May-2024 16:04               13873
function.fgets.php                                 24-May-2024 16:04                8999
function.fgetss.php                                24-May-2024 16:04               10050
function.file-exists.php                           24-May-2024 16:04                7708
function.file-get-contents.php                     24-May-2024 16:04               19678
function.file-put-contents.php                     24-May-2024 16:04               13937
function.file.php                                  24-May-2024 16:04               12602
function.fileatime.php                             24-May-2024 16:04                7344
function.filectime.php                             24-May-2024 16:04                7285
function.filegroup.php                             24-May-2024 16:04                6122
function.fileinode.php                             24-May-2024 16:04                5535
function.filemtime.php                             24-May-2024 16:04                6931
function.fileowner.php                             24-May-2024 16:04                5883
function.fileperms.php                             24-May-2024 16:04               16805
function.filesize.php                              24-May-2024 16:04                6119
function.filetype.php                              24-May-2024 16:04                7107
function.filter-has-var.php                        24-May-2024 16:05                3476
function.filter-id.php                             24-May-2024 16:05                3046
function.filter-input-array.php                    24-May-2024 16:05               14157
function.filter-input.php                          24-May-2024 16:05                8976
function.filter-list.php                           24-May-2024 16:05                3822
function.filter-var-array.php                      24-May-2024 16:05               12557
function.filter-var.php                            24-May-2024 16:05               14873
function.finfo-buffer.php                          24-May-2024 16:04                8652
function.finfo-close.php                           24-May-2024 16:04                3758
function.finfo-file.php                            24-May-2024 16:04                9292
function.finfo-open.php                            24-May-2024 16:04               10640
function.finfo-set-flags.php                       24-May-2024 16:04                4832
function.floatval.php                              24-May-2024 16:05                6958
function.flock.php                                 24-May-2024 16:04               14051
function.floor.php                                 24-May-2024 16:04                5088
function.flush.php                                 24-May-2024 16:04                5042
function.fmod.php                                  24-May-2024 16:04                5013
function.fnmatch.php                               24-May-2024 16:04               12216
function.fopen.php                                 24-May-2024 16:04               25483
function.forward-static-call-array.php             24-May-2024 16:05                9748
function.forward-static-call.php                   24-May-2024 16:05                9083
function.fpassthru.php                             24-May-2024 16:04                7819
function.fpm-get-status.php                        24-May-2024 16:05                2971
function.fprintf.php                               24-May-2024 16:05               24661
function.fputcsv.php                               24-May-2024 16:04               11087
function.fputs.php                                 24-May-2024 16:04                1719
function.fread.php                                 24-May-2024 16:04               15359
function.frenchtojd.php                            24-May-2024 16:04                4222
function.fscanf.php                                24-May-2024 16:04                9802
function.fseek.php                                 24-May-2024 16:04                8502
function.fsockopen.php                             24-May-2024 16:05               18171
function.fstat.php                                 24-May-2024 16:04                6328
function.fsync.php                                 24-May-2024 16:04                6040
function.ftell.php                                 24-May-2024 16:04                6505
function.ftok.php                                  24-May-2024 16:04                3854
function.ftp-alloc.php                             24-May-2024 16:05                8879
function.ftp-append.php                            24-May-2024 16:05                4788
function.ftp-cdup.php                              24-May-2024 16:05                6782
function.ftp-chdir.php                             24-May-2024 16:05                7690
function.ftp-chmod.php                             24-May-2024 16:05                7352
function.ftp-close.php                             24-May-2024 16:05                6305
function.ftp-connect.php                           24-May-2024 16:05                6982
function.ftp-delete.php                            24-May-2024 16:05                6455
function.ftp-exec.php                              24-May-2024 16:05                7021
function.ftp-fget.php                              24-May-2024 16:05               10681
function.ftp-fput.php                              24-May-2024 16:05               10025
function.ftp-get-option.php                        24-May-2024 16:05                6528
function.ftp-get.php                               24-May-2024 16:05                9907
function.ftp-login.php                             24-May-2024 16:05                7079
function.ftp-mdtm.php                              24-May-2024 16:05                7346
function.ftp-mkdir.php                             24-May-2024 16:05                7231
function.ftp-mlsd.php                              24-May-2024 16:05                9443
function.ftp-nb-continue.php                       24-May-2024 16:05                5732
function.ftp-nb-fget.php                           24-May-2024 16:05               11136
function.ftp-nb-fput.php                           24-May-2024 16:05               10937
function.ftp-nb-get.php                            24-May-2024 16:05               15088
function.ftp-nb-put.php                            24-May-2024 16:05               12244
function.ftp-nlist.php                             24-May-2024 16:05                7208
function.ftp-pasv.php                              24-May-2024 16:05                7735
function.ftp-put.php                               24-May-2024 16:05                9547
function.ftp-pwd.php                               24-May-2024 16:05                6246
function.ftp-quit.php                              24-May-2024 16:05                1713
function.ftp-raw.php                               24-May-2024 16:05                5903
function.ftp-rawlist.php                           24-May-2024 16:05                8555
function.ftp-rename.php                            24-May-2024 16:05                7523
function.ftp-rmdir.php                             24-May-2024 16:05                6781
function.ftp-set-option.php                        24-May-2024 16:05                8091
function.ftp-site.php                              24-May-2024 16:05                7122
function.ftp-size.php                              24-May-2024 16:05                7057
function.ftp-ssl-connect.php                       24-May-2024 16:05                9619
function.ftp-systype.php                           24-May-2024 16:05                5752
function.ftruncate.php                             24-May-2024 16:04                6719
function.func-get-arg.php                          24-May-2024 16:05               11444
function.func-get-args.php                         24-May-2024 16:05               12150
function.func-num-args.php                         24-May-2024 16:05                6094
function.function-exists.php                       24-May-2024 16:05                6352
function.fwrite.php                                24-May-2024 16:04               15357
function.gc-collect-cycles.php                     24-May-2024 16:04                2643
function.gc-disable.php                            24-May-2024 16:04                2627
function.gc-enable.php                             24-May-2024 16:04                2604
function.gc-enabled.php                            24-May-2024 16:04                3455
function.gc-mem-caches.php                         24-May-2024 16:04                2629
function.gc-status.php                             24-May-2024 16:04                8869
function.gd-info.php                               24-May-2024 16:04               10171
function.geoip-asnum-by-name.php                   24-May-2024 16:04                4288
function.geoip-continent-code-by-name.php          24-May-2024 16:04                5880
function.geoip-country-code-by-name.php            24-May-2024 16:04                5605
function.geoip-country-code3-by-name.php           24-May-2024 16:04                5132
function.geoip-country-name-by-name.php            24-May-2024 16:04                5090
function.geoip-database-info.php                   24-May-2024 16:04                4548
function.geoip-db-avail.php                        24-May-2024 16:04                4881
function.geoip-db-filename.php                     24-May-2024 16:04                4416
function.geoip-db-get-all-info.php                 24-May-2024 16:04                6983
function.geoip-domain-by-name.php                  24-May-2024 16:04                4648
function.geoip-id-by-name.php                      24-May-2024 16:04                5588
function.geoip-isp-by-name.php                     24-May-2024 16:04                4626
function.geoip-netspeedcell-by-name.php            24-May-2024 16:04                5384
function.geoip-org-by-name.php                     24-May-2024 16:04                4638
function.geoip-record-by-name.php                  24-May-2024 16:04                8189
function.geoip-region-by-name.php                  24-May-2024 16:04                5314
function.geoip-region-name-by-code.php             24-May-2024 16:04                7469
function.geoip-setup-custom-directory.php          24-May-2024 16:04                4342
function.geoip-time-zone-by-country-and-region.php 24-May-2024 16:04                7738
function.get-browser.php                           24-May-2024 16:05                9139
function.get-called-class.php                      24-May-2024 16:05                6468
function.get-cfg-var.php                           24-May-2024 16:04                4032
function.get-class-methods.php                     24-May-2024 16:05                7197
function.get-class-vars.php                        24-May-2024 16:05                9920
function.get-class.php                             24-May-2024 16:05               13458
function.get-current-user.php                      24-May-2024 16:04                4421
function.get-debug-type.php                        24-May-2024 16:05                9749
function.get-declared-classes.php                  24-May-2024 16:05                5627
function.get-declared-interfaces.php               24-May-2024 16:05                4484
function.get-declared-traits.php                   24-May-2024 16:05                2966
function.get-defined-constants.php                 24-May-2024 16:04                7773
function.get-defined-functions.php                 24-May-2024 16:05                7241
function.get-defined-vars.php                      24-May-2024 16:05                6308
function.get-extension-funcs.php                   24-May-2024 16:04                5764
function.get-headers.php                           24-May-2024 16:05                9685
function.get-html-translation-table.php            24-May-2024 16:05               14934
function.get-include-path.php                      24-May-2024 16:04                4500
function.get-included-files.php                    24-May-2024 16:04                6252
function.get-loaded-extensions.php                 24-May-2024 16:04                5794
function.get-magic-quotes-gpc.php                  24-May-2024 16:04                4300
function.get-magic-quotes-runtime.php              24-May-2024 16:04                3774
function.get-mangled-object-vars.php               24-May-2024 16:05                8304
function.get-meta-tags.php                         24-May-2024 16:05                8248
function.get-object-vars.php                       24-May-2024 16:05                6339
function.get-parent-class.php                      24-May-2024 16:05                8171
function.get-required-files.php                    24-May-2024 16:04                1889
function.get-resource-id.php                       24-May-2024 16:05                4858
function.get-resource-type.php                     24-May-2024 16:05                5529
function.get-resources.php                         24-May-2024 16:04                8270
function.getallheaders.php                         24-May-2024 16:05                4968
function.getcwd.php                                24-May-2024 16:04                5766
function.getdate.php                               24-May-2024 16:04                9497
function.getenv.php                                24-May-2024 16:04                8809
function.gethostbyaddr.php                         24-May-2024 16:05                4604
function.gethostbyname.php                         24-May-2024 16:05                4714
function.gethostbynamel.php                        24-May-2024 16:05                5356
function.gethostname.php                           24-May-2024 16:05                4144
function.getimagesize.php                          24-May-2024 16:04               18464
function.getimagesizefromstring.php                24-May-2024 16:04                5783
function.getlastmod.php                            24-May-2024 16:04                5362
function.getmxrr.php                               24-May-2024 16:05                6486
function.getmygid.php                              24-May-2024 16:04                3580
function.getmyinode.php                            24-May-2024 16:04                3582
function.getmypid.php                              24-May-2024 16:04                3965
function.getmyuid.php                              24-May-2024 16:04                3544
function.getopt.php                                24-May-2024 16:04               16110
function.getprotobyname.php                        24-May-2024 16:05                4778
function.getprotobynumber.php                      24-May-2024 16:05                3417
function.getrandmax.php                            24-May-2024 16:05                3026
function.getrusage.php                             24-May-2024 16:04               11710
function.getservbyname.php                         24-May-2024 16:05                6686
function.getservbyport.php                         24-May-2024 16:05                4054
function.gettext.php                               24-May-2024 16:04                6017
function.gettimeofday.php                          24-May-2024 16:04                4929
function.gettype.php                               24-May-2024 16:05                9144
function.glob.php                                  24-May-2024 16:04               11876
function.gmdate.php                                24-May-2024 16:04                7939
function.gmmktime.php                              24-May-2024 16:04               11744
function.gmp-abs.php                               24-May-2024 16:04                4440
function.gmp-add.php                               24-May-2024 16:04                4743
function.gmp-and.php                               24-May-2024 16:04                5236
function.gmp-binomial.php                          24-May-2024 16:04                4025
function.gmp-clrbit.php                            24-May-2024 16:04                5781
function.gmp-cmp.php                               24-May-2024 16:04                5661
function.gmp-com.php                               24-May-2024 16:04                3946
function.gmp-div-q.php                             24-May-2024 16:04                9941
function.gmp-div-qr.php                            24-May-2024 16:04                6632
function.gmp-div-r.php                             24-May-2024 16:04                6184
function.gmp-div.php                               24-May-2024 16:04                1732
function.gmp-divexact.php                          24-May-2024 16:04                5916
function.gmp-export.php                            24-May-2024 16:04                5900
function.gmp-fact.php                              24-May-2024 16:04                4849
function.gmp-gcd.php                               24-May-2024 16:04                5205
function.gmp-gcdext.php                            24-May-2024 16:04                9406
function.gmp-hamdist.php                           24-May-2024 16:04                6636
function.gmp-import.php                            24-May-2024 16:04                6221
function.gmp-init.php                              24-May-2024 16:04                5990
function.gmp-intval.php                            24-May-2024 16:04                5339
function.gmp-invert.php                            24-May-2024 16:04                5404
function.gmp-jacobi.php                            24-May-2024 16:04                5742
function.gmp-kronecker.php                         24-May-2024 16:04                4047
function.gmp-lcm.php                               24-May-2024 16:04                3803
function.gmp-legendre.php                          24-May-2024 16:04                5758
function.gmp-mod.php                               24-May-2024 16:04                4924
function.gmp-mul.php                               24-May-2024 16:04                4960
function.gmp-neg.php                               24-May-2024 16:04                4429
function.gmp-nextprime.php                         24-May-2024 16:04                5112
function.gmp-or.php                                24-May-2024 16:04                5460
function.gmp-perfect-power.php                     24-May-2024 16:04                3447
function.gmp-perfect-square.php                    24-May-2024 16:04                5686
function.gmp-popcount.php                          24-May-2024 16:04                4902
function.gmp-pow.php                               24-May-2024 16:04                5841
function.gmp-powm.php                              24-May-2024 16:04                5874
function.gmp-prob-prime.php                        24-May-2024 16:04                5963
function.gmp-random-bits.php                       24-May-2024 16:04                6204
function.gmp-random-range.php                      24-May-2024 16:04                7578
function.gmp-random-seed.php                       24-May-2024 16:04                7701
function.gmp-random.php                            24-May-2024 16:04                6579
function.gmp-root.php                              24-May-2024 16:04                3175
function.gmp-rootrem.php                           24-May-2024 16:04                3375
function.gmp-scan0.php                             24-May-2024 16:04                5656
function.gmp-scan1.php                             24-May-2024 16:04                5708
function.gmp-setbit.php                            24-May-2024 16:04               12239
function.gmp-sign.php                              24-May-2024 16:04                5145
function.gmp-sqrt.php                              24-May-2024 16:04                4978
function.gmp-sqrtrem.php                           24-May-2024 16:04                6474
function.gmp-strval.php                            24-May-2024 16:04                4718
function.gmp-sub.php                               24-May-2024 16:04                5033
function.gmp-testbit.php                           24-May-2024 16:04                6174
function.gmp-xor.php                               24-May-2024 16:04                5481
function.gmstrftime.php                            24-May-2024 16:04                9540
function.gnupg-adddecryptkey.php                   24-May-2024 16:04                5444
function.gnupg-addencryptkey.php                   24-May-2024 16:04                4991
function.gnupg-addsignkey.php                      24-May-2024 16:04                5469
function.gnupg-cleardecryptkeys.php                24-May-2024 16:04                4523
function.gnupg-clearencryptkeys.php                24-May-2024 16:04                4531
function.gnupg-clearsignkeys.php                   24-May-2024 16:04                4473
function.gnupg-decrypt.php                         24-May-2024 16:04                6255
function.gnupg-decryptverify.php                   24-May-2024 16:04                7341
function.gnupg-deletekey.php                       24-May-2024 16:04                5254
function.gnupg-encrypt.php                         24-May-2024 16:04                6143
function.gnupg-encryptsign.php                     24-May-2024 16:04                7081
function.gnupg-export.php                          24-May-2024 16:04                5329
function.gnupg-getengineinfo.php                   24-May-2024 16:04                5704
function.gnupg-geterror.php                        24-May-2024 16:04                4454
function.gnupg-geterrorinfo.php                    24-May-2024 16:04                5763
function.gnupg-getprotocol.php                     24-May-2024 16:04                4552
function.gnupg-gettrustlist.php                    24-May-2024 16:04                5362
function.gnupg-import.php                          24-May-2024 16:04                5597
function.gnupg-init.php                            24-May-2024 16:04                7443
function.gnupg-keyinfo.php                         24-May-2024 16:04                5524
function.gnupg-listsignatures.php                  24-May-2024 16:04                5559
function.gnupg-setarmor.php                        24-May-2024 16:04                5809
function.gnupg-seterrormode.php                    24-May-2024 16:04                5838
function.gnupg-setsignmode.php                     24-May-2024 16:04                5912
function.gnupg-sign.php                            24-May-2024 16:04                6379
function.gnupg-verify.php                          24-May-2024 16:04                8696
function.grapheme-extract.php                      24-May-2024 16:04                9284
function.grapheme-stripos.php                      24-May-2024 16:04                8675
function.grapheme-stristr.php                      24-May-2024 16:04                8220
function.grapheme-strlen.php                       24-May-2024 16:04                5698
function.grapheme-strpos.php                       24-May-2024 16:04                8324
function.grapheme-strripos.php                     24-May-2024 16:04                8084
function.grapheme-strrpos.php                      24-May-2024 16:04                7730
function.grapheme-strstr.php                       24-May-2024 16:04                7859
function.grapheme-substr.php                       24-May-2024 16:04                8473
function.gregoriantojd.php                         24-May-2024 16:04                8201
function.gzclose.php                               24-May-2024 16:04                4474
function.gzcompress.php                            24-May-2024 16:04                6271
function.gzdecode.php                              24-May-2024 16:04                3979
function.gzdeflate.php                             24-May-2024 16:04                5894
function.gzencode.php                              24-May-2024 16:04                7458
function.gzeof.php                                 24-May-2024 16:04                4410
function.gzfile.php                                24-May-2024 16:04                4963
function.gzgetc.php                                24-May-2024 16:04                4976
function.gzgets.php                                24-May-2024 16:04                6602
function.gzgetss.php                               24-May-2024 16:04                6478
function.gzinflate.php                             24-May-2024 16:04                5707
function.gzopen.php                                24-May-2024 16:04                6153
function.gzpassthru.php                            24-May-2024 16:04                5094
function.gzputs.php                                24-May-2024 16:04                1699
function.gzread.php                                24-May-2024 16:04                7178
function.gzrewind.php                              24-May-2024 16:04                3598
function.gzseek.php                                24-May-2024 16:04                7025
function.gztell.php                                24-May-2024 16:04                3787
function.gzuncompress.php                          24-May-2024 16:04                5565
function.gzwrite.php                               24-May-2024 16:04                7135
function.halt-compiler.php                         24-May-2024 16:05                5273
function.hash-algos.php                            24-May-2024 16:04                5941
function.hash-copy.php                             24-May-2024 16:04                5675
function.hash-equals.php                           24-May-2024 16:04                7489
function.hash-file.php                             24-May-2024 16:04                8120
function.hash-final.php                            24-May-2024 16:04                5312
function.hash-hkdf.php                             24-May-2024 16:04               10581
function.hash-hmac-algos.php                       24-May-2024 16:04                5509
function.hash-hmac-file.php                        24-May-2024 16:04                8974
function.hash-hmac.php                             24-May-2024 16:04                8543
function.hash-init.php                             24-May-2024 16:04               11149
function.hash-pbkdf2.php                           24-May-2024 16:04               13110
function.hash-update-file.php                      24-May-2024 16:04                6248
function.hash-update-stream.php                    24-May-2024 16:04                7752
function.hash-update.php                           24-May-2024 16:04                4716
function.hash.php                                  24-May-2024 16:04                7853
function.header-register-callback.php              24-May-2024 16:05                7113
function.header-remove.php                         24-May-2024 16:05                7168
function.header.php                                24-May-2024 16:05               21534
function.headers-list.php                          24-May-2024 16:05                6384
function.headers-sent.php                          24-May-2024 16:05                8751
function.hebrev.php                                24-May-2024 16:05                3481
function.hebrevc.php                               24-May-2024 16:05                3923
function.hex2bin.php                               24-May-2024 16:05                5201
function.hexdec.php                                24-May-2024 16:04                6609
function.highlight-file.php                        24-May-2024 16:05                6483
function.highlight-string.php                      24-May-2024 16:05                7284
function.hrtime.php                                24-May-2024 16:05                5593
function.html-entity-decode.php                    24-May-2024 16:05               15748
function.htmlentities.php                          24-May-2024 16:05               18787
function.htmlspecialchars-decode.php               24-May-2024 16:05                9934
function.htmlspecialchars.php                      24-May-2024 16:05               24714
function.http-build-query.php                      24-May-2024 16:05               20214
function.http-response-code.php                    24-May-2024 16:05                7586
function.hypot.php                                 24-May-2024 16:04                3091
function.ibase-add-user.php                        24-May-2024 16:04                5204
function.ibase-affected-rows.php                   24-May-2024 16:04                3614
function.ibase-backup.php                          24-May-2024 16:04               10499
function.ibase-blob-add.php                        24-May-2024 16:04                4110
function.ibase-blob-cancel.php                     24-May-2024 16:04                3815
function.ibase-blob-close.php                      24-May-2024 16:04                4158
function.ibase-blob-create.php                     24-May-2024 16:04                4223
function.ibase-blob-echo.php                       24-May-2024 16:04                4418
function.ibase-blob-get.php                        24-May-2024 16:04                6760
function.ibase-blob-import.php                     24-May-2024 16:04                8239
function.ibase-blob-info.php                       24-May-2024 16:04                3608
function.ibase-blob-open.php                       24-May-2024 16:04                4646
function.ibase-close.php                           24-May-2024 16:04                4085
function.ibase-commit-ret.php                      24-May-2024 16:04                3517
function.ibase-commit.php                          24-May-2024 16:04                3315
function.ibase-connect.php                         24-May-2024 16:04               11079
function.ibase-db-info.php                         24-May-2024 16:04                2811
function.ibase-delete-user.php                     24-May-2024 16:04                3620
function.ibase-drop-db.php                         24-May-2024 16:04                3908
function.ibase-errcode.php                         24-May-2024 16:04                2789
function.ibase-errmsg.php                          24-May-2024 16:04                2794
function.ibase-execute.php                         24-May-2024 16:04                7208
function.ibase-fetch-assoc.php                     24-May-2024 16:04                4923
function.ibase-fetch-object.php                    24-May-2024 16:04                6768
function.ibase-fetch-row.php                       24-May-2024 16:04                4777
function.ibase-field-info.php                      24-May-2024 16:04                7035
function.ibase-free-event-handler.php              24-May-2024 16:04                3681
function.ibase-free-query.php                      24-May-2024 16:04                2928
function.ibase-free-result.php                     24-May-2024 16:04                3018
function.ibase-gen-id.php                          24-May-2024 16:04                2980
function.ibase-maintain-db.php                     24-May-2024 16:04                3263
function.ibase-modify-user.php                     24-May-2024 16:04                5209
function.ibase-name-result.php                     24-May-2024 16:04                5867
function.ibase-num-fields.php                      24-May-2024 16:04                6464
function.ibase-num-params.php                      24-May-2024 16:04                3554
function.ibase-param-info.php                      24-May-2024 16:04                3818
function.ibase-pconnect.php                        24-May-2024 16:04                8579
function.ibase-prepare.php                         24-May-2024 16:04                4673
function.ibase-query.php                           24-May-2024 16:04                7451
function.ibase-restore.php                         24-May-2024 16:04               10790
function.ibase-rollback-ret.php                    24-May-2024 16:04                3575
function.ibase-rollback.php                        24-May-2024 16:04                3387
function.ibase-server-info.php                     24-May-2024 16:04                9959
function.ibase-service-attach.php                  24-May-2024 16:04               11308
function.ibase-service-detach.php                  24-May-2024 16:04                6268
function.ibase-set-event-handler.php               24-May-2024 16:04                8216
function.ibase-trans.php                           24-May-2024 16:04                6533
function.ibase-wait-event.php                      24-May-2024 16:04                4492
function.iconv-get-encoding.php                    24-May-2024 16:04                5821
function.iconv-mime-decode-headers.php             24-May-2024 16:04               11032
function.iconv-mime-decode.php                     24-May-2024 16:04                8867
function.iconv-mime-encode.php                     24-May-2024 16:04               12300
function.iconv-set-encoding.php                    24-May-2024 16:04                5075
function.iconv-strlen.php                          24-May-2024 16:04                5245
function.iconv-strpos.php                          24-May-2024 16:04                7842
function.iconv-strrpos.php                         24-May-2024 16:04                7045
function.iconv-substr.php                          24-May-2024 16:04                8799
function.iconv.php                                 24-May-2024 16:04                9384
function.idate.php                                 24-May-2024 16:04               11832
function.idn-to-ascii.php                          24-May-2024 16:04                8331
function.idn-to-utf8.php                           24-May-2024 16:04                8353
function.igbinary-serialize.php                    24-May-2024 16:04               10580
function.igbinary-unserialize.php                  24-May-2024 16:04               11058
function.ignore-user-abort.php                     24-May-2024 16:05                7923
function.image-type-to-extension.php               24-May-2024 16:04                5576
function.image-type-to-mime-type.php               24-May-2024 16:04                9140
function.image2wbmp.php                            24-May-2024 16:04                6845
function.imageaffine.php                           24-May-2024 16:04                5171
function.imageaffinematrixconcat.php               24-May-2024 16:04                6743
function.imageaffinematrixget.php                  24-May-2024 16:04                6855
function.imagealphablending.php                    24-May-2024 16:04                8127
function.imageantialias.php                        24-May-2024 16:04               11610
function.imagearc.php                              24-May-2024 16:04               14021
function.imageavif.php                             24-May-2024 16:04                6554
function.imagebmp.php                              24-May-2024 16:04                8699
function.imagechar.php                             24-May-2024 16:04               10360
function.imagecharup.php                           24-May-2024 16:04               10259
function.imagecolorallocate.php                    24-May-2024 16:04               10428
function.imagecolorallocatealpha.php               24-May-2024 16:04               18752
function.imagecolorat.php                          24-May-2024 16:04               10708
function.imagecolorclosest.php                     24-May-2024 16:04               12430
function.imagecolorclosestalpha.php                24-May-2024 16:04               12821
function.imagecolorclosesthwb.php                  24-May-2024 16:04                6847
function.imagecolordeallocate.php                  24-May-2024 16:04                6157
function.imagecolorexact.php                       24-May-2024 16:04                8857
function.imagecolorexactalpha.php                  24-May-2024 16:04                9863
function.imagecolormatch.php                       24-May-2024 16:04                8750
function.imagecolorresolve.php                     24-May-2024 16:04                8038
function.imagecolorresolvealpha.php                24-May-2024 16:04                8785
function.imagecolorset.php                         24-May-2024 16:04                9329
function.imagecolorsforindex.php                   24-May-2024 16:04                7813
function.imagecolorstotal.php                      24-May-2024 16:04                6059
function.imagecolortransparent.php                 24-May-2024 16:04                9485
function.imageconvolution.php                      24-May-2024 16:04               12183
function.imagecopy.php                             24-May-2024 16:04                9752
function.imagecopymerge.php                        24-May-2024 16:04               10138
function.imagecopymergegray.php                    24-May-2024 16:04               10863
function.imagecopyresampled.php                    24-May-2024 16:04               19899
function.imagecopyresized.php                      24-May-2024 16:04               14762
function.imagecreate.php                           24-May-2024 16:04                8627
function.imagecreatefromavif.php                   24-May-2024 16:04                3024
function.imagecreatefrombmp.php                    24-May-2024 16:04                5901
function.imagecreatefromgd.php                     24-May-2024 16:04                6550
function.imagecreatefromgd2.php                    24-May-2024 16:04                6829
function.imagecreatefromgd2part.php                24-May-2024 16:04                9447
function.imagecreatefromgif.php                    24-May-2024 16:04               10105
function.imagecreatefromjpeg.php                   24-May-2024 16:04                9716
function.imagecreatefrompng.php                    24-May-2024 16:04                9666
function.imagecreatefromstring.php                 24-May-2024 16:04                8661
function.imagecreatefromtga.php                    24-May-2024 16:04                3764
function.imagecreatefromwbmp.php                   24-May-2024 16:04                9802
function.imagecreatefromwebp.php                   24-May-2024 16:04                6072
function.imagecreatefromxbm.php                    24-May-2024 16:04                5899
function.imagecreatefromxpm.php                    24-May-2024 16:04                6605
function.imagecreatetruecolor.php                  24-May-2024 16:04                7506
function.imagecrop.php                             24-May-2024 16:04                8271
function.imagecropauto.php                         24-May-2024 16:04               12190
function.imagedashedline.php                       24-May-2024 16:04               13065
function.imagedestroy.php                          24-May-2024 16:04                5559
function.imageellipse.php                          24-May-2024 16:04               10434
function.imagefill.php                             24-May-2024 16:04                7900
function.imagefilledarc.php                        24-May-2024 16:04               19301
function.imagefilledellipse.php                    24-May-2024 16:04               10153
function.imagefilledpolygon.php                    24-May-2024 16:04               12584
function.imagefilledrectangle.php                  24-May-2024 16:04                8774
function.imagefilltoborder.php                     24-May-2024 16:04               11797
function.imagefilter.php                           24-May-2024 16:04               34842
function.imageflip.php                             24-May-2024 16:04               10195
function.imagefontheight.php                       24-May-2024 16:04                6802
function.imagefontwidth.php                        24-May-2024 16:04                6757
function.imageftbbox.php                           24-May-2024 16:04               14702
function.imagefttext.php                           24-May-2024 16:04               16778
function.imagegammacorrect.php                     24-May-2024 16:04                6327
function.imagegd.php                               24-May-2024 16:04               11434
function.imagegd2.php                              24-May-2024 16:04               12368
function.imagegetclip.php                          24-May-2024 16:04                6307
function.imagegetinterpolation.php                 24-May-2024 16:04                3920
function.imagegif.php                              24-May-2024 16:04               17346
function.imagegrabscreen.php                       24-May-2024 16:04                5113
function.imagegrabwindow.php                       24-May-2024 16:04               10428
function.imageinterlace.php                        24-May-2024 16:04                7874
function.imageistruecolor.php                      24-May-2024 16:04                7748
function.imagejpeg.php                             24-May-2024 16:04               15757
function.imagelayereffect.php                      24-May-2024 16:04               12695
function.imageline.php                             24-May-2024 16:04               15867
function.imageloadfont.php                         24-May-2024 16:04                9811
function.imageopenpolygon.php                      24-May-2024 16:04               10959
function.imagepalettecopy.php                      24-May-2024 16:04                7763
function.imagepalettetotruecolor.php               24-May-2024 16:04               10141
function.imagepng.php                              24-May-2024 16:04                9770
function.imagepolygon.php                          24-May-2024 16:04               11250
function.imagerectangle.php                        24-May-2024 16:04               10905
function.imageresolution.php                       24-May-2024 16:04                8140
function.imagerotate.php                           24-May-2024 16:04                9612
function.imagesavealpha.php                        24-May-2024 16:04                8349
function.imagescale.php                            24-May-2024 16:04                7416
function.imagesetbrush.php                         24-May-2024 16:04                9857
function.imagesetclip.php                          24-May-2024 16:04                5473
function.imagesetinterpolation.php                 24-May-2024 16:04               11906
function.imagesetpixel.php                         24-May-2024 16:04               11770
function.imagesetstyle.php                         24-May-2024 16:04               12444
function.imagesetthickness.php                     24-May-2024 16:04                8726
function.imagesettile.php                          24-May-2024 16:04                8992
function.imagestring.php                           24-May-2024 16:04               10659
function.imagestringup.php                         24-May-2024 16:04                9822
function.imagesx.php                               24-May-2024 16:04                5307
function.imagesy.php                               24-May-2024 16:04                5333
function.imagetruecolortopalette.php               24-May-2024 16:04                7325
function.imagettfbbox.php                          24-May-2024 16:04               20262
function.imagettftext.php                          24-May-2024 16:04               19455
function.imagetypes.php                            24-May-2024 16:04                5332
function.imagewbmp.php                             24-May-2024 16:04               15826
function.imagewebp.php                             24-May-2024 16:04                8061
function.imagexbm.php                              24-May-2024 16:04               12533
function.imap-8bit.php                             24-May-2024 16:04                3256
function.imap-alerts.php                           24-May-2024 16:04                3455
function.imap-append.php                           24-May-2024 16:04               10117
function.imap-base64.php                           24-May-2024 16:04                3756
function.imap-binary.php                           24-May-2024 16:04                3272
function.imap-body.php                             24-May-2024 16:04                6013
function.imap-bodystruct.php                       24-May-2024 16:04                4992
function.imap-check.php                            24-May-2024 16:04                6432
function.imap-clearflag-full.php                   24-May-2024 16:04                6939
function.imap-close.php                            24-May-2024 16:04                5389
function.imap-create.php                           24-May-2024 16:04                1803
function.imap-createmailbox.php                    24-May-2024 16:04               14332
function.imap-delete.php                           24-May-2024 16:04               11043
function.imap-deletemailbox.php                    24-May-2024 16:04                5325
function.imap-errors.php                           24-May-2024 16:04                3659
function.imap-expunge.php                          24-May-2024 16:04                3868
function.imap-fetch-overview.php                   24-May-2024 16:04               11838
function.imap-fetchbody.php                        24-May-2024 16:04                6618
function.imap-fetchheader.php                      24-May-2024 16:04                6245
function.imap-fetchmime.php                        24-May-2024 16:04                6790
function.imap-fetchstructure.php                   24-May-2024 16:04               10345
function.imap-fetchtext.php                        24-May-2024 16:04                1784
function.imap-gc.php                               24-May-2024 16:04                6204
function.imap-get-quota.php                        24-May-2024 16:04               12903
function.imap-get-quotaroot.php                    24-May-2024 16:04                9644
function.imap-getacl.php                           24-May-2024 16:04                6260
function.imap-getmailboxes.php                     24-May-2024 16:04               13384
function.imap-getsubscribed.php                    24-May-2024 16:04                8860
function.imap-header.php                           24-May-2024 16:04                2016
function.imap-headerinfo.php                       24-May-2024 16:04               12586
function.imap-headers.php                          24-May-2024 16:04                3821
function.imap-is-open.php                          24-May-2024 16:04                4320
function.imap-last-error.php                       24-May-2024 16:04                3330
function.imap-list.php                             24-May-2024 16:04                9270
function.imap-listmailbox.php                      24-May-2024 16:04                1789
function.imap-listscan.php                         24-May-2024 16:04                7452
function.imap-listsubscribed.php                   24-May-2024 16:04                1810
function.imap-lsub.php                             24-May-2024 16:04                6594
function.imap-mail-compose.php                     24-May-2024 16:04               16779
function.imap-mail-copy.php                        24-May-2024 16:04                6790
function.imap-mail-move.php                        24-May-2024 16:04                7236
function.imap-mail.php                             24-May-2024 16:04                7780
function.imap-mailboxmsginfo.php                   24-May-2024 16:04                9605
function.imap-mime-header-decode.php               24-May-2024 16:04                6745
function.imap-msgno.php                            24-May-2024 16:04                4369
function.imap-mutf7-to-utf8.php                    24-May-2024 16:04                3476
function.imap-num-msg.php                          24-May-2024 16:04                4366
function.imap-num-recent.php                       24-May-2024 16:04                4136
function.imap-open.php                             24-May-2024 16:04               23667
function.imap-ping.php                             24-May-2024 16:04                5224
function.imap-qprint.php                           24-May-2024 16:04                3272
function.imap-rename.php                           24-May-2024 16:04                1806
function.imap-renamemailbox.php                    24-May-2024 16:04                6059
function.imap-reopen.php                           24-May-2024 16:04                9390
function.imap-rfc822-parse-adrlist.php             24-May-2024 16:04                8028
function.imap-rfc822-parse-headers.php             24-May-2024 16:04                3878
function.imap-rfc822-write-address.php             24-May-2024 16:04                5668
function.imap-savebody.php                         24-May-2024 16:04                6998
function.imap-scan.php                             24-May-2024 16:04                1771
function.imap-scanmailbox.php                      24-May-2024 16:04                1801
function.imap-search.php                           24-May-2024 16:04               14638
function.imap-set-quota.php                        24-May-2024 16:04                7229
function.imap-setacl.php                           24-May-2024 16:04                5846
function.imap-setflag-full.php                     24-May-2024 16:04                9108
function.imap-sort.php                             24-May-2024 16:04                9097
function.imap-status.php                           24-May-2024 16:04               11291
function.imap-subscribe.php                        24-May-2024 16:04                4756
function.imap-thread.php                           24-May-2024 16:04                8220
function.imap-timeout.php                          24-May-2024 16:04                4970
function.imap-uid.php                              24-May-2024 16:04                4886
function.imap-undelete.php                         24-May-2024 16:04                5261
function.imap-unsubscribe.php                      24-May-2024 16:04                4851
function.imap-utf7-decode.php                      24-May-2024 16:04                4000
function.imap-utf7-encode.php                      24-May-2024 16:04                3448
function.imap-utf8-to-mutf7.php                    24-May-2024 16:04                3482
function.imap-utf8.php                             24-May-2024 16:04                4520
function.implode.php                               24-May-2024 16:05                8084
function.in-array.php                              24-May-2024 16:05               12108
function.include-once.php                          24-May-2024 16:04                2457
function.include.php                               24-May-2024 16:04               21886
function.inet-ntop.php                             24-May-2024 16:05                6515
function.inet-pton.php                             24-May-2024 16:05                5097
function.inflate-add.php                           24-May-2024 16:04                6769
function.inflate-get-read-len.php                  24-May-2024 16:04                3689
function.inflate-get-status.php                    24-May-2024 16:04                3391
function.inflate-init.php                          24-May-2024 16:04                7577
function.ini-alter.php                             24-May-2024 16:04                1748
function.ini-get-all.php                           24-May-2024 16:04               10810
function.ini-get.php                               24-May-2024 16:04               10706
function.ini-parse-quantity.php                    24-May-2024 16:04                7889
function.ini-restore.php                           24-May-2024 16:04                6415
function.ini-set.php                               24-May-2024 16:04                6917
function.inotify-add-watch.php                     24-May-2024 16:04                4699
function.inotify-init.php                          24-May-2024 16:04                9415
function.inotify-queue-len.php                     24-May-2024 16:04                4044
function.inotify-read.php                          24-May-2024 16:04                4777
function.inotify-rm-watch.php                      24-May-2024 16:04                3800
function.intdiv.php                                24-May-2024 16:04                7557
function.interface-exists.php                      24-May-2024 16:05                5745
function.intl-error-name.php                       24-May-2024 16:04                5162
function.intl-get-error-code.php                   24-May-2024 16:04                4765
function.intl-get-error-message.php                24-May-2024 16:04                4745
function.intl-is-failure.php                       24-May-2024 16:04                5637
function.intval.php                                24-May-2024 16:05               14188
function.ip2long.php                               24-May-2024 16:05                9446
function.iptcembed.php                             24-May-2024 16:04               12117
function.iptcparse.php                             24-May-2024 16:04                4772
function.is-a.php                                  24-May-2024 16:05                7425
function.is-array.php                              24-May-2024 16:05                5751
function.is-bool.php                               24-May-2024 16:05                5654
function.is-callable.php                           24-May-2024 16:05               11517
function.is-countable.php                          24-May-2024 16:05                6438
function.is-dir.php                                24-May-2024 16:04                7078
function.is-double.php                             24-May-2024 16:05                1737
function.is-executable.php                         24-May-2024 16:04                6956
function.is-file.php                               24-May-2024 16:04                6451
function.is-finite.php                             24-May-2024 16:04                6441
function.is-float.php                              24-May-2024 16:05                6663
function.is-infinite.php                           24-May-2024 16:04                5581
function.is-int.php                                24-May-2024 16:05                6767
function.is-integer.php                            24-May-2024 16:05                1730
function.is-iterable.php                           24-May-2024 16:05                5909
function.is-link.php                               24-May-2024 16:04                6035
function.is-long.php                               24-May-2024 16:05                1711
function.is-nan.php                                24-May-2024 16:04                6971
function.is-null.php                               24-May-2024 16:05                6160
function.is-numeric.php                            24-May-2024 16:05               12302
function.is-object.php                             24-May-2024 16:05                7451
function.is-readable.php                           24-May-2024 16:04                6877
function.is-real.php                               24-May-2024 16:05                1933
function.is-resource.php                           24-May-2024 16:05                5289
function.is-scalar.php                             24-May-2024 16:05                8397
function.is-soap-fault.php                         24-May-2024 16:05                8521
function.is-string.php                             24-May-2024 16:05                6766
function.is-subclass-of.php                        24-May-2024 16:05               13004
function.is-tainted.php                            24-May-2024 16:05                2483
function.is-uploaded-file.php                      24-May-2024 16:04                7223
function.is-writable.php                           24-May-2024 16:04                6390
function.is-writeable.php                          24-May-2024 16:04                1798
function.isset.php                                 24-May-2024 16:05               16775
function.iterator-apply.php                        24-May-2024 16:05                7095
function.iterator-count.php                        24-May-2024 16:05                8872
function.iterator-to-array.php                     24-May-2024 16:05                8199
function.jddayofweek.php                           24-May-2024 16:04                3912
function.jdmonthname.php                           24-May-2024 16:04                5168
function.jdtofrench.php                            24-May-2024 16:04                3210
function.jdtogregorian.php                         24-May-2024 16:04                3285
function.jdtojewish.php                            24-May-2024 16:04                7672
function.jdtojulian.php                            24-May-2024 16:04                3220
function.jdtounix.php                              24-May-2024 16:04                4728
function.jewishtojd.php                            24-May-2024 16:04                4869
function.join.php                                  24-May-2024 16:05                1693
function.jpeg2wbmp.php                             24-May-2024 16:04                6808
function.json-decode.php                           24-May-2024 16:04               20922
function.json-encode.php                           24-May-2024 16:04               31770
function.json-last-error-msg.php                   24-May-2024 16:04                3209
function.json-last-error.php                       24-May-2024 16:04               14449
function.json-validate.php                         24-May-2024 16:04                9067
function.juliantojd.php                            24-May-2024 16:04                4918
function.key-exists.php                            24-May-2024 16:05                1769
function.key.php                                   24-May-2024 16:05                8265
function.krsort.php                                24-May-2024 16:05                9258
function.ksort.php                                 24-May-2024 16:05               11164
function.lcfirst.php                               24-May-2024 16:05                5925
function.lcg-value.php                             24-May-2024 16:05                5566
function.lchgrp.php                                24-May-2024 16:04                6379
function.lchown.php                                24-May-2024 16:04                6196
function.ldap-8859-to-t61.php                      24-May-2024 16:05                3459
function.ldap-add-ext.php                          24-May-2024 16:05                6274
function.ldap-add.php                              24-May-2024 16:05               10942
function.ldap-bind-ext.php                         24-May-2024 16:05                6530
function.ldap-bind.php                             24-May-2024 16:05                9847
function.ldap-close.php                            24-May-2024 16:05                1754
function.ldap-compare.php                          24-May-2024 16:05               10783
function.ldap-connect-wallet.php                   24-May-2024 16:05                4569
function.ldap-connect.php                          24-May-2024 16:05               10504
function.ldap-control-paged-result-response.php    24-May-2024 16:05                6115
function.ldap-control-paged-result.php             24-May-2024 16:05               14896
function.ldap-count-entries.php                    24-May-2024 16:05                6053
function.ldap-count-references.php                 24-May-2024 16:05                5050
function.ldap-delete-ext.php                       24-May-2024 16:05                5769
function.ldap-delete.php                           24-May-2024 16:05                5722
function.ldap-dn2ufn.php                           24-May-2024 16:05                2906
function.ldap-err2str.php                          24-May-2024 16:05                4905
function.ldap-errno.php                            24-May-2024 16:05                7902
function.ldap-error.php                            24-May-2024 16:05                4915
function.ldap-escape.php                           24-May-2024 16:05                6595
function.ldap-exop-passwd.php                      24-May-2024 16:05               11169
function.ldap-exop-refresh.php                     24-May-2024 16:05                5550
function.ldap-exop-sync.php                        24-May-2024 16:05                5754
function.ldap-exop-whoami.php                      24-May-2024 16:05                4195
function.ldap-exop.php                             24-May-2024 16:05               13234
function.ldap-explode-dn.php                       24-May-2024 16:05                3864
function.ldap-first-attribute.php                  24-May-2024 16:05                5887
function.ldap-first-entry.php                      24-May-2024 16:05                6385
function.ldap-first-reference.php                  24-May-2024 16:05                2446
function.ldap-free-result.php                      24-May-2024 16:05                4470
function.ldap-get-attributes.php                   24-May-2024 16:05                8813
function.ldap-get-dn.php                           24-May-2024 16:05                4675
function.ldap-get-entries.php                      24-May-2024 16:05                6593
function.ldap-get-option.php                       24-May-2024 16:05               17186
function.ldap-get-values-len.php                   24-May-2024 16:05                5938
function.ldap-get-values.php                       24-May-2024 16:05                9479
function.ldap-list.php                             24-May-2024 16:05               16724
function.ldap-mod-add.php                          24-May-2024 16:05                7244
function.ldap-mod-del.php                          24-May-2024 16:05                6721
function.ldap-mod-replace.php                      24-May-2024 16:05                7172
function.ldap-mod_add-ext.php                      24-May-2024 16:05                6225
function.ldap-mod_del-ext.php                      24-May-2024 16:05                6240
function.ldap-mod_replace-ext.php                  24-May-2024 16:05                6305
function.ldap-modify-batch.php                     24-May-2024 16:05               19509
function.ldap-modify.php                           24-May-2024 16:05                2153
function.ldap-next-attribute.php                   24-May-2024 16:05                5665
function.ldap-next-entry.php                       24-May-2024 16:05                6285
function.ldap-next-reference.php                   24-May-2024 16:05                2374
function.ldap-parse-exop.php                       24-May-2024 16:05                6413
function.ldap-parse-reference.php                  24-May-2024 16:05                2506
function.ldap-parse-result.php                     24-May-2024 16:05               10379
function.ldap-read.php                             24-May-2024 16:05               14212
function.ldap-rename-ext.php                       24-May-2024 16:05                6591
function.ldap-rename.php                           24-May-2024 16:05                7729
function.ldap-sasl-bind.php                        24-May-2024 16:05                7529
function.ldap-search.php                           24-May-2024 16:05               17077
function.ldap-set-option.php                       24-May-2024 16:05               20178
function.ldap-set-rebind-proc.php                  24-May-2024 16:05                3472
function.ldap-sort.php                             24-May-2024 16:05                7393
function.ldap-start-tls.php                        24-May-2024 16:05                2125
function.ldap-t61-to-8859.php                      24-May-2024 16:05                2264
function.ldap-unbind.php                           24-May-2024 16:05                4122
function.levenshtein.php                           24-May-2024 16:05               12832
function.libxml-clear-errors.php                   24-May-2024 16:05                2955
function.libxml-disable-entity-loader.php          24-May-2024 16:05                5390
function.libxml-get-errors.php                     24-May-2024 16:05               10848
function.libxml-get-external-entity-loader.php     24-May-2024 16:05                3824
function.libxml-get-last-error.php                 24-May-2024 16:05                3361
function.libxml-set-external-entity-loader.php     24-May-2024 16:05               10963
function.libxml-set-streams-context.php            24-May-2024 16:05                5226
function.libxml-use-internal-errors.php            24-May-2024 16:05                7055
function.link.php                                  24-May-2024 16:04                6284
function.linkinfo.php                              24-May-2024 16:04                4781
function.list.php                                  24-May-2024 16:05               17289
function.localeconv.php                            24-May-2024 16:05                9796
function.localtime.php                             24-May-2024 16:04                9741
function.log.php                                   24-May-2024 16:04                4165
function.log10.php                                 24-May-2024 16:04                2743
function.log1p.php                                 24-May-2024 16:04                3528
function.long2ip.php                               24-May-2024 16:05                4635
function.lstat.php                                 24-May-2024 16:04                6921
function.ltrim.php                                 24-May-2024 16:05                9719
function.lzf-compress.php                          24-May-2024 16:04                3046
function.lzf-decompress.php                        24-May-2024 16:04                3094
function.lzf-optimized-for.php                     24-May-2024 16:04                2386
function.mail.php                                  24-May-2024 16:04               27769
function.mailparse-determine-best-xfer-encoding..> 24-May-2024 16:04                4457
function.mailparse-msg-create.php                  24-May-2024 16:04                3558
function.mailparse-msg-extract-part-file.php       24-May-2024 16:04                5617
function.mailparse-msg-extract-part.php            24-May-2024 16:04                4269
function.mailparse-msg-extract-whole-part-file.php 24-May-2024 16:04                4293
function.mailparse-msg-free.php                    24-May-2024 16:04                3775
function.mailparse-msg-get-part-data.php           24-May-2024 16:04                2673
function.mailparse-msg-get-part.php                24-May-2024 16:04                2984
function.mailparse-msg-get-structure.php           24-May-2024 16:04                2703
function.mailparse-msg-parse-file.php              24-May-2024 16:04                4569
function.mailparse-msg-parse.php                   24-May-2024 16:04                3796
function.mailparse-rfc822-parse-addresses.php      24-May-2024 16:04                5842
function.mailparse-stream-encode.php               24-May-2024 16:04                6249
function.mailparse-uudecode-all.php                24-May-2024 16:04                7140
function.max.php                                   24-May-2024 16:04               12932
function.mb-check-encoding.php                     24-May-2024 16:04                5792
function.mb-chr.php                                24-May-2024 16:04                7485
function.mb-convert-case.php                       24-May-2024 16:04               12159
function.mb-convert-encoding.php                   24-May-2024 16:04               12259
function.mb-convert-kana.php                       24-May-2024 16:04               10205
function.mb-convert-variables.php                  24-May-2024 16:04                6863
function.mb-decode-mimeheader.php                  24-May-2024 16:04                3203
function.mb-decode-numericentity.php               24-May-2024 16:04               34074
function.mb-detect-encoding.php                    24-May-2024 16:04               17673
function.mb-detect-order.php                       24-May-2024 16:04                9447
function.mb-encode-mimeheader.php                  24-May-2024 16:04               10021
function.mb-encode-numericentity.php               24-May-2024 16:04               12855
function.mb-encoding-aliases.php                   24-May-2024 16:04                6733
function.mb-ereg-match.php                         24-May-2024 16:04                5873
function.mb-ereg-replace-callback.php              24-May-2024 16:04               13072
function.mb-ereg-replace.php                       24-May-2024 16:04                7651
function.mb-ereg-search-getpos.php                 24-May-2024 16:04                4091
function.mb-ereg-search-getregs.php                24-May-2024 16:04                4584
function.mb-ereg-search-init.php                   24-May-2024 16:04                6516
function.mb-ereg-search-pos.php                    24-May-2024 16:04                6278
function.mb-ereg-search-regs.php                   24-May-2024 16:04                6094
function.mb-ereg-search-setpos.php                 24-May-2024 16:04                4805
function.mb-ereg-search.php                        24-May-2024 16:04                6004
function.mb-ereg.php                               24-May-2024 16:04                6965
function.mb-eregi-replace.php                      24-May-2024 16:04                7318
function.mb-eregi.php                              24-May-2024 16:04                7161
function.mb-get-info.php                           24-May-2024 16:04                6546
function.mb-http-input.php                         24-May-2024 16:04                5410
function.mb-http-output.php                        24-May-2024 16:04                5367
function.mb-internal-encoding.php                  24-May-2024 16:04                7652
function.mb-language.php                           24-May-2024 16:04                6894
function.mb-list-encodings.php                     24-May-2024 16:04                5258
function.mb-ord.php                                24-May-2024 16:04                7186
function.mb-output-handler.php                     24-May-2024 16:04                5448
function.mb-parse-str.php                          24-May-2024 16:04                4914
function.mb-preferred-mime-name.php                24-May-2024 16:04                4581
function.mb-regex-encoding.php                     24-May-2024 16:04                4758
function.mb-regex-set-options.php                  24-May-2024 16:04                9426
function.mb-scrub.php                              24-May-2024 16:04                4329
function.mb-send-mail.php                          24-May-2024 16:04               11113
function.mb-split.php                              24-May-2024 16:04                4802
function.mb-str-pad.php                            24-May-2024 16:04                8933
function.mb-str-split.php                          24-May-2024 16:04                5816
function.mb-strcut.php                             24-May-2024 16:04                8106
function.mb-strimwidth.php                         24-May-2024 16:04                8185
function.mb-stripos.php                            24-May-2024 16:04                6835
function.mb-stristr.php                            24-May-2024 16:04                7230
function.mb-strlen.php                             24-May-2024 16:04                5238
function.mb-strpos.php                             24-May-2024 16:04                6703
function.mb-strrchr.php                            24-May-2024 16:04                6994
function.mb-strrichr.php                           24-May-2024 16:04                7093
function.mb-strripos.php                           24-May-2024 16:04                6704
function.mb-strrpos.php                            24-May-2024 16:04                6995
function.mb-strstr.php                             24-May-2024 16:04                6993
function.mb-strtolower.php                         24-May-2024 16:04                7354
function.mb-strtoupper.php                         24-May-2024 16:04                7363
function.mb-strwidth.php                           24-May-2024 16:04                9253
function.mb-substitute-character.php               24-May-2024 16:04                7321
function.mb-substr-count.php                       24-May-2024 16:04                6017
function.mb-substr.php                             24-May-2024 16:04                6875
function.mcrypt-create-iv.php                      24-May-2024 16:04                7020
function.mcrypt-decrypt.php                        24-May-2024 16:04                6134
function.mcrypt-enc-get-algorithms-name.php        24-May-2024 16:04                5400
function.mcrypt-enc-get-block-size.php             24-May-2024 16:04                3074
function.mcrypt-enc-get-iv-size.php                24-May-2024 16:04                3447
function.mcrypt-enc-get-key-size.php               24-May-2024 16:04                3166
function.mcrypt-enc-get-modes-name.php             24-May-2024 16:04                5324
function.mcrypt-enc-get-supported-key-sizes.php    24-May-2024 16:04                5191
function.mcrypt-enc-is-block-algorithm-mode.php    24-May-2024 16:04                3785
function.mcrypt-enc-is-block-algorithm.php         24-May-2024 16:04                3516
function.mcrypt-enc-is-block-mode.php              24-May-2024 16:04                3622
function.mcrypt-enc-self-test.php                  24-May-2024 16:04                3252
function.mcrypt-encrypt.php                        24-May-2024 16:04               14285
function.mcrypt-generic-deinit.php                 24-May-2024 16:04                4218
function.mcrypt-generic-init.php                   24-May-2024 16:04                5652
function.mcrypt-generic.php                        24-May-2024 16:04                6484
function.mcrypt-get-block-size.php                 24-May-2024 16:04                6973
function.mcrypt-get-cipher-name.php                24-May-2024 16:04                5172
function.mcrypt-get-iv-size.php                    24-May-2024 16:04                6673
function.mcrypt-get-key-size.php                   24-May-2024 16:04                7168
function.mcrypt-list-algorithms.php                24-May-2024 16:04                5004
function.mcrypt-list-modes.php                     24-May-2024 16:04                4912
function.mcrypt-module-close.php                   24-May-2024 16:04                3603
function.mcrypt-module-get-algo-block-size.php     24-May-2024 16:04                3718
function.mcrypt-module-get-algo-key-size.php       24-May-2024 16:04                3796
function.mcrypt-module-get-supported-key-sizes.php 24-May-2024 16:04                5029
function.mcrypt-module-is-block-algorithm-mode.php 24-May-2024 16:04                4767
function.mcrypt-module-is-block-algorithm.php      24-May-2024 16:04                4326
function.mcrypt-module-is-block-mode.php           24-May-2024 16:04                4793
function.mcrypt-module-open.php                    24-May-2024 16:04               14963
function.mcrypt-module-self-test.php               24-May-2024 16:04                5198
function.md5-file.php                              24-May-2024 16:05                5389
function.md5.php                                   24-May-2024 16:05                6272
function.mdecrypt-generic.php                      24-May-2024 16:04               11216
function.memcache-debug.php                        24-May-2024 16:05                4030
function.memory-get-peak-usage.php                 24-May-2024 16:04                3918
function.memory-get-usage.php                      24-May-2024 16:04                5818
function.memory-reset-peak-usage.php               24-May-2024 16:04                5092
function.metaphone.php                             24-May-2024 16:05                8512
function.method-exists.php                         24-May-2024 16:05                6897
function.mhash-count.php                           24-May-2024 16:04                4846
function.mhash-get-block-size.php                  24-May-2024 16:04                4760
function.mhash-get-hash-name.php                   24-May-2024 16:04                4714
function.mhash-keygen-s2k.php                      24-May-2024 16:04                6261
function.mhash.php                                 24-May-2024 16:04                4956
function.microtime.php                             24-May-2024 16:04                8230
function.mime-content-type.php                     24-May-2024 16:04                5271
function.min.php                                   24-May-2024 16:04               13473
function.mkdir.php                                 24-May-2024 16:04               10063
function.mktime.php                                24-May-2024 16:04               19581
function.money-format.php                          24-May-2024 16:05               19533
function.mongodb.bson-fromjson.php                 24-May-2024 16:04                5900
function.mongodb.bson-fromphp.php                  24-May-2024 16:04                6242
function.mongodb.bson-tocanonicalextendedjson.php  24-May-2024 16:04               13941
function.mongodb.bson-tojson.php                   24-May-2024 16:04               15016
function.mongodb.bson-tophp.php                    24-May-2024 16:04                9128
function.mongodb.bson-torelaxedextendedjson.php    24-May-2024 16:04               13638
function.mongodb.driver.monitoring.addsubscribe..> 24-May-2024 16:04                5094
function.mongodb.driver.monitoring.removesubscr..> 24-May-2024 16:04                4954
function.move-uploaded-file.php                    24-May-2024 16:04                9189
function.mqseries-back.php                         24-May-2024 16:05                6689
function.mqseries-begin.php                        24-May-2024 16:05                7666
function.mqseries-close.php                        24-May-2024 16:05                6779
function.mqseries-cmit.php                         24-May-2024 16:05                6610
function.mqseries-conn.php                         24-May-2024 16:05                6139
function.mqseries-connx.php                        24-May-2024 16:05               12684
function.mqseries-disc.php                         24-May-2024 16:05                5748
function.mqseries-get.php                          24-May-2024 16:05               12308
function.mqseries-inq.php                          24-May-2024 16:05                9417
function.mqseries-open.php                         24-May-2024 16:05                7402
function.mqseries-put.php                          24-May-2024 16:05               12973
function.mqseries-put1.php                         24-May-2024 16:05                6343
function.mqseries-set.php                          24-May-2024 16:05                6269
function.mqseries-strerror.php                     24-May-2024 16:05                4334
function.msg-get-queue.php                         24-May-2024 16:04                6041
function.msg-queue-exists.php                      24-May-2024 16:04                3595
function.msg-receive.php                           24-May-2024 16:04               12598
function.msg-remove-queue.php                      24-May-2024 16:04                4877
function.msg-send.php                              24-May-2024 16:04               10614
function.msg-set-queue.php                         24-May-2024 16:04                5507
function.msg-stat-queue.php                        24-May-2024 16:04                6971
function.mt-getrandmax.php                         24-May-2024 16:05                3509
function.mt-rand.php                               24-May-2024 16:05               11308
function.mt-srand.php                              24-May-2024 16:05                9277
function.mysql-affected-rows.php                   24-May-2024 16:04               12588
function.mysql-client-encoding.php                 24-May-2024 16:04                6405
function.mysql-close.php                           24-May-2024 16:04                7845
function.mysql-connect.php                         24-May-2024 16:04               18148
function.mysql-create-db.php                       24-May-2024 16:04                8822
function.mysql-data-seek.php                       24-May-2024 16:04               12333
function.mysql-db-name.php                         24-May-2024 16:04                8037
function.mysql-db-query.php                        24-May-2024 16:04               10594
function.mysql-drop-db.php                         24-May-2024 16:04                7998
function.mysql-errno.php                           24-May-2024 16:04                8549
function.mysql-error.php                           24-May-2024 16:04                8525
function.mysql-escape-string.php                   24-May-2024 16:04                6763
function.mysql-fetch-array.php                     24-May-2024 16:04               16078
function.mysql-fetch-assoc.php                     24-May-2024 16:04               11779
function.mysql-fetch-field.php                     24-May-2024 16:04               13443
function.mysql-fetch-lengths.php                   24-May-2024 16:04                7816
function.mysql-fetch-object.php                    24-May-2024 16:04               12191
function.mysql-fetch-row.php                       24-May-2024 16:04                7828
function.mysql-field-flags.php                     24-May-2024 16:04                8814
function.mysql-field-len.php                       24-May-2024 16:04                7162
function.mysql-field-name.php                      24-May-2024 16:04                9312
function.mysql-field-seek.php                      24-May-2024 16:04                5338
function.mysql-field-table.php                     24-May-2024 16:04                7845
function.mysql-field-type.php                      24-May-2024 16:04               11889
function.mysql-free-result.php                     24-May-2024 16:04                7985
function.mysql-get-client-info.php                 24-May-2024 16:04                5398
function.mysql-get-host-info.php                   24-May-2024 16:04                7257
function.mysql-get-proto-info.php                  24-May-2024 16:04                6818
function.mysql-get-server-info.php                 24-May-2024 16:04                7356
function.mysql-info.php                            24-May-2024 16:04                6577
function.mysql-insert-id.php                       24-May-2024 16:04                8624
function.mysql-list-dbs.php                        24-May-2024 16:04                9063
function.mysql-list-fields.php                     24-May-2024 16:04                9187
function.mysql-list-processes.php                  24-May-2024 16:04                7853
function.mysql-list-tables.php                     24-May-2024 16:04                9946
function.mysql-num-fields.php                      24-May-2024 16:04                6723
function.mysql-num-rows.php                        24-May-2024 16:04                8207
function.mysql-pconnect.php                        24-May-2024 16:04                9072
function.mysql-ping.php                            24-May-2024 16:04                8185
function.mysql-query.php                           24-May-2024 16:04               14503
function.mysql-real-escape-string.php              24-May-2024 16:04               16317
function.mysql-result.php                          24-May-2024 16:04                9959
function.mysql-select-db.php                       24-May-2024 16:04                8000
function.mysql-set-charset.php                     24-May-2024 16:04                6204
function.mysql-stat.php                            24-May-2024 16:04                9673
function.mysql-tablename.php                       24-May-2024 16:04                8413
function.mysql-thread-id.php                       24-May-2024 16:04                6946
function.mysql-unbuffered-query.php                24-May-2024 16:04                7486
function.mysql-xdevapi-expression.php              24-May-2024 16:04                4941
function.mysql-xdevapi-getsession.php              24-May-2024 16:04               14225
function.mysqli-connect.php                        24-May-2024 16:04                2488
function.mysqli-escape-string.php                  24-May-2024 16:04                2011
function.mysqli-execute.php                        24-May-2024 16:04                2588
function.mysqli-get-client-stats.php               24-May-2024 16:04                8540
function.mysqli-get-links-stats.php                24-May-2024 16:04                3539
function.mysqli-report.php                         24-May-2024 16:04                1813
function.mysqli-set-opt.php                        24-May-2024 16:04                1902
function.natcasesort.php                           24-May-2024 16:05                8143
function.natsort.php                               24-May-2024 16:05               11341
function.net-get-interfaces.php                    24-May-2024 16:05                5150
function.next.php                                  24-May-2024 16:05               10144
function.ngettext.php                              24-May-2024 16:04                5817
function.nl-langinfo.php                           24-May-2024 16:05               16101
function.nl2br.php                                 24-May-2024 16:05                7030
function.number-format.php                         24-May-2024 16:05                9233
function.oauth-get-sbs.php                         24-May-2024 16:05                3155
function.oauth-urlencode.php                       24-May-2024 16:05                2718
function.ob-clean.php                              24-May-2024 16:04                4950
function.ob-end-clean.php                          24-May-2024 16:04                6195
function.ob-end-flush.php                          24-May-2024 16:04                5991
function.ob-flush.php                              24-May-2024 16:04                5028
function.ob-get-clean.php                          24-May-2024 16:04                7357
function.ob-get-contents.php                       24-May-2024 16:04                4940
function.ob-get-flush.php                          24-May-2024 16:04                7050
function.ob-get-length.php                         24-May-2024 16:04                4882
function.ob-get-level.php                          24-May-2024 16:04                3829
function.ob-get-status.php                         24-May-2024 16:04               10845
function.ob-gzhandler.php                          24-May-2024 16:04                6453
function.ob-iconv-handler.php                      24-May-2024 16:04                5348
function.ob-implicit-flush.php                     24-May-2024 16:04                5599
function.ob-list-handlers.php                      24-May-2024 16:04               14285
function.ob-start.php                              24-May-2024 16:04               18453
function.ob-tidyhandler.php                        24-May-2024 16:05                4519
function.oci-bind-array-by-name.php                24-May-2024 16:04               14160
function.oci-bind-by-name.php                      24-May-2024 16:04               82354
function.oci-cancel.php                            24-May-2024 16:04                2830
function.oci-client-version.php                    24-May-2024 16:04                4118
function.oci-close.php                             24-May-2024 16:04               19596
function.oci-commit.php                            24-May-2024 16:04               11862
function.oci-connect.php                           24-May-2024 16:04               37076
function.oci-define-by-name.php                    24-May-2024 16:04               24483
function.oci-error.php                             24-May-2024 16:04               12280
function.oci-execute.php                           24-May-2024 16:04               22520
function.oci-fetch-all.php                         24-May-2024 16:04               25489
function.oci-fetch-array.php                       24-May-2024 16:04               66465
function.oci-fetch-assoc.php                       24-May-2024 16:04                9078
function.oci-fetch-object.php                      24-May-2024 16:04               18986
function.oci-fetch-row.php                         24-May-2024 16:04                9093
function.oci-fetch.php                             24-May-2024 16:04               13824
function.oci-field-is-null.php                     24-May-2024 16:04                8077
function.oci-field-name.php                        24-May-2024 16:04                9814
function.oci-field-precision.php                   24-May-2024 16:04                8876
function.oci-field-scale.php                       24-May-2024 16:04                8892
function.oci-field-size.php                        24-May-2024 16:04               10455
function.oci-field-type-raw.php                    24-May-2024 16:04                8145
function.oci-field-type.php                        24-May-2024 16:04               10687
function.oci-free-descriptor.php                   24-May-2024 16:04                3663
function.oci-free-statement.php                    24-May-2024 16:04                3078
function.oci-get-implicit-resultset.php            24-May-2024 16:04               28852
function.oci-internal-debug.php                    24-May-2024 16:04                3252
function.oci-new-collection.php                    24-May-2024 16:04                5345
function.oci-new-connect.php                       24-May-2024 16:04               17857
function.oci-new-cursor.php                        24-May-2024 16:04                7944
function.oci-new-descriptor.php                    24-May-2024 16:04               18884
function.oci-num-fields.php                        24-May-2024 16:04                7073
function.oci-num-rows.php                          24-May-2024 16:04                8002
function.oci-parse.php                             24-May-2024 16:04               12972
function.oci-password-change.php                   24-May-2024 16:04               14073
function.oci-pconnect.php                          24-May-2024 16:04               16317
function.oci-register-taf-callback.php             24-May-2024 16:04                5842
function.oci-result.php                            24-May-2024 16:04                8976
function.oci-rollback.php                          24-May-2024 16:04               15194
function.oci-server-version.php                    24-May-2024 16:04                4921
function.oci-set-action.php                        24-May-2024 16:04                9206
function.oci-set-call-timout.php                   24-May-2024 16:04                6014
function.oci-set-client-identifier.php             24-May-2024 16:04                8990
function.oci-set-client-info.php                   24-May-2024 16:04                9061
function.oci-set-db-operation.php                  24-May-2024 16:04                8099
function.oci-set-edition.php                       24-May-2024 16:04               10380
function.oci-set-module-name.php                   24-May-2024 16:04                9320
function.oci-set-prefetch-lob.php                  24-May-2024 16:04                9318
function.oci-set-prefetch.php                      24-May-2024 16:04               21964
function.oci-statement-type.php                    24-May-2024 16:04                7217
function.oci-unregister-taf-callback.php           24-May-2024 16:04                3693
function.ocibindbyname.php                         24-May-2024 16:04                2073
function.ocicancel.php                             24-May-2024 16:04                2015
function.ocicloselob.php                           24-May-2024 16:04                2014
function.ocicollappend.php                         24-May-2024 16:04                2079
function.ocicollassign.php                         24-May-2024 16:04                2084
function.ocicollassignelem.php                     24-May-2024 16:04                2129
function.ocicollgetelem.php                        24-May-2024 16:04                2096
function.ocicollmax.php                            24-May-2024 16:04                2048
function.ocicollsize.php                           24-May-2024 16:04                2051
function.ocicolltrim.php                           24-May-2024 16:04                2061
function.ocicolumnisnull.php                       24-May-2024 16:04                2085
function.ocicolumnname.php                         24-May-2024 16:04                2077
function.ocicolumnprecision.php                    24-May-2024 16:04                2120
function.ocicolumnscale.php                        24-May-2024 16:04                2084
function.ocicolumnsize.php                         24-May-2024 16:04                2065
function.ocicolumntype.php                         24-May-2024 16:04                2069
function.ocicolumntyperaw.php                      24-May-2024 16:04                2092
function.ocicommit.php                             24-May-2024 16:04                2029
function.ocidefinebyname.php                       24-May-2024 16:04                2075
function.ocierror.php                              24-May-2024 16:04                2006
function.ociexecute.php                            24-May-2024 16:04                2010
function.ocifetch.php                              24-May-2024 16:04                2000
function.ocifetchinto.php                          24-May-2024 16:04                2748
function.ocifetchstatement.php                     24-May-2024 16:04                2093
function.ocifreecollection.php                     24-May-2024 16:04                2111
function.ocifreecursor.php                         24-May-2024 16:04                2083
function.ocifreedesc.php                           24-May-2024 16:04                2027
function.ocifreestatement.php                      24-May-2024 16:04                2102
function.ociinternaldebug.php                      24-May-2024 16:04                2116
function.ociloadlob.php                            24-May-2024 16:04                2012
function.ocilob-copy.php                           24-May-2024 16:04                4910
function.ocilob-is-equal.php                       24-May-2024 16:04                3451
function.ocilogoff.php                             24-May-2024 16:04                1999
function.ocilogon.php                              24-May-2024 16:04                2014
function.ocinewcollection.php                      24-May-2024 16:04                2100
function.ocinewcursor.php                          24-May-2024 16:04                2068
function.ocinewdescriptor.php                      24-May-2024 16:04                2090
function.ocinlogon.php                             24-May-2024 16:04                2039
function.ocinumcols.php                            24-May-2024 16:04                2024
function.ociparse.php                              24-May-2024 16:04                1994
function.ociplogon.php                             24-May-2024 16:04                2009
function.ociresult.php                             24-May-2024 16:04                2007
function.ocirollback.php                           24-May-2024 16:04                2029
function.ocirowcount.php                           24-May-2024 16:04                2031
function.ocisavelob.php                            24-May-2024 16:04                2012
function.ocisavelobfile.php                        24-May-2024 16:04                2050
function.ociserverversion.php                      24-May-2024 16:04                2104
function.ocisetprefetch.php                        24-May-2024 16:04                2090
function.ocistatementtype.php                      24-May-2024 16:04                2110
function.ociwritelobtofile.php                     24-May-2024 16:04                2091
function.ociwritetemporarylob.php                  24-May-2024 16:04                2114
function.octdec.php                                24-May-2024 16:04                6060
function.odbc-autocommit.php                       24-May-2024 16:04                6022
function.odbc-binmode.php                          24-May-2024 16:04                7739
function.odbc-close-all.php                        24-May-2024 16:04                2744
function.odbc-close.php                            24-May-2024 16:04                3063
function.odbc-columnprivileges.php                 24-May-2024 16:04                9163
function.odbc-columns.php                          24-May-2024 16:04               12224
function.odbc-commit.php                           24-May-2024 16:04                2865
function.odbc-connect.php                          24-May-2024 16:04                9321
function.odbc-connection-string-is-quoted.php      24-May-2024 16:04                3967
function.odbc-connection-string-quote.php          24-May-2024 16:04                6139
function.odbc-connection-string-should-quote.php   24-May-2024 16:04                4398
function.odbc-cursor.php                           24-May-2024 16:04                2850
function.odbc-data-source.php                      24-May-2024 16:04                6351
function.odbc-do.php                               24-May-2024 16:04                1733
function.odbc-error.php                            24-May-2024 16:04                4391
function.odbc-errormsg.php                         24-May-2024 16:04                4456
function.odbc-exec.php                             24-May-2024 16:04                4184
function.odbc-execute.php                          24-May-2024 16:04                7393
function.odbc-fetch-array.php                      24-May-2024 16:04                4444
function.odbc-fetch-into.php                       24-May-2024 16:04                5218
function.odbc-fetch-object.php                     24-May-2024 16:04                4476
function.odbc-fetch-row.php                        24-May-2024 16:04                5229
function.odbc-field-len.php                        24-May-2024 16:04                3577
function.odbc-field-name.php                       24-May-2024 16:04                3210
function.odbc-field-num.php                        24-May-2024 16:04                3196
function.odbc-field-precision.php                  24-May-2024 16:04                2257
function.odbc-field-scale.php                      24-May-2024 16:04                3204
function.odbc-field-type.php                       24-May-2024 16:04                3230
function.odbc-foreignkeys.php                      24-May-2024 16:04                9576
function.odbc-free-result.php                      24-May-2024 16:04                3607
function.odbc-gettypeinfo.php                      24-May-2024 16:04                4744
function.odbc-longreadlen.php                      24-May-2024 16:04                3982
function.odbc-next-result.php                      24-May-2024 16:04                9353
function.odbc-num-fields.php                       24-May-2024 16:04                2689
function.odbc-num-rows.php                         24-May-2024 16:04                3398
function.odbc-pconnect.php                         24-May-2024 16:04                5030
function.odbc-prepare.php                          24-May-2024 16:04                6685
function.odbc-primarykeys.php                      24-May-2024 16:04                8153
function.odbc-procedurecolumns.php                 24-May-2024 16:04               12447
function.odbc-procedures.php                       24-May-2024 16:04               10199
function.odbc-result-all.php                       24-May-2024 16:04                4413
function.odbc-result.php                           24-May-2024 16:04                6171
function.odbc-rollback.php                         24-May-2024 16:04                2873
function.odbc-setoption.php                        24-May-2024 16:04                7701
function.odbc-specialcolumns.php                   24-May-2024 16:04                8309
function.odbc-statistics.php                       24-May-2024 16:04               10412
function.odbc-tableprivileges.php                  24-May-2024 16:04                8702
function.odbc-tables.php                           24-May-2024 16:04               13680
function.opcache-compile-file.php                  24-May-2024 16:04                4219
function.opcache-get-configuration.php             24-May-2024 16:04                3461
function.opcache-get-status.php                    24-May-2024 16:04                4036
function.opcache-invalidate.php                    24-May-2024 16:04                4776
function.opcache-is-script-cached.php              24-May-2024 16:04                3828
function.opcache-reset.php                         24-May-2024 16:04                3907
function.openal-buffer-create.php                  24-May-2024 16:04                3001
function.openal-buffer-data.php                    24-May-2024 16:04                5198
function.openal-buffer-destroy.php                 24-May-2024 16:04                3287
function.openal-buffer-get.php                     24-May-2024 16:04                4115
function.openal-buffer-loadwav.php                 24-May-2024 16:04                3891
function.openal-context-create.php                 24-May-2024 16:04                3518
function.openal-context-current.php                24-May-2024 16:04                3372
function.openal-context-destroy.php                24-May-2024 16:04                3338
function.openal-context-process.php                24-May-2024 16:04                3787
function.openal-context-suspend.php                24-May-2024 16:04                3781
function.openal-device-close.php                   24-May-2024 16:04                3304
function.openal-device-open.php                    24-May-2024 16:04                3530
function.openal-listener-get.php                   24-May-2024 16:04                3579
function.openal-listener-set.php                   24-May-2024 16:04                3971
function.openal-source-create.php                  24-May-2024 16:04                3203
function.openal-source-destroy.php                 24-May-2024 16:04                3292
function.openal-source-get.php                     24-May-2024 16:04                5802
function.openal-source-pause.php                   24-May-2024 16:04                3612
function.openal-source-play.php                    24-May-2024 16:04                3611
function.openal-source-rewind.php                  24-May-2024 16:04                3621
function.openal-source-set.php                     24-May-2024 16:04                6550
function.openal-source-stop.php                    24-May-2024 16:04                3593
function.openal-stream.php                         24-May-2024 16:04                4651
function.opendir.php                               24-May-2024 16:04                8377
function.openlog.php                               24-May-2024 16:05               11195
function.openssl-cipher-iv-length.php              24-May-2024 16:04                4663
function.openssl-cipher-key-length.php             24-May-2024 16:04                4573
function.openssl-cms-decrypt.php                   24-May-2024 16:04                5861
function.openssl-cms-encrypt.php                   24-May-2024 16:04                7085
function.openssl-cms-read.php                      24-May-2024 16:04                3406
function.openssl-cms-sign.php                      24-May-2024 16:04                8613
function.openssl-cms-verify.php                    24-May-2024 16:04                7734
function.openssl-csr-export-to-file.php            24-May-2024 16:04                8908
function.openssl-csr-export.php                    24-May-2024 16:04                8873
function.openssl-csr-get-public-key.php            24-May-2024 16:04                9161
function.openssl-csr-get-subject.php               24-May-2024 16:04                9969
function.openssl-csr-new.php                       24-May-2024 16:04               22982
function.openssl-csr-sign.php                      24-May-2024 16:04               14766
function.openssl-decrypt.php                       24-May-2024 16:04                8498
function.openssl-dh-compute-key.php                24-May-2024 16:04               17134
function.openssl-digest.php                        24-May-2024 16:04                5026
function.openssl-encrypt.php                       24-May-2024 16:04               18758
function.openssl-error-string.php                  24-May-2024 16:04                4048
function.openssl-free-key.php                      24-May-2024 16:04                3979
function.openssl-get-cert-locations.php            24-May-2024 16:04                4123
function.openssl-get-cipher-methods.php            24-May-2024 16:04               14378
function.openssl-get-curve-names.php               24-May-2024 16:04                7415
function.openssl-get-md-methods.php                24-May-2024 16:04                7298
function.openssl-get-privatekey.php                24-May-2024 16:04                1958
function.openssl-get-publickey.php                 24-May-2024 16:04                1929
function.openssl-open.php                          24-May-2024 16:04               10910
function.openssl-pbkdf2.php                        24-May-2024 16:04                7976
function.openssl-pkcs12-export-to-file.php         24-May-2024 16:04                8119
function.openssl-pkcs12-export.php                 24-May-2024 16:04                8157
function.openssl-pkcs12-read.php                   24-May-2024 16:04                5913
function.openssl-pkcs7-decrypt.php                 24-May-2024 16:04                8195
function.openssl-pkcs7-encrypt.php                 24-May-2024 16:04               11351
function.openssl-pkcs7-read.php                    24-May-2024 16:04                7148
function.openssl-pkcs7-sign.php                    24-May-2024 16:04               12736
function.openssl-pkcs7-verify.php                  24-May-2024 16:04                8857
function.openssl-pkey-derive.php                   24-May-2024 16:04                8536
function.openssl-pkey-export-to-file.php           24-May-2024 16:04                7203
function.openssl-pkey-export.php                   24-May-2024 16:04                7077
function.openssl-pkey-free.php                     24-May-2024 16:04                4303
function.openssl-pkey-get-details.php              24-May-2024 16:04                9968
function.openssl-pkey-get-private.php              24-May-2024 16:04                6780
function.openssl-pkey-get-public.php               24-May-2024 16:04                5919
function.openssl-pkey-new.php                      24-May-2024 16:04                7385
function.openssl-private-decrypt.php               24-May-2024 16:04                7329
function.openssl-private-encrypt.php               24-May-2024 16:04                7097
function.openssl-public-decrypt.php                24-May-2024 16:04                6995
function.openssl-public-encrypt.php                24-May-2024 16:04                7392
function.openssl-random-pseudo-bytes.php           24-May-2024 16:04                9835
function.openssl-seal.php                          24-May-2024 16:04               11994
function.openssl-sign.php                          24-May-2024 16:04               13114
function.openssl-spki-export-challenge.php         24-May-2024 16:04                8001
function.openssl-spki-export.php                   24-May-2024 16:04                8800
function.openssl-spki-new.php                      24-May-2024 16:04                9884
function.openssl-spki-verify.php                   24-May-2024 16:04                8053
function.openssl-verify.php                        24-May-2024 16:04               13810
function.openssl-x509-check-private-key.php        24-May-2024 16:04                6266
function.openssl-x509-checkpurpose.php             24-May-2024 16:04                8052
function.openssl-x509-export-to-file.php           24-May-2024 16:04                5447
function.openssl-x509-export.php                   24-May-2024 16:04                5420
function.openssl-x509-fingerprint.php              24-May-2024 16:04                6003
function.openssl-x509-free.php                     24-May-2024 16:04                4312
function.openssl-x509-parse.php                    24-May-2024 16:04                5106
function.openssl-x509-read.php                     24-May-2024 16:04                4843
function.openssl-x509-verify.php                   24-May-2024 16:04               12811
function.ord.php                                   24-May-2024 16:05                7382
function.output-add-rewrite-var.php                24-May-2024 16:04               10121
function.output-reset-rewrite-vars.php             24-May-2024 16:04                7029
function.pack.php                                  24-May-2024 16:05               14145
function.parse-ini-file.php                        24-May-2024 16:04               22448
function.parse-ini-string.php                      24-May-2024 16:04                7805
function.parse-str.php                             24-May-2024 16:05               10640
function.parse-url.php                             24-May-2024 16:05               17476
function.passthru.php                              24-May-2024 16:04                8210
function.password-algos.php                        24-May-2024 16:04                3385
function.password-get-info.php                     24-May-2024 16:04                3682
function.password-hash.php                         24-May-2024 16:04               25637
function.password-needs-rehash.php                 24-May-2024 16:04                8611
function.password-verify.php                       24-May-2024 16:04                7375
function.pathinfo.php                              24-May-2024 16:04               14875
function.pclose.php                                24-May-2024 16:04                5151
function.pcntl-alarm.php                           24-May-2024 16:04                3098
function.pcntl-async-signals.php                   24-May-2024 16:04                4460
function.pcntl-errno.php                           24-May-2024 16:04                1821
function.pcntl-exec.php                            24-May-2024 16:04                3935
function.pcntl-fork.php                            24-May-2024 16:04                5258
function.pcntl-get-last-error.php                  24-May-2024 16:04                2902
function.pcntl-getpriority.php                     24-May-2024 16:04                6111
function.pcntl-rfork.php                           24-May-2024 16:04                8390
function.pcntl-setpriority.php                     24-May-2024 16:04                5937
function.pcntl-signal-dispatch.php                 24-May-2024 16:04                5887
function.pcntl-signal-get-handler.php              24-May-2024 16:04                6934
function.pcntl-signal.php                          24-May-2024 16:04               12014
function.pcntl-sigprocmask.php                     24-May-2024 16:04                6384
function.pcntl-sigtimedwait.php                    24-May-2024 16:04                5381
function.pcntl-sigwaitinfo.php                     24-May-2024 16:04                7929
function.pcntl-strerror.php                        24-May-2024 16:04                3081
function.pcntl-unshare.php                         24-May-2024 16:04                4881
function.pcntl-wait.php                            24-May-2024 16:04                8861
function.pcntl-waitpid.php                         24-May-2024 16:04               10140
function.pcntl-wexitstatus.php                     24-May-2024 16:04                3946
function.pcntl-wifexited.php                       24-May-2024 16:04                3676
function.pcntl-wifsignaled.php                     24-May-2024 16:04                3742
function.pcntl-wifstopped.php                      24-May-2024 16:04                3773
function.pcntl-wstopsig.php                        24-May-2024 16:04                3893
function.pcntl-wtermsig.php                        24-May-2024 16:04                4077
function.pfsockopen.php                            24-May-2024 16:05                5979
function.pg-affected-rows.php                      24-May-2024 16:04                7135
function.pg-cancel-query.php                       24-May-2024 16:04                7807
function.pg-client-encoding.php                    24-May-2024 16:04                7650
function.pg-close.php                              24-May-2024 16:04                7424
function.pg-connect-poll.php                       24-May-2024 16:04                4371
function.pg-connect.php                            24-May-2024 16:04               11934
function.pg-connection-busy.php                    24-May-2024 16:04                6045
function.pg-connection-reset.php                   24-May-2024 16:04                5997
function.pg-connection-status.php                  24-May-2024 16:04                5775
function.pg-consume-input.php                      24-May-2024 16:04                3966
function.pg-convert.php                            24-May-2024 16:04               10689
function.pg-copy-from.php                          24-May-2024 16:04                8424
function.pg-copy-to.php                            24-May-2024 16:04                7745
function.pg-dbname.php                             24-May-2024 16:04                5618
function.pg-delete.php                             24-May-2024 16:04               10482
function.pg-end-copy.php                           24-May-2024 16:04                7768
function.pg-escape-bytea.php                       24-May-2024 16:04                8442
function.pg-escape-identifier.php                  24-May-2024 16:04                8365
function.pg-escape-literal.php                     24-May-2024 16:04                8850
function.pg-escape-string.php                      24-May-2024 16:04                8223
function.pg-execute.php                            24-May-2024 16:04               11352
function.pg-fetch-all-columns.php                  24-May-2024 16:04                7344
function.pg-fetch-all.php                          24-May-2024 16:04                9599
function.pg-fetch-array.php                        24-May-2024 16:04               13214
function.pg-fetch-assoc.php                        24-May-2024 16:04                9742
function.pg-fetch-object.php                       24-May-2024 16:04               12485
function.pg-fetch-result.php                       24-May-2024 16:04                9758
function.pg-fetch-row.php                          24-May-2024 16:04               10261
function.pg-field-is-null.php                      24-May-2024 16:04                8870
function.pg-field-name.php                         24-May-2024 16:04                9308
function.pg-field-num.php                          24-May-2024 16:04                7001
function.pg-field-prtlen.php                       24-May-2024 16:04               11388
function.pg-field-size.php                         24-May-2024 16:04                9529
function.pg-field-table.php                        24-May-2024 16:04                9215
function.pg-field-type-oid.php                     24-May-2024 16:04                7810
function.pg-field-type.php                         24-May-2024 16:04                7500
function.pg-flush.php                              24-May-2024 16:04                3980
function.pg-free-result.php                        24-May-2024 16:04                7786
function.pg-get-notify.php                         24-May-2024 16:04                7960
function.pg-get-pid.php                            24-May-2024 16:04                5367
function.pg-get-result.php                         24-May-2024 16:04                9121
function.pg-host.php                               24-May-2024 16:04                6633
function.pg-insert.php                             24-May-2024 16:04               12746
function.pg-last-error.php                         24-May-2024 16:04                7941
function.pg-last-notice.php                        24-May-2024 16:04                9032
function.pg-last-oid.php                           24-May-2024 16:04                8009
function.pg-lo-close.php                           24-May-2024 16:04                7547
function.pg-lo-create.php                          24-May-2024 16:04                9340
function.pg-lo-export.php                          24-May-2024 16:04                8755
function.pg-lo-import.php                          24-May-2024 16:04                8144
function.pg-lo-open.php                            24-May-2024 16:04                9728
function.pg-lo-read-all.php                        24-May-2024 16:04                6782
function.pg-lo-read.php                            24-May-2024 16:04                7357
function.pg-lo-seek.php                            24-May-2024 16:04                8383
function.pg-lo-tell.php                            24-May-2024 16:04                7287
function.pg-lo-truncate.php                        24-May-2024 16:04                6943
function.pg-lo-unlink.php                          24-May-2024 16:04                7729
function.pg-lo-write.php                           24-May-2024 16:04                8674
function.pg-meta-data.php                          24-May-2024 16:04                7770
function.pg-num-fields.php                         24-May-2024 16:04                6250
function.pg-num-rows.php                           24-May-2024 16:04                6195
function.pg-options.php                            24-May-2024 16:04                5924
function.pg-parameter-status.php                   24-May-2024 16:04                9219
function.pg-pconnect.php                           24-May-2024 16:04               10755
function.pg-ping.php                               24-May-2024 16:04                6508
function.pg-port.php                               24-May-2024 16:04                6112
function.pg-prepare.php                            24-May-2024 16:04               11461
function.pg-put-line.php                           24-May-2024 16:04                9459
function.pg-query-params.php                       24-May-2024 16:04               11834
function.pg-query.php                              24-May-2024 16:04               13117
function.pg-result-error-field.php                 24-May-2024 16:04               10111
function.pg-result-error.php                       24-May-2024 16:04                8568
function.pg-result-seek.php                        24-May-2024 16:04                7686
function.pg-result-status.php                      24-May-2024 16:04                9020
function.pg-select.php                             24-May-2024 16:04               12817
function.pg-send-execute.php                       24-May-2024 16:04               10982
function.pg-send-prepare.php                       24-May-2024 16:04               11475
function.pg-send-query-params.php                  24-May-2024 16:04                8470
function.pg-send-query.php                         24-May-2024 16:04               10339
function.pg-set-client-encoding.php                24-May-2024 16:04                9562
function.pg-set-error-context-visibility.php       24-May-2024 16:04                7058
function.pg-set-error-verbosity.php                24-May-2024 16:04                9576
function.pg-socket.php                             24-May-2024 16:04                4138
function.pg-trace.php                              24-May-2024 16:04                9851
function.pg-transaction-status.php                 24-May-2024 16:04                7046
function.pg-tty.php                                24-May-2024 16:04                6462
function.pg-unescape-bytea.php                     24-May-2024 16:04                6694
function.pg-untrace.php                            24-May-2024 16:04                7180
function.pg-update.php                             24-May-2024 16:04               11493
function.pg-version.php                            24-May-2024 16:04                7026
function.php-ini-loaded-file.php                   24-May-2024 16:04                4825
function.php-ini-scanned-files.php                 24-May-2024 16:04                6547
function.php-sapi-name.php                         24-May-2024 16:04                6377
function.php-strip-whitespace.php                  24-May-2024 16:05                4961
function.php-uname.php                             24-May-2024 16:04                9394
function.phpcredits.php                            24-May-2024 16:04                8552
function.phpdbg-break-file.php                     24-May-2024 16:04                3906
function.phpdbg-break-function.php                 24-May-2024 16:04                3643
function.phpdbg-break-method.php                   24-May-2024 16:04                3973
function.phpdbg-break-next.php                     24-May-2024 16:04                3309
function.phpdbg-clear.php                          24-May-2024 16:04                3677
function.phpdbg-color.php                          24-May-2024 16:04                3900
function.phpdbg-end-oplog.php                      24-May-2024 16:04                2694
function.phpdbg-exec.php                           24-May-2024 16:04                3276
function.phpdbg-get-executable.php                 24-May-2024 16:04                2637
function.phpdbg-prompt.php                         24-May-2024 16:04                2921
function.phpdbg-start-oplog.php                    24-May-2024 16:04                2360
function.phpinfo.php                               24-May-2024 16:04                9935
function.phpversion.php                            24-May-2024 16:04               11369
function.pi.php                                    24-May-2024 16:04                3154
function.png2wbmp.php                              24-May-2024 16:04                6776
function.popen.php                                 24-May-2024 16:04                9447
function.pos.php                                   24-May-2024 16:05                1666
function.posix-access.php                          24-May-2024 16:04                6920
function.posix-ctermid.php                         24-May-2024 16:04                4479
function.posix-eaccess.php                         24-May-2024 16:04                7831
function.posix-errno.php                           24-May-2024 16:04                1827
function.posix-fpathconf.php                       24-May-2024 16:04                7034
function.posix-get-last-error.php                  24-May-2024 16:04                4403
function.posix-getcwd.php                          24-May-2024 16:04                4448
function.posix-getegid.php                         24-May-2024 16:04                5320
function.posix-geteuid.php                         24-May-2024 16:04                5344
function.posix-getgid.php                          24-May-2024 16:04                4811
function.posix-getgrgid.php                        24-May-2024 16:04                6525
function.posix-getgrnam.php                        24-May-2024 16:04                6510
function.posix-getgroups.php                       24-May-2024 16:04                4340
function.posix-getlogin.php                        24-May-2024 16:04                3659
function.posix-getpgid.php                         24-May-2024 16:04                4785
function.posix-getpgrp.php                         24-May-2024 16:04                2621
function.posix-getpid.php                          24-May-2024 16:04                3310
function.posix-getppid.php                         24-May-2024 16:04                2928
function.posix-getpwnam.php                        24-May-2024 16:04                7254
function.posix-getpwuid.php                        24-May-2024 16:04                7203
function.posix-getrlimit.php                       24-May-2024 16:04                8947
function.posix-getsid.php                          24-May-2024 16:04                4861
function.posix-getuid.php                          24-May-2024 16:04                3372
function.posix-initgroups.php                      24-May-2024 16:04                3422
function.posix-isatty.php                          24-May-2024 16:04                4691
function.posix-kill.php                            24-May-2024 16:04                3614
function.posix-mkfifo.php                          24-May-2024 16:04                3786
function.posix-mknod.php                           24-May-2024 16:04                7748
function.posix-pathconf.php                        24-May-2024 16:04                6466
function.posix-setegid.php                         24-May-2024 16:04                5293
function.posix-seteuid.php                         24-May-2024 16:04                3644
function.posix-setgid.php                          24-May-2024 16:04                5554
function.posix-setpgid.php                         24-May-2024 16:04                3565
function.posix-setrlimit.php                       24-May-2024 16:04                5047
function.posix-setsid.php                          24-May-2024 16:04                2681
function.posix-setuid.php                          24-May-2024 16:04                5622
function.posix-strerror.php                        24-May-2024 16:04                5050
function.posix-sysconf.php                         24-May-2024 16:04                4104
function.posix-times.php                           24-May-2024 16:04                5014
function.posix-ttyname.php                         24-May-2024 16:04                5364
function.posix-uname.php                           24-May-2024 16:04                5251
function.pow.php                                   24-May-2024 16:04                6875
function.preg-filter.php                           24-May-2024 16:05               10061
function.preg-grep.php                             24-May-2024 16:05                6069
function.preg-last-error-msg.php                   24-May-2024 16:05                4219
function.preg-last-error.php                       24-May-2024 16:05                5254
function.preg-match-all.php                        24-May-2024 16:05               26545
function.preg-match.php                            24-May-2024 16:05               24546
function.preg-quote.php                            24-May-2024 16:05                8983
function.preg-replace-callback-array.php           24-May-2024 16:05               10884
function.preg-replace-callback.php                 24-May-2024 16:05               18300
function.preg-replace.php                          24-May-2024 16:05               25630
function.preg-split.php                            24-May-2024 16:05               13261
function.prev.php                                  24-May-2024 16:05                9590
function.print-r.php                               24-May-2024 16:05                9597
function.print.php                                 24-May-2024 16:05               13228
function.printf.php                                24-May-2024 16:05               30044
function.proc-close.php                            24-May-2024 16:04                3904
function.proc-get-status.php                       24-May-2024 16:04                7015
function.proc-nice.php                             24-May-2024 16:04                8219
function.proc-open.php                             24-May-2024 16:04               24395
function.proc-terminate.php                        24-May-2024 16:04                4997
function.property-exists.php                       24-May-2024 16:05                8873
function.ps-add-bookmark.php                       24-May-2024 16:04                5572
function.ps-add-launchlink.php                     24-May-2024 16:04                6026
function.ps-add-locallink.php                      24-May-2024 16:04                6955
function.ps-add-note.php                           24-May-2024 16:04                7682
function.ps-add-pdflink.php                        24-May-2024 16:04                7351
function.ps-add-weblink.php                        24-May-2024 16:04                6137
function.ps-arc.php                                24-May-2024 16:04                5483
function.ps-arcn.php                               24-May-2024 16:04                5490
function.ps-begin-page.php                         24-May-2024 16:04                7955
function.ps-begin-pattern.php                      24-May-2024 16:04               13664
function.ps-begin-template.php                     24-May-2024 16:04               11715
function.ps-circle.php                             24-May-2024 16:04                4919
function.ps-clip.php                               24-May-2024 16:04                3205
function.ps-close-image.php                        24-May-2024 16:04                4155
function.ps-close.php                              24-May-2024 16:04                3982
function.ps-closepath-stroke.php                   24-May-2024 16:04                3250
function.ps-closepath.php                          24-May-2024 16:04                3461
function.ps-continue-text.php                      24-May-2024 16:04                4406
function.ps-curveto.php                            24-May-2024 16:04                5233
function.ps-delete.php                             24-May-2024 16:04                3890
function.ps-end-page.php                           24-May-2024 16:04                3614
function.ps-end-pattern.php                        24-May-2024 16:04                3424
function.ps-end-template.php                       24-May-2024 16:04                3455
function.ps-fill-stroke.php                        24-May-2024 16:04                3501
function.ps-fill.php                               24-May-2024 16:04                3432
function.ps-findfont.php                           24-May-2024 16:04                8240
function.ps-get-buffer.php                         24-May-2024 16:04                3433
function.ps-get-parameter.php                      24-May-2024 16:04                7737
function.ps-get-value.php                          24-May-2024 16:04               10111
function.ps-hyphenate.php                          24-May-2024 16:04                7783
function.ps-include-file.php                       24-May-2024 16:04                3317
function.ps-lineto.php                             24-May-2024 16:04                8407
function.ps-makespotcolor.php                      24-May-2024 16:04               10517
function.ps-moveto.php                             24-May-2024 16:04                4044
function.ps-new.php                                24-May-2024 16:04                3408
function.ps-open-file.php                          24-May-2024 16:04                3948
function.ps-open-image-file.php                    24-May-2024 16:04                5133
function.ps-open-image.php                         24-May-2024 16:04                7293
function.ps-open-memory-image.php                  24-May-2024 16:04                2966
function.ps-place-image.php                        24-May-2024 16:04                5440
function.ps-rect.php                               24-May-2024 16:04                5161
function.ps-restore.php                            24-May-2024 16:04                3618
function.ps-rotate.php                             24-May-2024 16:04               12356
function.ps-save.php                               24-May-2024 16:04                3372
function.ps-scale.php                              24-May-2024 16:04                3903
function.ps-set-border-color.php                   24-May-2024 16:04                4982
function.ps-set-border-dash.php                    24-May-2024 16:04                4598
function.ps-set-border-style.php                   24-May-2024 16:04                4720
function.ps-set-info.php                           24-May-2024 16:04                6480
function.ps-set-parameter.php                      24-May-2024 16:04                4227
function.ps-set-text-pos.php                       24-May-2024 16:04                9612
function.ps-set-value.php                          24-May-2024 16:04                4944
function.ps-setcolor.php                           24-May-2024 16:04                6395
function.ps-setdash.php                            24-May-2024 16:04                3778
function.ps-setflat.php                            24-May-2024 16:04                3327
function.ps-setfont.php                            24-May-2024 16:04                4334
function.ps-setgray.php                            24-May-2024 16:04                3500
function.ps-setlinecap.php                         24-May-2024 16:04                4019
function.ps-setlinejoin.php                        24-May-2024 16:04                4039
function.ps-setlinewidth.php                       24-May-2024 16:04                3862
function.ps-setmiterlimit.php                      24-May-2024 16:04                4412
function.ps-setoverprintmode.php                   24-May-2024 16:04                3334
function.ps-setpolydash.php                        24-May-2024 16:04                8005
function.ps-shading-pattern.php                    24-May-2024 16:04                4583
function.ps-shading.php                            24-May-2024 16:04                7695
function.ps-shfill.php                             24-May-2024 16:04                4293
function.ps-show-boxed.php                         24-May-2024 16:04               14049
function.ps-show-xy.php                            24-May-2024 16:04                4422
function.ps-show-xy2.php                           24-May-2024 16:04                3315
function.ps-show.php                               24-May-2024 16:04                6387
function.ps-show2.php                              24-May-2024 16:04                3474
function.ps-string-geometry.php                    24-May-2024 16:04                5129
function.ps-stringwidth.php                        24-May-2024 16:04                4643
function.ps-stroke.php                             24-May-2024 16:04                3616
function.ps-symbol-name.php                        24-May-2024 16:04                4118
function.ps-symbol-width.php                       24-May-2024 16:04                4775
function.ps-symbol.php                             24-May-2024 16:04                3996
function.ps-translate.php                          24-May-2024 16:04               14325
function.pspell-add-to-personal.php                24-May-2024 16:04                6763
function.pspell-add-to-session.php                 24-May-2024 16:04                4341
function.pspell-check.php                          24-May-2024 16:04                5236
function.pspell-clear-session.php                  24-May-2024 16:04                6101
function.pspell-config-create.php                  24-May-2024 16:04                8551
function.pspell-config-data-dir.php                24-May-2024 16:04                3610
function.pspell-config-dict-dir.php                24-May-2024 16:04                3604
function.pspell-config-ignore.php                  24-May-2024 16:04                5987
function.pspell-config-mode.php                    24-May-2024 16:04                6822
function.pspell-config-personal.php                24-May-2024 16:04                6961
function.pspell-config-repl.php                    24-May-2024 16:04                7273
function.pspell-config-runtogether.php             24-May-2024 16:04                6725
function.pspell-config-save-repl.php               24-May-2024 16:04                5691
function.pspell-new-config.php                     24-May-2024 16:04                6702
function.pspell-new-personal.php                   24-May-2024 16:04               11891
function.pspell-new.php                            24-May-2024 16:04               10211
function.pspell-save-wordlist.php                  24-May-2024 16:04                6347
function.pspell-store-replacement.php              24-May-2024 16:04                8112
function.pspell-suggest.php                        24-May-2024 16:04                5757
function.putenv.php                                24-May-2024 16:04                4172
function.quoted-printable-decode.php               24-May-2024 16:05                5263
function.quoted-printable-encode.php               24-May-2024 16:05                5021
function.quotemeta.php                             24-May-2024 16:05                5977
function.rad2deg.php                               24-May-2024 16:04                3634
function.radius-acct-open.php                      24-May-2024 16:04                3367
function.radius-add-server.php                     24-May-2024 16:04                8185
function.radius-auth-open.php                      24-May-2024 16:04                3376
function.radius-close.php                          24-May-2024 16:04                2793
function.radius-config.php                         24-May-2024 16:04                4286
function.radius-create-request.php                 24-May-2024 16:04                5488
function.radius-cvt-addr.php                       24-May-2024 16:04                6286
function.radius-cvt-int.php                        24-May-2024 16:04                5677
function.radius-cvt-string.php                     24-May-2024 16:04                5745
function.radius-demangle-mppe-key.php              24-May-2024 16:04                3415
function.radius-demangle.php                       24-May-2024 16:04                3129
function.radius-get-attr.php                       24-May-2024 16:04                6565
function.radius-get-tagged-attr-data.php           24-May-2024 16:04                6580
function.radius-get-tagged-attr-tag.php            24-May-2024 16:04                6633
function.radius-get-vendor-attr.php                24-May-2024 16:04                8284
function.radius-put-addr.php                       24-May-2024 16:04                5722
function.radius-put-attr.php                       24-May-2024 16:04                8942
function.radius-put-int.php                        24-May-2024 16:04                7667
function.radius-put-string.php                     24-May-2024 16:04                8173
function.radius-put-vendor-addr.php                24-May-2024 16:04                5682
function.radius-put-vendor-attr.php                24-May-2024 16:04                7925
function.radius-put-vendor-int.php                 24-May-2024 16:04                6438
function.radius-put-vendor-string.php              24-May-2024 16:04                6956
function.radius-request-authenticator.php          24-May-2024 16:04                3278
function.radius-salt-encrypt-attr.php              24-May-2024 16:04                4309
function.radius-send-request.php                   24-May-2024 16:04                4174
function.radius-server-secret.php                  24-May-2024 16:04                2809
function.radius-strerror.php                       24-May-2024 16:04                2719
function.rand.php                                  24-May-2024 16:05               11112
function.random-bytes.php                          24-May-2024 16:05               10199
function.random-int.php                            24-May-2024 16:05               10088
function.range.php                                 24-May-2024 16:05               17078
function.rar-wrapper-cache-stats.php               24-May-2024 16:04                2439
function.rawurldecode.php                          24-May-2024 16:05                4777
function.rawurlencode.php                          24-May-2024 16:05                6539
function.read-exif-data.php                        24-May-2024 16:04                2565
function.readdir.php                               24-May-2024 16:04               10864
function.readfile.php                              24-May-2024 16:04               10300
function.readgzfile.php                            24-May-2024 16:04                4835
function.readline-add-history.php                  24-May-2024 16:04                2863
function.readline-callback-handler-install.php     24-May-2024 16:04               10001
function.readline-callback-handler-remove.php      24-May-2024 16:04                4124
function.readline-callback-read-char.php           24-May-2024 16:04                4036
function.readline-clear-history.php                24-May-2024 16:04                2618
function.readline-completion-function.php          24-May-2024 16:04                3184
function.readline-info.php                         24-May-2024 16:04                5107
function.readline-list-history.php                 24-May-2024 16:04                2459
function.readline-on-new-line.php                  24-May-2024 16:04                2839
function.readline-read-history.php                 24-May-2024 16:04                3615
function.readline-redisplay.php                    24-May-2024 16:04                2306
function.readline-write-history.php                24-May-2024 16:04                3571
function.readline.php                              24-May-2024 16:04                5306
function.readlink.php                              24-May-2024 16:04                4699
function.realpath-cache-get.php                    24-May-2024 16:04                4392
function.realpath-cache-size.php                   24-May-2024 16:04                3815
function.realpath.php                              24-May-2024 16:04                9226
function.recode-file.php                           24-May-2024 16:04                5931
function.recode-string.php                         24-May-2024 16:04                5306
function.recode.php                                24-May-2024 16:04                1766
function.register-shutdown-function.php            24-May-2024 16:05                8128
function.register-tick-function.php                24-May-2024 16:05                5549
function.rename.php                                24-May-2024 16:04                6279
function.require-once.php                          24-May-2024 16:04                1992
function.require.php                               24-May-2024 16:04                2184
function.reset.php                                 24-May-2024 16:05               10208
function.restore-error-handler.php                 24-May-2024 16:04                5899
function.restore-exception-handler.php             24-May-2024 16:04                6636
function.restore-include-path.php                  24-May-2024 16:04                5289
function.return.php                                24-May-2024 16:04                4879
function.rewind.php                                24-May-2024 16:04                6666
function.rewinddir.php                             24-May-2024 16:04                3683
function.rmdir.php                                 24-May-2024 16:04                5361
function.rnp-backend-string.php                    24-May-2024 16:04                2281
function.rnp-backend-version.php                   24-May-2024 16:04                2217
function.rnp-decrypt.php                           24-May-2024 16:04                3258
function.rnp-dump-packets-to-json.php              24-May-2024 16:04                3172
function.rnp-dump-packets.php                      24-May-2024 16:04                3126
function.rnp-ffi-create.php                        24-May-2024 16:04                3221
function.rnp-ffi-destroy.php                       24-May-2024 16:04                2445
function.rnp-ffi-set-pass-provider.php             24-May-2024 16:04                6756
function.rnp-import-keys.php                       24-May-2024 16:04                3510
function.rnp-import-signatures.php                 24-May-2024 16:04                3500
function.rnp-key-export-autocrypt.php              24-May-2024 16:04                4561
function.rnp-key-export-revocation.php             24-May-2024 16:04                5206
function.rnp-key-export.php                        24-May-2024 16:04                3480
function.rnp-key-get-info.php                      24-May-2024 16:04                7993
function.rnp-key-remove.php                        24-May-2024 16:04                3620
function.rnp-key-revoke.php                        24-May-2024 16:04                4852
function.rnp-list-keys.php                         24-May-2024 16:04                3163
function.rnp-load-keys-from-path.php               24-May-2024 16:04                3859
function.rnp-load-keys.php                         24-May-2024 16:04                3815
function.rnp-locate-key.php                        24-May-2024 16:04                3583
function.rnp-op-encrypt.php                        24-May-2024 16:04                7945
function.rnp-op-generate-key.php                   24-May-2024 16:04                7564
function.rnp-op-sign-cleartext.php                 24-May-2024 16:04                5214
function.rnp-op-sign-detached.php                  24-May-2024 16:04                5093
function.rnp-op-sign.php                           24-May-2024 16:04                6174
function.rnp-op-verify-detached.php                24-May-2024 16:04                7098
function.rnp-op-verify.php                         24-May-2024 16:04                6837
function.rnp-save-keys-to-path.php                 24-May-2024 16:04                3873
function.rnp-save-keys.php                         24-May-2024 16:04                3846
function.rnp-supported-features.php                24-May-2024 16:04                2940
function.rnp-version-string-full.php               24-May-2024 16:04                2302
function.rnp-version-string.php                    24-May-2024 16:04                2199
function.round.php                                 24-May-2024 16:04               24474
function.rpmaddtag.php                             24-May-2024 16:04                3349
function.rpmdbinfo.php                             24-May-2024 16:04                5222
function.rpmdbsearch.php                           24-May-2024 16:04                6122
function.rpmgetsymlink.php                         24-May-2024 16:04                2972
function.rpminfo.php                               24-May-2024 16:04                5404
function.rpmvercmp.php                             24-May-2024 16:04                4903
function.rrd-create.php                            24-May-2024 16:05                2976
function.rrd-error.php                             24-May-2024 16:05                2129
function.rrd-fetch.php                             24-May-2024 16:05                2950
function.rrd-first.php                             24-May-2024 16:05                2944
function.rrd-graph.php                             24-May-2024 16:05                3196
function.rrd-info.php                              24-May-2024 16:05                2529
function.rrd-last.php                              24-May-2024 16:05                2463
function.rrd-lastupdate.php                        24-May-2024 16:05                2659
function.rrd-restore.php                           24-May-2024 16:05                3365
function.rrd-tune.php                              24-May-2024 16:05                3047
function.rrd-update.php                            24-May-2024 16:05                3120
function.rrd-version.php                           24-May-2024 16:05                2223
function.rrd-xport.php                             24-May-2024 16:05                2703
function.rrdc-disconnect.php                       24-May-2024 16:05                2576
function.rsort.php                                 24-May-2024 16:05                9653
function.rtrim.php                                 24-May-2024 16:05                9757
function.runkit7-constant-add.php                  24-May-2024 16:04                4464
function.runkit7-constant-redefine.php             24-May-2024 16:04                4340
function.runkit7-constant-remove.php               24-May-2024 16:04                3674
function.runkit7-function-add.php                  24-May-2024 16:04                9762
function.runkit7-function-copy.php                 24-May-2024 16:04                5523
function.runkit7-function-redefine.php             24-May-2024 16:04               10222
function.runkit7-function-remove.php               24-May-2024 16:04                4171
function.runkit7-function-rename.php               24-May-2024 16:04                4448
function.runkit7-import.php                        24-May-2024 16:04                3857
function.runkit7-method-add.php                    24-May-2024 16:04               11782
function.runkit7-method-copy.php                   24-May-2024 16:04                7061
function.runkit7-method-redefine.php               24-May-2024 16:04               12218
function.runkit7-method-remove.php                 24-May-2024 16:04                6490
function.runkit7-method-rename.php                 24-May-2024 16:04                6652
function.runkit7-object-id.php                     24-May-2024 16:04                3780
function.runkit7-superglobals.php                  24-May-2024 16:04                2652
function.runkit7-zval-inspect.php                  24-May-2024 16:04                5108
function.sapi-windows-cp-conv.php                  24-May-2024 16:05                5060
function.sapi-windows-cp-get.php                   24-May-2024 16:05                3745
function.sapi-windows-cp-is-utf8.php               24-May-2024 16:05                2835
function.sapi-windows-cp-set.php                   24-May-2024 16:05                3191
function.sapi-windows-generate-ctrl-event.php      24-May-2024 16:05                8060
function.sapi-windows-set-ctrl-handler.php         24-May-2024 16:05                8044
function.sapi-windows-vt100-support.php            24-May-2024 16:05               12021
function.scandir.php                               24-May-2024 16:04                9215
function.scoutapm-get-calls.php                    24-May-2024 16:05                4641
function.scoutapm-list-instrumented-functions.php  24-May-2024 16:05                3884
function.seaslog-get-author.php                    24-May-2024 16:05                3144
function.seaslog-get-version.php                   24-May-2024 16:05                3145
function.sem-acquire.php                           24-May-2024 16:04                5521
function.sem-get.php                               24-May-2024 16:04                7507
function.sem-release.php                           24-May-2024 16:04                4453
function.sem-remove.php                            24-May-2024 16:04                4400
function.serialize.php                             24-May-2024 16:05               11367
function.session-abort.php                         24-May-2024 16:05                4397
function.session-cache-expire.php                  24-May-2024 16:05                7799
function.session-cache-limiter.php                 24-May-2024 16:05                9590
function.session-commit.php                        24-May-2024 16:05                1879
function.session-create-id.php                     24-May-2024 16:05               10988
function.session-decode.php                        24-May-2024 16:05                3995
function.session-destroy.php                       24-May-2024 16:05               10034
function.session-encode.php                        24-May-2024 16:05                4253
function.session-gc.php                            24-May-2024 16:05                8466
function.session-get-cookie-params.php             24-May-2024 16:05                5705
function.session-id.php                            24-May-2024 16:05                6717
function.session-module-name.php                   24-May-2024 16:05                4856
function.session-name.php                          24-May-2024 16:05                8679
function.session-regenerate-id.php                 24-May-2024 16:05               17413
function.session-register-shutdown.php             24-May-2024 16:05                2853
function.session-reset.php                         24-May-2024 16:05                4302
function.session-save-path.php                     24-May-2024 16:05                5038
function.session-set-cookie-params.php             24-May-2024 16:05               11327
function.session-set-save-handler.php              24-May-2024 16:05               26004
function.session-start.php                         24-May-2024 16:05               15515
function.session-status.php                        24-May-2024 16:05                3472
function.session-unset.php                         24-May-2024 16:05                5359
function.session-write-close.php                   24-May-2024 16:05                4511
function.set-error-handler.php                     24-May-2024 16:04               27587
function.set-exception-handler.php                 24-May-2024 16:04                7243
function.set-file-buffer.php                       24-May-2024 16:04                1851
function.set-include-path.php                      24-May-2024 16:04                6389
function.set-time-limit.php                        24-May-2024 16:04                4989
function.setcookie.php                             24-May-2024 16:05               29549
function.setlocale.php                             24-May-2024 16:05               16126
function.setrawcookie.php                          24-May-2024 16:05                6529
function.settype.php                               24-May-2024 16:05                6494
function.sha1-file.php                             24-May-2024 16:05                5837
function.sha1.php                                  24-May-2024 16:05                6099
function.shell-exec.php                            24-May-2024 16:04                6064
function.shm-attach.php                            24-May-2024 16:04                6444
function.shm-detach.php                            24-May-2024 16:04                4759
function.shm-get-var.php                           24-May-2024 16:04                4531
function.shm-has-var.php                           24-May-2024 16:04                4529
function.shm-put-var.php                           24-May-2024 16:04                5680
function.shm-remove-var.php                        24-May-2024 16:04                4404
function.shm-remove.php                            24-May-2024 16:04                4122
function.shmop-close.php                           24-May-2024 16:04                5068
function.shmop-delete.php                          24-May-2024 16:04                4370
function.shmop-open.php                            24-May-2024 16:04               10645
function.shmop-read.php                            24-May-2024 16:04                7102
function.shmop-size.php                            24-May-2024 16:04                4417
function.shmop-write.php                           24-May-2024 16:04                6514
function.show-source.php                           24-May-2024 16:05                1800
function.shuffle.php                               24-May-2024 16:05                7453
function.simdjson-decode.php                       24-May-2024 16:04               17006
function.simdjson-is-valid.php                     24-May-2024 16:04               10483
function.simdjson-key-count.php                    24-May-2024 16:04                4813
function.simdjson-key-exists.php                   24-May-2024 16:04                4608
function.simdjson-key-value.php                    24-May-2024 16:04                7346
function.similar-text.php                          24-May-2024 16:05                7760
function.simplexml-import-dom.php                  24-May-2024 16:05                6647
function.simplexml-load-file.php                   24-May-2024 16:05               10760
function.simplexml-load-string.php                 24-May-2024 16:05               10402
function.sin.php                                   24-May-2024 16:04                4670
function.sinh.php                                  24-May-2024 16:04                3423
function.sizeof.php                                24-May-2024 16:05                1686
function.sleep.php                                 24-May-2024 16:05                7443
function.snmp-get-quick-print.php                  24-May-2024 16:05                3822
function.snmp-get-valueretrieval.php               24-May-2024 16:05                4478
function.snmp-read-mib.php                         24-May-2024 16:05                4923
function.snmp-set-enum-print.php                   24-May-2024 16:05                5491
function.snmp-set-oid-numeric-print.php            24-May-2024 16:05                2373
function.snmp-set-oid-output-format.php            24-May-2024 16:05                7944
function.snmp-set-quick-print.php                  24-May-2024 16:05                7579
function.snmp-set-valueretrieval.php               24-May-2024 16:05                9684
function.snmp2-get.php                             24-May-2024 16:05                5907
function.snmp2-getnext.php                         24-May-2024 16:05                6331
function.snmp2-real-walk.php                       24-May-2024 16:05                6682
function.snmp2-set.php                             24-May-2024 16:05               11611
function.snmp2-walk.php                            24-May-2024 16:05                7366
function.snmp3-get.php                             24-May-2024 16:05                9148
function.snmp3-getnext.php                         24-May-2024 16:05                9534
function.snmp3-real-walk.php                       24-May-2024 16:05               10113
function.snmp3-set.php                             24-May-2024 16:05               14493
function.snmp3-walk.php                            24-May-2024 16:05               10879
function.snmpget.php                               24-May-2024 16:05                5934
function.snmpgetnext.php                           24-May-2024 16:05                6202
function.snmprealwalk.php                          24-May-2024 16:05                6582
function.snmpset.php                               24-May-2024 16:05               11669
function.snmpwalk.php                              24-May-2024 16:05                7503
function.snmpwalkoid.php                           24-May-2024 16:05                8186
function.socket-accept.php                         24-May-2024 16:05                7304
function.socket-addrinfo-bind.php                  24-May-2024 16:05                5699
function.socket-addrinfo-connect.php               24-May-2024 16:05                5475
function.socket-addrinfo-explain.php               24-May-2024 16:05                4649
function.socket-addrinfo-lookup.php                24-May-2024 16:05                6447
function.socket-atmark.php                         24-May-2024 16:05                5100
function.socket-bind.php                           24-May-2024 16:05               11474
function.socket-clear-error.php                    24-May-2024 16:05                4866
function.socket-close.php                          24-May-2024 16:05                4738
function.socket-cmsg-space.php                     24-May-2024 16:05                3865
function.socket-connect.php                        24-May-2024 16:05                8154
function.socket-create-listen.php                  24-May-2024 16:05                7590
function.socket-create-pair.php                    24-May-2024 16:05               20216
function.socket-create.php                         24-May-2024 16:05               14380
function.socket-export-stream.php                  24-May-2024 16:05                3648
function.socket-get-option.php                     24-May-2024 16:05               33461
function.socket-get-status.php                     24-May-2024 16:05                1881
function.socket-getopt.php                         24-May-2024 16:05                1856
function.socket-getpeername.php                    24-May-2024 16:05                8947
function.socket-getsockname.php                    24-May-2024 16:05                8250
function.socket-import-stream.php                  24-May-2024 16:05                5328
function.socket-last-error.php                     24-May-2024 16:05                7619
function.socket-listen.php                         24-May-2024 16:05                7755
function.socket-read.php                           24-May-2024 16:05                8519
function.socket-recv.php                           24-May-2024 16:05               17051
function.socket-recvfrom.php                       24-May-2024 16:05               14639
function.socket-recvmsg.php                        24-May-2024 16:05                4524
function.socket-select.php                         24-May-2024 16:05               17130
function.socket-send.php                           24-May-2024 16:05                7197
function.socket-sendmsg.php                        24-May-2024 16:05                4679
function.socket-sendto.php                         24-May-2024 16:05               10560
function.socket-set-block.php                      24-May-2024 16:05                6431
function.socket-set-blocking.php                   24-May-2024 16:05                1901
function.socket-set-nonblock.php                   24-May-2024 16:05                6853
function.socket-set-option.php                     24-May-2024 16:05               11698
function.socket-set-timeout.php                    24-May-2024 16:05                1869
function.socket-setopt.php                         24-May-2024 16:05                1850
function.socket-shutdown.php                       24-May-2024 16:05                5239
function.socket-strerror.php                       24-May-2024 16:05                7414
function.socket-write.php                          24-May-2024 16:05                7817
function.socket-wsaprotocol-info-export.php        24-May-2024 16:05                5260
function.socket-wsaprotocol-info-import.php        24-May-2024 16:05                4610
function.socket-wsaprotocol-info-release.php       24-May-2024 16:05                3720
function.sodium-add.php                            24-May-2024 16:04                3322
function.sodium-base642bin.php                     24-May-2024 16:04                4967
function.sodium-bin2base64.php                     24-May-2024 16:04                4544
function.sodium-bin2hex.php                        24-May-2024 16:04                2978
function.sodium-compare.php                        24-May-2024 16:04                3645
function.sodium-crypto-aead-aes256gcm-decrypt.php  24-May-2024 16:04                5140
function.sodium-crypto-aead-aes256gcm-encrypt.php  24-May-2024 16:04                4916
function.sodium-crypto-aead-aes256gcm-is-availa..> 24-May-2024 16:04                2985
function.sodium-crypto-aead-aes256gcm-keygen.php   24-May-2024 16:04                2937
function.sodium-crypto-aead-chacha20poly1305-de..> 24-May-2024 16:04                4989
function.sodium-crypto-aead-chacha20poly1305-en..> 24-May-2024 16:04                4725
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-May-2024 16:04                5324
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-May-2024 16:04                4990
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-May-2024 16:04                3129
function.sodium-crypto-aead-chacha20poly1305-ke..> 24-May-2024 16:04                3064
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-May-2024 16:04                5569
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-May-2024 16:04                5267
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-May-2024 16:04                3105
function.sodium-crypto-auth-keygen.php             24-May-2024 16:04                2747
function.sodium-crypto-auth-verify.php             24-May-2024 16:04                4113
function.sodium-crypto-auth.php                    24-May-2024 16:04                3560
function.sodium-crypto-box-keypair-from-secretk..> 24-May-2024 16:04                3596
function.sodium-crypto-box-keypair.php             24-May-2024 16:04                3123
function.sodium-crypto-box-open.php                24-May-2024 16:04                4336
function.sodium-crypto-box-publickey-from-secre..> 24-May-2024 16:04                3450
function.sodium-crypto-box-publickey.php           24-May-2024 16:04                3147
function.sodium-crypto-box-seal-open.php           24-May-2024 16:04                6281
function.sodium-crypto-box-seal.php                24-May-2024 16:04                7478
function.sodium-crypto-box-secretkey.php           24-May-2024 16:04                3110
function.sodium-crypto-box-seed-keypair.php        24-May-2024 16:04                3307
function.sodium-crypto-box.php                     24-May-2024 16:04                4803
function.sodium-crypto-core-ristretto255-add.php   24-May-2024 16:04                6195
function.sodium-crypto-core-ristretto255-from-h..> 24-May-2024 16:04                5602
function.sodium-crypto-core-ristretto255-is-val..> 24-May-2024 16:04                5809
function.sodium-crypto-core-ristretto255-random..> 24-May-2024 16:04                5699
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:04                6467
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:04                3656
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:04                5533
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:04                3949
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:04                5542
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:04                5862
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:04                3618
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:04                6465
function.sodium-crypto-core-ristretto255-sub.php   24-May-2024 16:04                6225
function.sodium-crypto-generichash-final.php       24-May-2024 16:04                6984
function.sodium-crypto-generichash-init.php        24-May-2024 16:04                7045
function.sodium-crypto-generichash-keygen.php      24-May-2024 16:04                2549
function.sodium-crypto-generichash-update.php      24-May-2024 16:04                6657
function.sodium-crypto-generichash.php             24-May-2024 16:04                4043
function.sodium-crypto-kdf-derive-from-key.php     24-May-2024 16:04                4262
function.sodium-crypto-kdf-keygen.php              24-May-2024 16:04                2687
function.sodium-crypto-kx-client-session-keys.php  24-May-2024 16:04                3615
function.sodium-crypto-kx-keypair.php              24-May-2024 16:04                5158
function.sodium-crypto-kx-publickey.php            24-May-2024 16:04                2990
function.sodium-crypto-kx-secretkey.php            24-May-2024 16:04                3004
function.sodium-crypto-kx-seed-keypair.php         24-May-2024 16:04                2888
function.sodium-crypto-kx-server-session-keys.php  24-May-2024 16:04                3691
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-May-2024 16:04                3504
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-May-2024 16:04                3734
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-May-2024 16:04                7120
function.sodium-crypto-pwhash-str-needs-rehash.php 24-May-2024 16:04                4234
function.sodium-crypto-pwhash-str-verify.php       24-May-2024 16:04                5292
function.sodium-crypto-pwhash-str.php              24-May-2024 16:04                9531
function.sodium-crypto-pwhash.php                  24-May-2024 16:04               11222
function.sodium-crypto-scalarmult-base.php         24-May-2024 16:04                2098
function.sodium-crypto-scalarmult-ristretto255-..> 24-May-2024 16:04                3584
function.sodium-crypto-scalarmult-ristretto255.php 24-May-2024 16:04                3972
function.sodium-crypto-scalarmult.php              24-May-2024 16:04                3168
function.sodium-crypto-secretbox-keygen.php        24-May-2024 16:04                6433
function.sodium-crypto-secretbox-open.php          24-May-2024 16:04                9237
function.sodium-crypto-secretbox.php               24-May-2024 16:04                9180
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:04               11221
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:04               10560
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:04                2865
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:04                6238
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:04                6513
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:04                3105
function.sodium-crypto-shorthash-keygen.php        24-May-2024 16:04                2820
function.sodium-crypto-shorthash.php               24-May-2024 16:04                3491
function.sodium-crypto-sign-detached.php           24-May-2024 16:04                3387
function.sodium-crypto-sign-ed25519-pk-to-curve..> 24-May-2024 16:04                3009
function.sodium-crypto-sign-ed25519-sk-to-curve..> 24-May-2024 16:04                3162
function.sodium-crypto-sign-keypair-from-secret..> 24-May-2024 16:04                3393
function.sodium-crypto-sign-keypair.php            24-May-2024 16:04                2552
function.sodium-crypto-sign-open.php               24-May-2024 16:04                3508
function.sodium-crypto-sign-publickey-from-secr..> 24-May-2024 16:04                2986
function.sodium-crypto-sign-publickey.php          24-May-2024 16:04                3032
function.sodium-crypto-sign-secretkey.php          24-May-2024 16:04                3008
function.sodium-crypto-sign-seed-keypair.php       24-May-2024 16:04                3334
function.sodium-crypto-sign-verify-detached.php    24-May-2024 16:04                3710
function.sodium-crypto-sign.php                    24-May-2024 16:04                3607
function.sodium-crypto-stream-keygen.php           24-May-2024 16:04                2726
function.sodium-crypto-stream-xchacha20-keygen.php 24-May-2024 16:04                2882
function.sodium-crypto-stream-xchacha20-xor-ic.php 24-May-2024 16:04               10153
function.sodium-crypto-stream-xchacha20-xor.php    24-May-2024 16:04                5149
function.sodium-crypto-stream-xchacha20.php        24-May-2024 16:04                3963
function.sodium-crypto-stream-xor.php              24-May-2024 16:04                3904
function.sodium-crypto-stream.php                  24-May-2024 16:04                3755
function.sodium-hex2bin.php                        24-May-2024 16:04                3539
function.sodium-increment.php                      24-May-2024 16:04                2648
function.sodium-memcmp.php                         24-May-2024 16:04                3916
function.sodium-memzero.php                        24-May-2024 16:04                2655
function.sodium-pad.php                            24-May-2024 16:04                3082
function.sodium-unpad.php                          24-May-2024 16:04                3000
function.solr-get-version.php                      24-May-2024 16:05                4043
function.sort.php                                  24-May-2024 16:05               13028
function.soundex.php                               24-May-2024 16:05                7424
function.spl-autoload-call.php                     24-May-2024 16:05                2758
function.spl-autoload-extensions.php               24-May-2024 16:05                5108
function.spl-autoload-functions.php                24-May-2024 16:05                3189
function.spl-autoload-register.php                 24-May-2024 16:05               13926
function.spl-autoload-unregister.php               24-May-2024 16:05                3311
function.spl-autoload.php                          24-May-2024 16:05                4949
function.spl-classes.php                           24-May-2024 16:05                3771
function.spl-object-hash.php                       24-May-2024 16:05                5571
function.spl-object-id.php                         24-May-2024 16:05                4441
function.sprintf.php                               24-May-2024 16:05               31375
function.sqlsrv-begin-transaction.php              24-May-2024 16:04               11300
function.sqlsrv-cancel.php                         24-May-2024 16:04               10359
function.sqlsrv-client-info.php                    24-May-2024 16:04                6756
function.sqlsrv-close.php                          24-May-2024 16:04                5628
function.sqlsrv-commit.php                         24-May-2024 16:04               11143
function.sqlsrv-configure.php                      24-May-2024 16:04                4772
function.sqlsrv-connect.php                        24-May-2024 16:04               12193
function.sqlsrv-errors.php                         24-May-2024 16:04               10045
function.sqlsrv-execute.php                        24-May-2024 16:04               10182
function.sqlsrv-fetch-array.php                    24-May-2024 16:04               16097
function.sqlsrv-fetch-object.php                   24-May-2024 16:04               12384
function.sqlsrv-fetch.php                          24-May-2024 16:04               10831
function.sqlsrv-field-metadata.php                 24-May-2024 16:04                8867
function.sqlsrv-free-stmt.php                      24-May-2024 16:04                7760
function.sqlsrv-get-config.php                     24-May-2024 16:04                3353
function.sqlsrv-get-field.php                      24-May-2024 16:04               10203
function.sqlsrv-has-rows.php                       24-May-2024 16:04                6360
function.sqlsrv-next-result.php                    24-May-2024 16:04                9276
function.sqlsrv-num-fields.php                     24-May-2024 16:04                8194
function.sqlsrv-num-rows.php                       24-May-2024 16:04                7921
function.sqlsrv-prepare.php                        24-May-2024 16:04               14539
function.sqlsrv-query.php                          24-May-2024 16:04               11892
function.sqlsrv-rollback.php                       24-May-2024 16:04               10613
function.sqlsrv-rows-affected.php                  24-May-2024 16:04                7971
function.sqlsrv-send-stream-data.php               24-May-2024 16:04                8540
function.sqlsrv-server-info.php                    24-May-2024 16:04                6156
function.sqrt.php                                  24-May-2024 16:04                4645
function.srand.php                                 24-May-2024 16:05                7758
function.sscanf.php                                24-May-2024 16:05               12155
function.ssdeep-fuzzy-compare.php                  24-May-2024 16:05                3295
function.ssdeep-fuzzy-hash-filename.php            24-May-2024 16:05                3020
function.ssdeep-fuzzy-hash.php                     24-May-2024 16:05                2864
function.ssh2-auth-agent.php                       24-May-2024 16:05                4855
function.ssh2-auth-hostbased-file.php              24-May-2024 16:05                7897
function.ssh2-auth-none.php                        24-May-2024 16:05                4957
function.ssh2-auth-password.php                    24-May-2024 16:05                5190
function.ssh2-auth-pubkey-file.php                 24-May-2024 16:05                7460
function.ssh2-connect.php                          24-May-2024 16:05               16489
function.ssh2-disconnect.php                       24-May-2024 16:05                3150
function.ssh2-exec.php                             24-May-2024 16:05                7776
function.ssh2-fetch-stream.php                     24-May-2024 16:05                5758
function.ssh2-fingerprint.php                      24-May-2024 16:05                5687
function.ssh2-forward-accept.php                   24-May-2024 16:05                3280
function.ssh2-forward-listen.php                   24-May-2024 16:05                4769
function.ssh2-methods-negotiated.php               24-May-2024 16:05                8096
function.ssh2-poll.php                             24-May-2024 16:05                3905
function.ssh2-publickey-add.php                    24-May-2024 16:05                8718
function.ssh2-publickey-init.php                   24-May-2024 16:05                5030
function.ssh2-publickey-list.php                   24-May-2024 16:05                9202
function.ssh2-publickey-remove.php                 24-May-2024 16:05                4939
function.ssh2-scp-recv.php                         24-May-2024 16:05                5658
function.ssh2-scp-send.php                         24-May-2024 16:05                6286
function.ssh2-send-eof.php                         24-May-2024 16:05                3729
function.ssh2-sftp-chmod.php                       24-May-2024 16:05                6147
function.ssh2-sftp-lstat.php                       24-May-2024 16:05                7551
function.ssh2-sftp-mkdir.php                       24-May-2024 16:05                7142
function.ssh2-sftp-readlink.php                    24-May-2024 16:05                5520
function.ssh2-sftp-realpath.php                    24-May-2024 16:05                5690
function.ssh2-sftp-rename.php                      24-May-2024 16:05                5711
function.ssh2-sftp-rmdir.php                       24-May-2024 16:05                5749
function.ssh2-sftp-stat.php                        24-May-2024 16:05                7466
function.ssh2-sftp-symlink.php                     24-May-2024 16:05                5963
function.ssh2-sftp-unlink.php                      24-May-2024 16:05                5149
function.ssh2-sftp.php                             24-May-2024 16:05                5622
function.ssh2-shell.php                            24-May-2024 16:05                8254
function.ssh2-tunnel.php                           24-May-2024 16:05                5505
function.stat.php                                  24-May-2024 16:04               17917
function.stats-absolute-deviation.php              24-May-2024 16:04                2853
function.stats-cdf-beta.php                        24-May-2024 16:04                5220
function.stats-cdf-binomial.php                    24-May-2024 16:04                5205
function.stats-cdf-cauchy.php                      24-May-2024 16:04                5240
function.stats-cdf-chisquare.php                   24-May-2024 16:04                4559
function.stats-cdf-exponential.php                 24-May-2024 16:04                4590
function.stats-cdf-f.php                           24-May-2024 16:04                5145
function.stats-cdf-gamma.php                       24-May-2024 16:04                5204
function.stats-cdf-laplace.php                     24-May-2024 16:04                5225
function.stats-cdf-logistic.php                    24-May-2024 16:04                5260
function.stats-cdf-negative-binomial.php           24-May-2024 16:04                5348
function.stats-cdf-noncentral-chisquare.php        24-May-2024 16:04                5450
function.stats-cdf-noncentral-f.php                24-May-2024 16:04                6024
function.stats-cdf-noncentral-t.php                24-May-2024 16:04                5310
function.stats-cdf-normal.php                      24-May-2024 16:04                5242
function.stats-cdf-poisson.php                     24-May-2024 16:04                4524
function.stats-cdf-t.php                           24-May-2024 16:04                4452
function.stats-cdf-uniform.php                     24-May-2024 16:04                5205
function.stats-cdf-weibull.php                     24-May-2024 16:04                5242
function.stats-covariance.php                      24-May-2024 16:04                3053
function.stats-dens-beta.php                       24-May-2024 16:04                3539
function.stats-dens-cauchy.php                     24-May-2024 16:04                3597
function.stats-dens-chisquare.php                  24-May-2024 16:04                3267
function.stats-dens-exponential.php                24-May-2024 16:04                3257
function.stats-dens-f.php                          24-May-2024 16:04                3537
function.stats-dens-gamma.php                      24-May-2024 16:04                3590
function.stats-dens-laplace.php                    24-May-2024 16:04                3624
function.stats-dens-logistic.php                   24-May-2024 16:04                3636
function.stats-dens-normal.php                     24-May-2024 16:04                3607
function.stats-dens-pmf-binomial.php               24-May-2024 16:04                3661
function.stats-dens-pmf-hypergeometric.php         24-May-2024 16:04                4313
function.stats-dens-pmf-negative-binomial.php      24-May-2024 16:04                3790
function.stats-dens-pmf-poisson.php                24-May-2024 16:04                3258
function.stats-dens-t.php                          24-May-2024 16:04                3171
function.stats-dens-uniform.php                    24-May-2024 16:04                3572
function.stats-dens-weibull.php                    24-May-2024 16:04                3604
function.stats-harmonic-mean.php                   24-May-2024 16:04                2752
function.stats-kurtosis.php                        24-May-2024 16:04                2760
function.stats-rand-gen-beta.php                   24-May-2024 16:04                3066
function.stats-rand-gen-chisquare.php              24-May-2024 16:04                2739
function.stats-rand-gen-exponential.php            24-May-2024 16:04                2737
function.stats-rand-gen-f.php                      24-May-2024 16:04                3120
function.stats-rand-gen-funiform.php               24-May-2024 16:04                3047
function.stats-rand-gen-gamma.php                  24-May-2024 16:04                3133
function.stats-rand-gen-ibinomial-negative.php     24-May-2024 16:04                3213
function.stats-rand-gen-ibinomial.php              24-May-2024 16:04                3137
function.stats-rand-gen-int.php                    24-May-2024 16:04                2327
function.stats-rand-gen-ipoisson.php               24-May-2024 16:04                2712
function.stats-rand-gen-iuniform.php               24-May-2024 16:04                3114
function.stats-rand-gen-noncentral-chisquare.php   24-May-2024 16:04                3255
function.stats-rand-gen-noncentral-f.php           24-May-2024 16:04                3608
function.stats-rand-gen-noncentral-t.php           24-May-2024 16:04                3168
function.stats-rand-gen-normal.php                 24-May-2024 16:04                3081
function.stats-rand-gen-t.php                      24-May-2024 16:04                2631
function.stats-rand-get-seeds.php                  24-May-2024 16:04                2370
function.stats-rand-phrase-to-seeds.php            24-May-2024 16:04                2720
function.stats-rand-ranf.php                       24-May-2024 16:04                2371
function.stats-rand-setall.php                     24-May-2024 16:04                2989
function.stats-skew.php                            24-May-2024 16:04                2726
function.stats-standard-deviation.php              24-May-2024 16:04                3897
function.stats-stat-binomial-coef.php              24-May-2024 16:04                3026
function.stats-stat-correlation.php                24-May-2024 16:04                3233
function.stats-stat-factorial.php                  24-May-2024 16:04                2599
function.stats-stat-independent-t.php              24-May-2024 16:04                3391
function.stats-stat-innerproduct.php               24-May-2024 16:04                3175
function.stats-stat-paired-t.php                   24-May-2024 16:04                3112
function.stats-stat-percentile.php                 24-May-2024 16:04                2978
function.stats-stat-powersum.php                   24-May-2024 16:04                2970
function.stats-variance.php                        24-May-2024 16:04                3397
function.stomp-connect-error.php                   24-May-2024 16:05                3748
function.stomp-version.php                         24-May-2024 16:05                3179
function.str-contains.php                          24-May-2024 16:05                8516
function.str-decrement.php                         24-May-2024 16:05                6811
function.str-ends-with.php                         24-May-2024 16:05                8454
function.str-getcsv.php                            24-May-2024 16:05                9831
function.str-increment.php                         24-May-2024 16:05                6455
function.str-ireplace.php                          24-May-2024 16:05               10032
function.str-pad.php                               24-May-2024 16:05                8545
function.str-repeat.php                            24-May-2024 16:05                4764
function.str-replace.php                           24-May-2024 16:05               17643
function.str-rot13.php                             24-May-2024 16:05                3743
function.str-shuffle.php                           24-May-2024 16:05                6367
function.str-split.php                             24-May-2024 16:05                8921
function.str-starts-with.php                       24-May-2024 16:05                8476
function.str-word-count.php                        24-May-2024 16:05                9440
function.strcasecmp.php                            24-May-2024 16:05                6577
function.strchr.php                                24-May-2024 16:05                1708
function.strcmp.php                                24-May-2024 16:05                6295
function.strcoll.php                               24-May-2024 16:05                5417
function.strcspn.php                               24-May-2024 16:05               11729
function.stream-bucket-append.php                  24-May-2024 16:05                2377
function.stream-bucket-make-writeable.php          24-May-2024 16:05                4578
function.stream-bucket-new.php                     24-May-2024 16:05                2414
function.stream-bucket-prepend.php                 24-May-2024 16:05                6448
function.stream-context-create.php                 24-May-2024 16:05                8165
function.stream-context-get-default.php            24-May-2024 16:05                9243
function.stream-context-get-options.php            24-May-2024 16:05                4642
function.stream-context-get-params.php             24-May-2024 16:05                5617
function.stream-context-set-default.php            24-May-2024 16:05                6618
function.stream-context-set-option.php             24-May-2024 16:05                5913
function.stream-context-set-options.php            24-May-2024 16:05                6619
function.stream-context-set-params.php             24-May-2024 16:05                4989
function.stream-copy-to-stream.php                 24-May-2024 16:05                8084
function.stream-filter-append.php                  24-May-2024 16:05               11918
function.stream-filter-prepend.php                 24-May-2024 16:05                9060
function.stream-filter-register.php                24-May-2024 16:05               19120
function.stream-filter-remove.php                  24-May-2024 16:05                6928
function.stream-get-contents.php                   24-May-2024 16:05                9480
function.stream-get-filters.php                    24-May-2024 16:05                4252
function.stream-get-line.php                       24-May-2024 16:05                5512
function.stream-get-meta-data.php                  24-May-2024 16:05               15448
function.stream-get-transports.php                 24-May-2024 16:05                4263
function.stream-get-wrappers.php                   24-May-2024 16:05                5096
function.stream-is-local.php                       24-May-2024 16:05                4334
function.stream-isatty.php                         24-May-2024 16:05                4277
function.stream-notification-callback.php          24-May-2024 16:05               22654
function.stream-register-wrapper.php               24-May-2024 16:05                1982
function.stream-resolve-include-path.php           24-May-2024 16:05                4421
function.stream-select.php                         24-May-2024 16:05               18055
function.stream-set-blocking.php                   24-May-2024 16:05                5405
function.stream-set-chunk-size.php                 24-May-2024 16:05                4581
function.stream-set-read-buffer.php                24-May-2024 16:05                4064
function.stream-set-timeout.php                    24-May-2024 16:05                8502
function.stream-set-write-buffer.php               24-May-2024 16:05                6257
function.stream-socket-accept.php                  24-May-2024 16:05                8235
function.stream-socket-client.php                  24-May-2024 16:05               19264
function.stream-socket-enable-crypto.php           24-May-2024 16:05               13762
function.stream-socket-get-name.php                24-May-2024 16:05                4030
function.stream-socket-pair.php                    24-May-2024 16:05               10169
function.stream-socket-recvfrom.php                24-May-2024 16:05               11542
function.stream-socket-sendto.php                  24-May-2024 16:05                7955
function.stream-socket-server.php                  24-May-2024 16:05               16820
function.stream-socket-shutdown.php                24-May-2024 16:05                6874
function.stream-supports-lock.php                  24-May-2024 16:05                3385
function.stream-wrapper-register.php               24-May-2024 16:05                9818
function.stream-wrapper-restore.php                24-May-2024 16:05                3031
function.stream-wrapper-unregister.php             24-May-2024 16:05                3297
function.strftime.php                              24-May-2024 16:04               56957
function.strip-tags.php                            24-May-2024 16:05               10121
function.stripcslashes.php                         24-May-2024 16:05                4097
function.stripos.php                               24-May-2024 16:05               12496
function.stripslashes.php                          24-May-2024 16:05                7826
function.stristr.php                               24-May-2024 16:05               10905
function.strlen.php                                24-May-2024 16:05                4991
function.strnatcasecmp.php                         24-May-2024 16:05                7971
function.strnatcmp.php                             24-May-2024 16:05                9262
function.strncasecmp.php                           24-May-2024 16:05                7252
function.strncmp.php                               24-May-2024 16:05                7067
function.strpbrk.php                               24-May-2024 16:05                5512
function.strpos.php                                24-May-2024 16:05               14473
function.strptime.php                              24-May-2024 16:04               13100
function.strrchr.php                               24-May-2024 16:05                8713
function.strrev.php                                24-May-2024 16:05                3262
function.strripos.php                              24-May-2024 16:05               11334
function.strrpos.php                               24-May-2024 16:05               13178
function.strspn.php                                24-May-2024 16:05               11061
function.strstr.php                                24-May-2024 16:05                9120
function.strtok.php                                24-May-2024 16:05               13963
function.strtolower.php                            24-May-2024 16:05                6137
function.strtotime.php                             24-May-2024 16:04               13828
function.strtoupper.php                            24-May-2024 16:05                6140
function.strtr.php                                 24-May-2024 16:05               11881
function.strval.php                                24-May-2024 16:05                6640
function.substr-compare.php                        24-May-2024 16:05               11376
function.substr-count.php                          24-May-2024 16:05                9813
function.substr-replace.php                        24-May-2024 16:05               16394
function.substr.php                                24-May-2024 16:05               23288
function.svn-add.php                               24-May-2024 16:05                6621
function.svn-auth-get-parameter.php                24-May-2024 16:05                4107
function.svn-auth-set-parameter.php                24-May-2024 16:05                5589
function.svn-blame.php                             24-May-2024 16:05                5049
function.svn-cat.php                               24-May-2024 16:05                5097
function.svn-checkout.php                          24-May-2024 16:05                7956
function.svn-cleanup.php                           24-May-2024 16:05                5612
function.svn-client-version.php                    24-May-2024 16:05                3737
function.svn-commit.php                            24-May-2024 16:05                8311
function.svn-delete.php                            24-May-2024 16:05                4966
function.svn-diff.php                              24-May-2024 16:05               14490
function.svn-export.php                            24-May-2024 16:05                5442
function.svn-fs-abort-txn.php                      24-May-2024 16:05                3445
function.svn-fs-apply-text.php                     24-May-2024 16:05                2970
function.svn-fs-begin-txn2.php                     24-May-2024 16:05                2958
function.svn-fs-change-node-prop.php               24-May-2024 16:05                3453
function.svn-fs-check-path.php                     24-May-2024 16:05                3066
function.svn-fs-contents-changed.php               24-May-2024 16:05                3540
function.svn-fs-copy.php                           24-May-2024 16:05                4458
function.svn-fs-delete.php                         24-May-2024 16:05                3735
function.svn-fs-dir-entries.php                    24-May-2024 16:05                3104
function.svn-fs-file-contents.php                  24-May-2024 16:05                3115
function.svn-fs-file-length.php                    24-May-2024 16:05                3002
function.svn-fs-is-dir.php                         24-May-2024 16:05                3804
function.svn-fs-is-file.php                        24-May-2024 16:05                3789
function.svn-fs-make-dir.php                       24-May-2024 16:05                3747
function.svn-fs-make-file.php                      24-May-2024 16:05                3762
function.svn-fs-node-created-rev.php               24-May-2024 16:05                3027
function.svn-fs-node-prop.php                      24-May-2024 16:05                3115
function.svn-fs-props-changed.php                  24-May-2024 16:05                3523
function.svn-fs-revision-prop.php                  24-May-2024 16:05                3147
function.svn-fs-revision-root.php                  24-May-2024 16:05                3053
function.svn-fs-txn-root.php                       24-May-2024 16:05                2799
function.svn-fs-youngest-rev.php                   24-May-2024 16:05                2825
function.svn-import.php                            24-May-2024 16:05                6513
function.svn-log.php                               24-May-2024 16:05                9745
function.svn-ls.php                                24-May-2024 16:05                7482
function.svn-mkdir.php                             24-May-2024 16:05                3404
function.svn-repos-create.php                      24-May-2024 16:05                3238
function.svn-repos-fs-begin-txn-for-commit.php     24-May-2024 16:05                3546
function.svn-repos-fs-commit-txn.php               24-May-2024 16:05                2914
function.svn-repos-fs.php                          24-May-2024 16:05                2821
function.svn-repos-hotcopy.php                     24-May-2024 16:05                3194
function.svn-repos-open.php                        24-May-2024 16:05                2721
function.svn-repos-recover.php                     24-May-2024 16:05                2765
function.svn-revert.php                            24-May-2024 16:05                3662
function.svn-status.php                            24-May-2024 16:05               15133
function.svn-update.php                            24-May-2024 16:05                6447
function.swoole-async-dns-lookup.php               24-May-2024 16:05                3909
function.swoole-async-read.php                     24-May-2024 16:05                4498
function.swoole-async-readfile.php                 24-May-2024 16:05                3934
function.swoole-async-set.php                      24-May-2024 16:05                2448
function.swoole-async-write.php                    24-May-2024 16:05                3814
function.swoole-async-writefile.php                24-May-2024 16:05                3842
function.swoole-clear-error.php                    24-May-2024 16:05                2328
function.swoole-client-select.php                  24-May-2024 16:05                3530
function.swoole-cpu-num.php                        24-May-2024 16:05                2179
function.swoole-errno.php                          24-May-2024 16:05                2156
function.swoole-error-log.php                      24-May-2024 16:05                3599
function.swoole-event-add.php                      24-May-2024 16:05                3537
function.swoole-event-defer.php                    24-May-2024 16:05                2697
function.swoole-event-del.php                      24-May-2024 16:05                2663
function.swoole-event-exit.php                     24-May-2024 16:05                2222
function.swoole-event-set.php                      24-May-2024 16:05                3525
function.swoole-event-wait.php                     24-May-2024 16:05                2193
function.swoole-event-write.php                    24-May-2024 16:05                2935
function.swoole-get-local-ip.php                   24-May-2024 16:05                2250
function.swoole-last-error.php                     24-May-2024 16:05                2205
function.swoole-load-module.php                    24-May-2024 16:05                2363
function.swoole-select.php                         24-May-2024 16:05                3497
function.swoole-set-process-name.php               24-May-2024 16:05                2670
function.swoole-strerror.php                       24-May-2024 16:05                2624
function.swoole-timer-after.php                    24-May-2024 16:05                3048
function.swoole-timer-exists.php                   24-May-2024 16:05                2461
function.swoole-timer-tick.php                     24-May-2024 16:05                2925
function.swoole-version.php                        24-May-2024 16:05                2184
function.symlink.php                               24-May-2024 16:04                5796
function.sys-get-temp-dir.php                      24-May-2024 16:04                4303
function.sys-getloadavg.php                        24-May-2024 16:05                4244
function.syslog.php                                24-May-2024 16:05                9783
function.system.php                                24-May-2024 16:04                8110
function.taint.php                                 24-May-2024 16:05                2803
function.tan.php                                   24-May-2024 16:04                4441
function.tanh.php                                  24-May-2024 16:04                3455
function.tcpwrap-check.php                         24-May-2024 16:05                6185
function.tempnam.php                               24-May-2024 16:04                7680
function.textdomain.php                            24-May-2024 16:04                3526
function.tidy-access-count.php                     24-May-2024 16:05                6658
function.tidy-config-count.php                     24-May-2024 16:05                4379
function.tidy-error-count.php                      24-May-2024 16:05                5430
function.tidy-get-output.php                       24-May-2024 16:05                4365
function.tidy-warning-count.php                    24-May-2024 16:05                4969
function.time-nanosleep.php                        24-May-2024 16:05                8839
function.time-sleep-until.php                      24-May-2024 16:05                5918
function.time.php                                  24-May-2024 16:04                4779
function.timezone-abbreviations-list.php           24-May-2024 16:04                1978
function.timezone-identifiers-list.php             24-May-2024 16:04                1994
function.timezone-location-get.php                 24-May-2024 16:04                1950
function.timezone-name-from-abbr.php               24-May-2024 16:04                6532
function.timezone-name-get.php                     24-May-2024 16:04                1894
function.timezone-offset-get.php                   24-May-2024 16:04                1892
function.timezone-open.php                         24-May-2024 16:04                1880
function.timezone-transitions-get.php              24-May-2024 16:04                1953
function.timezone-version-get.php                  24-May-2024 16:04                4666
function.tmpfile.php                               24-May-2024 16:04                5785
function.token-get-all.php                         24-May-2024 16:05               12383
function.token-name.php                            24-May-2024 16:05                4232
function.touch.php                                 24-May-2024 16:04                8397
function.trader-acos.php                           24-May-2024 16:04                2501
function.trader-ad.php                             24-May-2024 16:04                3404
function.trader-add.php                            24-May-2024 16:04                2835
function.trader-adosc.php                          24-May-2024 16:04                4264
function.trader-adx.php                            24-May-2024 16:04                3493
function.trader-adxr.php                           24-May-2024 16:04                3504
function.trader-apo.php                            24-May-2024 16:04                3704
function.trader-aroon.php                          24-May-2024 16:04                3067
function.trader-aroonosc.php                       24-May-2024 16:04                3104
function.trader-asin.php                           24-May-2024 16:04                2519
function.trader-atan.php                           24-May-2024 16:04                2512
function.trader-atr.php                            24-May-2024 16:04                3483
function.trader-avgprice.php                       24-May-2024 16:04                3458
function.trader-bbands.php                         24-May-2024 16:04                4463
function.trader-beta.php                           24-May-2024 16:04                3040
function.trader-bop.php                            24-May-2024 16:04                3407
function.trader-cci.php                            24-May-2024 16:04                3488
function.trader-cdl2crows.php                      24-May-2024 16:04                3480
function.trader-cdl3blackcrows.php                 24-May-2024 16:04                3542
function.trader-cdl3inside.php                     24-May-2024 16:04                3523
function.trader-cdl3linestrike.php                 24-May-2024 16:04                3546
function.trader-cdl3outside.php                    24-May-2024 16:04                3538
function.trader-cdl3starsinsouth.php               24-May-2024 16:04                3587
function.trader-cdl3whitesoldiers.php              24-May-2024 16:04                3611
function.trader-cdlabandonedbaby.php               24-May-2024 16:04                3999
function.trader-cdladvanceblock.php                24-May-2024 16:04                3564
function.trader-cdlbelthold.php                    24-May-2024 16:04                3520
function.trader-cdlbreakaway.php                   24-May-2024 16:04                3534
function.trader-cdlclosingmarubozu.php             24-May-2024 16:04                3605
function.trader-cdlconcealbabyswall.php            24-May-2024 16:04                3628
function.trader-cdlcounterattack.php               24-May-2024 16:04                3592
function.trader-cdldarkcloudcover.php              24-May-2024 16:04                3993
function.trader-cdldoji.php                        24-May-2024 16:04                3477
function.trader-cdldojistar.php                    24-May-2024 16:04                3512
function.trader-cdldragonflydoji.php               24-May-2024 16:04                3567
function.trader-cdlengulfing.php                   24-May-2024 16:04                3552
function.trader-cdleveningdojistar.php             24-May-2024 16:04                4010
function.trader-cdleveningstar.php                 24-May-2024 16:04                3987
function.trader-cdlgapsidesidewhite.php            24-May-2024 16:04                3635
function.trader-cdlgravestonedoji.php              24-May-2024 16:04                3588
function.trader-cdlhammer.php                      24-May-2024 16:04                3503
function.trader-cdlhangingman.php                  24-May-2024 16:04                3524
function.trader-cdlharami.php                      24-May-2024 16:04                3505
function.trader-cdlharamicross.php                 24-May-2024 16:04                3547
function.trader-cdlhighwave.php                    24-May-2024 16:04                3521
function.trader-cdlhikkake.php                     24-May-2024 16:04                3510
function.trader-cdlhikkakemod.php                  24-May-2024 16:04                3551
function.trader-cdlhomingpigeon.php                24-May-2024 16:04                3572
function.trader-cdlidentical3crows.php             24-May-2024 16:04                3596
function.trader-cdlinneck.php                      24-May-2024 16:04                3522
function.trader-cdlinvertedhammer.php              24-May-2024 16:04                3570
function.trader-cdlkicking.php                     24-May-2024 16:04                3524
function.trader-cdlkickingbylength.php             24-May-2024 16:04                3630
function.trader-cdlladderbottom.php                24-May-2024 16:04                3580
function.trader-cdllongleggeddoji.php              24-May-2024 16:04                3585
function.trader-cdllongline.php                    24-May-2024 16:04                3529
function.trader-cdlmarubozu.php                    24-May-2024 16:04                3515
function.trader-cdlmatchinglow.php                 24-May-2024 16:04                3541
function.trader-cdlmathold.php                     24-May-2024 16:04                3933
function.trader-cdlmorningdojistar.php             24-May-2024 16:04                4006
function.trader-cdlmorningstar.php                 24-May-2024 16:04                3967
function.trader-cdlonneck.php                      24-May-2024 16:04                3502
function.trader-cdlpiercing.php                    24-May-2024 16:04                3519
function.trader-cdlrickshawman.php                 24-May-2024 16:04                3559
function.trader-cdlrisefall3methods.php            24-May-2024 16:04                3629
function.trader-cdlseparatinglines.php             24-May-2024 16:04                3611
function.trader-cdlshootingstar.php                24-May-2024 16:04                3570
function.trader-cdlshortline.php                   24-May-2024 16:04                3542
function.trader-cdlspinningtop.php                 24-May-2024 16:04                3557
function.trader-cdlstalledpattern.php              24-May-2024 16:04                3592
function.trader-cdlsticksandwich.php               24-May-2024 16:04                3573
function.trader-cdltakuri.php                      24-May-2024 16:04                3544
function.trader-cdltasukigap.php                   24-May-2024 16:04                3519
function.trader-cdlthrusting.php                   24-May-2024 16:04                3528
function.trader-cdltristar.php                     24-May-2024 16:04                3516
function.trader-cdlunique3river.php                24-May-2024 16:04                3567
function.trader-cdlupsidegap2crows.php             24-May-2024 16:04                3615
function.trader-cdlxsidegap3methods.php            24-May-2024 16:04                3614
function.trader-ceil.php                           24-May-2024 16:04                2536
function.trader-cmo.php                            24-May-2024 16:04                2753
function.trader-correl.php                         24-May-2024 16:04                3092
function.trader-cos.php                            24-May-2024 16:04                2502
function.trader-cosh.php                           24-May-2024 16:04                2518
function.trader-dema.php                           24-May-2024 16:04                2764
function.trader-div.php                            24-May-2024 16:04                2851
function.trader-dx.php                             24-May-2024 16:04                3469
function.trader-ema.php                            24-May-2024 16:04                2747
function.trader-errno.php                          24-May-2024 16:04                2249
function.trader-exp.php                            24-May-2024 16:04                2546
function.trader-floor.php                          24-May-2024 16:04                2528
function.trader-get-compat.php                     24-May-2024 16:04                2439
function.trader-get-unstable-period.php            24-May-2024 16:04                2750
function.trader-ht-dcperiod.php                    24-May-2024 16:04                2516
function.trader-ht-dcphase.php                     24-May-2024 16:04                2487
function.trader-ht-phasor.php                      24-May-2024 16:04                2468
function.trader-ht-sine.php                        24-May-2024 16:04                2447
function.trader-ht-trendline.php                   24-May-2024 16:04                2508
function.trader-ht-trendmode.php                   24-May-2024 16:04                2498
function.trader-kama.php                           24-May-2024 16:04                2802
function.trader-linearreg-angle.php                24-May-2024 16:04                2896
function.trader-linearreg-intercept.php            24-May-2024 16:04                2954
function.trader-linearreg-slope.php                24-May-2024 16:04                2906
function.trader-linearreg.php                      24-May-2024 16:04                2818
function.trader-ln.php                             24-May-2024 16:04                2504
function.trader-log10.php                          24-May-2024 16:04                2508
function.trader-ma.php                             24-May-2024 16:04                3168
function.trader-macd.php                           24-May-2024 16:04                3689
function.trader-macdext.php                        24-May-2024 16:04                5182
function.trader-macdfix.php                        24-May-2024 16:04                2848
function.trader-mama.php                           24-May-2024 16:04                3189
function.trader-mavp.php                           24-May-2024 16:04                4096
function.trader-max.php                            24-May-2024 16:04                2768
function.trader-maxindex.php                       24-May-2024 16:04                2825
function.trader-medprice.php                       24-May-2024 16:04                2734
function.trader-mfi.php                            24-May-2024 16:04                3829
function.trader-midpoint.php                       24-May-2024 16:04                2799
function.trader-midprice.php                       24-May-2024 16:04                3118
function.trader-min.php                            24-May-2024 16:04                2775
function.trader-minindex.php                       24-May-2024 16:04                2820
function.trader-minmax.php                         24-May-2024 16:04                2824
function.trader-minmaxindex.php                    24-May-2024 16:04                2875
function.trader-minus-di.php                       24-May-2024 16:04                3556
function.trader-minus-dm.php                       24-May-2024 16:04                3118
function.trader-mom.php                            24-May-2024 16:04                2739
function.trader-mult.php                           24-May-2024 16:04                2851
function.trader-natr.php                           24-May-2024 16:04                3494
function.trader-obv.php                            24-May-2024 16:04                2689
function.trader-plus-di.php                        24-May-2024 16:04                3527
function.trader-plus-dm.php                        24-May-2024 16:04                3105
function.trader-ppo.php                            24-May-2024 16:04                3708
function.trader-roc.php                            24-May-2024 16:04                2763
function.trader-rocp.php                           24-May-2024 16:04                2791
function.trader-rocr.php                           24-May-2024 16:04                2776
function.trader-rocr100.php                        24-May-2024 16:04                2816
function.trader-rsi.php                            24-May-2024 16:04                2744
function.trader-sar.php                            24-May-2024 16:04                3749
function.trader-sarext.php                         24-May-2024 16:04                7161
function.trader-set-compat.php                     24-May-2024 16:04                2657
function.trader-set-unstable-period.php            24-May-2024 16:04                3245
function.trader-sin.php                            24-May-2024 16:04                2526
function.trader-sinh.php                           24-May-2024 16:04                2514
function.trader-sma.php                            24-May-2024 16:04                2744
function.trader-sqrt.php                           24-May-2024 16:04                2507
function.trader-stddev.php                         24-May-2024 16:04                3088
function.trader-stoch.php                          24-May-2024 16:04                5361
function.trader-stochf.php                         24-May-2024 16:04                4468
function.trader-stochrsi.php                       24-May-2024 16:04                4221
function.trader-sub.php                            24-May-2024 16:04                2856
function.trader-sum.php                            24-May-2024 16:04                2726
function.trader-t3.php                             24-May-2024 16:04                3105
function.trader-tan.php                            24-May-2024 16:04                2495
function.trader-tanh.php                           24-May-2024 16:04                2519
function.trader-tema.php                           24-May-2024 16:04                2770
function.trader-trange.php                         24-May-2024 16:04                3016
function.trader-trima.php                          24-May-2024 16:04                2772
function.trader-trix.php                           24-May-2024 16:04                2782
function.trader-tsf.php                            24-May-2024 16:04                2751
function.trader-typprice.php                       24-May-2024 16:04                3039
function.trader-ultosc.php                         24-May-2024 16:04                4351
function.trader-var.php                            24-May-2024 16:04                3058
function.trader-wclprice.php                       24-May-2024 16:04                3044
function.trader-willr.php                          24-May-2024 16:04                3500
function.trader-wma.php                            24-May-2024 16:04                2768
function.trait-exists.php                          24-May-2024 16:05                3219
function.trigger-error.php                         24-May-2024 16:04                8195
function.trim.php                                  24-May-2024 16:05               14010
function.uasort.php                                24-May-2024 16:05               10833
function.ucfirst.php                               24-May-2024 16:05                6116
function.ucwords.php                               24-May-2024 16:05                9986
function.ui-draw-text-font-fontfamilies.php        24-May-2024 16:05                2449
function.ui-quit.php                               24-May-2024 16:05                2089
function.ui-run.php                                24-May-2024 16:05                2450
function.uksort.php                                24-May-2024 16:05               10197
function.umask.php                                 24-May-2024 16:04                6020
function.uniqid.php                                24-May-2024 16:05                8883
function.unixtojd.php                              24-May-2024 16:04                4148
function.unlink.php                                24-May-2024 16:04                6462
function.unpack.php                                24-May-2024 16:05               11169
function.unregister-tick-function.php              24-May-2024 16:05                3268
function.unserialize.php                           24-May-2024 16:05               19171
function.unset.php                                 24-May-2024 16:05               15806
function.untaint.php                               24-May-2024 16:05                2603
function.uopz-add-function.php                     24-May-2024 16:04                7186
function.uopz-allow-exit.php                       24-May-2024 16:04                4646
function.uopz-backup.php                           24-May-2024 16:04                4619
function.uopz-compose.php                          24-May-2024 16:04                6891
function.uopz-copy.php                             24-May-2024 16:04                5206
function.uopz-del-function.php                     24-May-2024 16:04                6626
function.uopz-delete.php                           24-May-2024 16:04                6048
function.uopz-extend.php                           24-May-2024 16:04                5204
function.uopz-flags.php                            24-May-2024 16:04               11391
function.uopz-function.php                         24-May-2024 16:04                7366
function.uopz-get-exit-status.php                  24-May-2024 16:04                4219
function.uopz-get-hook.php                         24-May-2024 16:04                5368
function.uopz-get-mock.php                         24-May-2024 16:04                5051
function.uopz-get-property.php                     24-May-2024 16:04                6231
function.uopz-get-return.php                       24-May-2024 16:04                4472
function.uopz-get-static.php                       24-May-2024 16:04                5179
function.uopz-implement.php                        24-May-2024 16:04                5230
function.uopz-overload.php                         24-May-2024 16:04                3972
function.uopz-redefine.php                         24-May-2024 16:04                5237
function.uopz-rename.php                           24-May-2024 16:04                6821
function.uopz-restore.php                          24-May-2024 16:04                4993
function.uopz-set-hook.php                         24-May-2024 16:04                5708
function.uopz-set-mock.php                         24-May-2024 16:04               11200
function.uopz-set-property.php                     24-May-2024 16:04                7525
function.uopz-set-return.php                       24-May-2024 16:04                9682
function.uopz-set-static.php                       24-May-2024 16:04                5778
function.uopz-undefine.php                         24-May-2024 16:04                4752
function.uopz-unset-hook.php                       24-May-2024 16:04                5599
function.uopz-unset-mock.php                       24-May-2024 16:04                5489
function.uopz-unset-return.php                     24-May-2024 16:04                4948
function.urldecode.php                             24-May-2024 16:05                6551
function.urlencode.php                             24-May-2024 16:05               10127
function.use-soap-error-handler.php                24-May-2024 16:05                4231
function.user-error.php                            24-May-2024 16:04                1766
function.usleep.php                                24-May-2024 16:05                7215
function.usort.php                                 24-May-2024 16:05               27719
function.utf8-decode.php                           24-May-2024 16:05               19549
function.utf8-encode.php                           24-May-2024 16:05               16221
function.var-dump.php                              24-May-2024 16:05                7094
function.var-export.php                            24-May-2024 16:05               17290
function.var-representation.php                    24-May-2024 16:05               13361
function.variant-abs.php                           24-May-2024 16:05                4415
function.variant-add.php                           24-May-2024 16:05                5784
function.variant-and.php                           24-May-2024 16:05                7889
function.variant-cast.php                          24-May-2024 16:05                3645
function.variant-cat.php                           24-May-2024 16:05                4996
function.variant-cmp.php                           24-May-2024 16:05                8521
function.variant-date-from-timestamp.php           24-May-2024 16:05                3797
function.variant-date-to-timestamp.php             24-May-2024 16:05                3973
function.variant-div.php                           24-May-2024 16:05                6735
function.variant-eqv.php                           24-May-2024 16:05                4785
function.variant-fix.php                           24-May-2024 16:05                5765
function.variant-get-type.php                      24-May-2024 16:05                3723
function.variant-idiv.php                          24-May-2024 16:05                6036
function.variant-imp.php                           24-May-2024 16:05                7411
function.variant-int.php                           24-May-2024 16:05                5214
function.variant-mod.php                           24-May-2024 16:05                5029
function.variant-mul.php                           24-May-2024 16:05                6172
function.variant-neg.php                           24-May-2024 16:05                4119
function.variant-not.php                           24-May-2024 16:05                4411
function.variant-or.php                            24-May-2024 16:05                8023
function.variant-pow.php                           24-May-2024 16:05                4854
function.variant-round.php                         24-May-2024 16:05                4790
function.variant-set-type.php                      24-May-2024 16:05                3730
function.variant-set.php                           24-May-2024 16:05                2981
function.variant-sub.php                           24-May-2024 16:05                5709
function.variant-xor.php                           24-May-2024 16:05                6760
function.version-compare.php                       24-May-2024 16:04               12249
function.vfprintf.php                              24-May-2024 16:05               22354
function.virtual.php                               24-May-2024 16:05                5836
function.vprintf.php                               24-May-2024 16:05               21768
function.vsprintf.php                              24-May-2024 16:05               21602
function.wddx-add-vars.php                         24-May-2024 16:05                3925
function.wddx-deserialize.php                      24-May-2024 16:05                3970
function.wddx-packet-end.php                       24-May-2024 16:05                2961
function.wddx-packet-start.php                     24-May-2024 16:05                3205
function.wddx-serialize-value.php                  24-May-2024 16:05                3399
function.wddx-serialize-vars.php                   24-May-2024 16:05                6130
function.win32-continue-service.php                24-May-2024 16:05                7308
function.win32-create-service.php                  24-May-2024 16:05               30572
function.win32-delete-service.php                  24-May-2024 16:05                7800
function.win32-get-last-control-message.php        24-May-2024 16:05                9123
function.win32-pause-service.php                   24-May-2024 16:05                7274
function.win32-query-service-status.php            24-May-2024 16:05                9586
function.win32-send-custom-control.php             24-May-2024 16:05                7514
function.win32-set-service-exit-code.php           24-May-2024 16:05                5935
function.win32-set-service-exit-mode.php           24-May-2024 16:05                6083
function.win32-set-service-status.php              24-May-2024 16:05               10138
function.win32-start-service-ctrl-dispatcher.php   24-May-2024 16:05               12453
function.win32-start-service.php                   24-May-2024 16:05                7276
function.win32-stop-service.php                    24-May-2024 16:05                7189
function.wincache-fcache-fileinfo.php              24-May-2024 16:04                9997
function.wincache-fcache-meminfo.php               24-May-2024 16:04                7750
function.wincache-lock.php                         24-May-2024 16:04                9293
function.wincache-ocache-fileinfo.php              24-May-2024 16:04               10680
function.wincache-ocache-meminfo.php               24-May-2024 16:04                7903
function.wincache-refresh-if-changed.php           24-May-2024 16:04                8471
function.wincache-rplist-fileinfo.php              24-May-2024 16:04                8197
function.wincache-rplist-meminfo.php               24-May-2024 16:04                7844
function.wincache-scache-info.php                  24-May-2024 16:04               10245
function.wincache-scache-meminfo.php               24-May-2024 16:04                7287
function.wincache-ucache-add.php                   24-May-2024 16:04               14523
function.wincache-ucache-cas.php                   24-May-2024 16:04                6635
function.wincache-ucache-clear.php                 24-May-2024 16:04                7951
function.wincache-ucache-dec.php                   24-May-2024 16:04                6583
function.wincache-ucache-delete.php                24-May-2024 16:04               11804
function.wincache-ucache-exists.php                24-May-2024 16:04                6488
function.wincache-ucache-get.php                   24-May-2024 16:04               11143
function.wincache-ucache-inc.php                   24-May-2024 16:04                6575
function.wincache-ucache-info.php                  24-May-2024 16:04               12225
function.wincache-ucache-meminfo.php               24-May-2024 16:04                7538
function.wincache-ucache-set.php                   24-May-2024 16:04               14463
function.wincache-unlock.php                       24-May-2024 16:04                8390
function.wordwrap.php                              24-May-2024 16:05                9404
function.xattr-get.php                             24-May-2024 16:04                6360
function.xattr-list.php                            24-May-2024 16:04                6772
function.xattr-remove.php                          24-May-2024 16:04                6576
function.xattr-set.php                             24-May-2024 16:04                8408
function.xattr-supported.php                       24-May-2024 16:04                5683
function.xdiff-file-bdiff-size.php                 24-May-2024 16:04                5053
function.xdiff-file-bdiff.php                      24-May-2024 16:04                6421
function.xdiff-file-bpatch.php                     24-May-2024 16:04                6945
function.xdiff-file-diff-binary.php                24-May-2024 16:04                6880
function.xdiff-file-diff.php                       24-May-2024 16:04                7720
function.xdiff-file-merge3.php                     24-May-2024 16:04                7038
function.xdiff-file-patch-binary.php               24-May-2024 16:04                7055
function.xdiff-file-patch.php                      24-May-2024 16:04                9395
function.xdiff-file-rabdiff.php                    24-May-2024 16:04                7030
function.xdiff-string-bdiff-size.php               24-May-2024 16:04                5344
function.xdiff-string-bdiff.php                    24-May-2024 16:04                4144
function.xdiff-string-bpatch.php                   24-May-2024 16:04                4210
function.xdiff-string-diff-binary.php              24-May-2024 16:04                4674
function.xdiff-string-diff.php                     24-May-2024 16:04                7984
function.xdiff-string-merge3.php                   24-May-2024 16:04                5035
function.xdiff-string-patch-binary.php             24-May-2024 16:04                4786
function.xdiff-string-patch.php                    24-May-2024 16:04                8757
function.xdiff-string-rabdiff.php                  24-May-2024 16:04                4805
function.xhprof-disable.php                        24-May-2024 16:04                4021
function.xhprof-enable.php                         24-May-2024 16:04                7337
function.xhprof-sample-disable.php                 24-May-2024 16:04                4703
function.xhprof-sample-enable.php                  24-May-2024 16:04                3687
function.xml-error-string.php                      24-May-2024 16:05                3449
function.xml-get-current-byte-index.php            24-May-2024 16:05                4784
function.xml-get-current-column-number.php         24-May-2024 16:05                4478
function.xml-get-current-line-number.php           24-May-2024 16:05                4296
function.xml-get-error-code.php                    24-May-2024 16:05                3953
function.xml-parse-into-struct.php                 24-May-2024 16:05               19982
function.xml-parse.php                             24-May-2024 16:05                8958
function.xml-parser-create-ns.php                  24-May-2024 16:05                5743
function.xml-parser-create.php                     24-May-2024 16:05                5292
function.xml-parser-free.php                       24-May-2024 16:05                4455
function.xml-parser-get-option.php                 24-May-2024 16:05                6338
function.xml-parser-set-option.php                 24-May-2024 16:05                8592
function.xml-set-character-data-handler.php        24-May-2024 16:05                6011
function.xml-set-default-handler.php               24-May-2024 16:05                5903
function.xml-set-element-handler.php               24-May-2024 16:05                9353
function.xml-set-end-namespace-decl-handler.php    24-May-2024 16:05                6871
function.xml-set-external-entity-ref-handler.php   24-May-2024 16:05                9906
function.xml-set-notation-decl-handler.php         24-May-2024 16:05                7992
function.xml-set-object.php                        24-May-2024 16:05                9479
function.xml-set-processing-instruction-handler..> 24-May-2024 16:05                7013
function.xml-set-start-namespace-decl-handler.php  24-May-2024 16:05                7139
function.xml-set-unparsed-entity-decl-handler.php  24-May-2024 16:05                8955
function.xmlrpc-decode-request.php                 24-May-2024 16:05                2970
function.xmlrpc-decode.php                         24-May-2024 16:05                4306
function.xmlrpc-encode-request.php                 24-May-2024 16:05                8799
function.xmlrpc-encode.php                         24-May-2024 16:05                2546
function.xmlrpc-get-type.php                       24-May-2024 16:05                6439
function.xmlrpc-is-fault.php                       24-May-2024 16:05                4090
function.xmlrpc-parse-method-descriptions.php      24-May-2024 16:05                2745
function.xmlrpc-server-add-introspection-data.php  24-May-2024 16:05                2943
function.xmlrpc-server-call-method.php             24-May-2024 16:05                3367
function.xmlrpc-server-create.php                  24-May-2024 16:05                2460
function.xmlrpc-server-destroy.php                 24-May-2024 16:05                2672
function.xmlrpc-server-register-introspection-c..> 24-May-2024 16:05                3022
function.xmlrpc-server-register-method.php         24-May-2024 16:05                3109
function.xmlrpc-set-type.php                       24-May-2024 16:05                5755
function.yaml-emit-file.php                        24-May-2024 16:05                6753
function.yaml-emit.php                             24-May-2024 16:05               12252
function.yaml-parse-file.php                       24-May-2024 16:05                6388
function.yaml-parse-url.php                        24-May-2024 16:05                6649
function.yaml-parse.php                            24-May-2024 16:05               10091
function.yaz-addinfo.php                           24-May-2024 16:05                3528
function.yaz-ccl-conf.php                          24-May-2024 16:05                5885
function.yaz-ccl-parse.php                         24-May-2024 16:05                6961
function.yaz-close.php                             24-May-2024 16:05                3644
function.yaz-connect.php                           24-May-2024 16:05               10023
function.yaz-database.php                          24-May-2024 16:05                3544
function.yaz-element.php                           24-May-2024 16:05                4097
function.yaz-errno.php                             24-May-2024 16:05                3826
function.yaz-error.php                             24-May-2024 16:05                3463
function.yaz-es-result.php                         24-May-2024 16:05                3420
function.yaz-es.php                                24-May-2024 16:05                7513
function.yaz-get-option.php                        24-May-2024 16:05                3539
function.yaz-hits.php                              24-May-2024 16:05                5282
function.yaz-itemorder.php                         24-May-2024 16:05                7291
function.yaz-present.php                           24-May-2024 16:05                3140
function.yaz-range.php                             24-May-2024 16:05                3716
function.yaz-record.php                            24-May-2024 16:05               15612
function.yaz-scan-result.php                       24-May-2024 16:05                4151
function.yaz-scan.php                              24-May-2024 16:05                9643
function.yaz-schema.php                            24-May-2024 16:05                3594
function.yaz-search.php                            24-May-2024 16:05                9399
function.yaz-set-option.php                        24-May-2024 16:05                7536
function.yaz-sort.php                              24-May-2024 16:05                5809
function.yaz-syntax.php                            24-May-2024 16:05                3511
function.yaz-wait.php                              24-May-2024 16:05                4446
function.zend-thread-id.php                        24-May-2024 16:04                3873
function.zend-version.php                          24-May-2024 16:04                4015
function.zip-close.php                             24-May-2024 16:04                4134
function.zip-entry-close.php                       24-May-2024 16:04                4409
function.zip-entry-compressedsize.php              24-May-2024 16:04                4707
function.zip-entry-compressionmethod.php           24-May-2024 16:04                4789
function.zip-entry-filesize.php                    24-May-2024 16:04                4663
function.zip-entry-name.php                        24-May-2024 16:04                4573
function.zip-entry-open.php                        24-May-2024 16:04                6172
function.zip-entry-read.php                        24-May-2024 16:04                5401
function.zip-open.php                              24-May-2024 16:04                4777
function.zip-read.php                              24-May-2024 16:04                5016
function.zlib-decode.php                           24-May-2024 16:04                3600
function.zlib-encode.php                           24-May-2024 16:04                5511
function.zlib-get-coding-type.php                  24-May-2024 16:04                2987
function.zookeeper-dispatch.php                    24-May-2024 16:05                8331
functional.parallel.php                            24-May-2024 16:04                2600
functions.anonymous.php                            24-May-2024 16:04               24685
functions.arguments.php                            24-May-2024 16:04               43855
functions.arrow.php                                24-May-2024 16:04               10381
functions.first_class_callable_syntax.php          24-May-2024 16:04               11705
functions.internal.php                             24-May-2024 16:04                8627
functions.returning-values.php                     24-May-2024 16:04                6386
functions.user-defined.php                         24-May-2024 16:04               10024
functions.variable-functions.php                   24-May-2024 16:04               11596
gearman.configuration.php                          24-May-2024 16:05                1250
gearman.constants.php                              24-May-2024 16:05               23918
gearman.examples-reverse-bg.php                    24-May-2024 16:05               10726
gearman.examples-reverse-task.php                  24-May-2024 16:05               17375
gearman.examples-reverse.php                       24-May-2024 16:05               12796
gearman.examples.php                               24-May-2024 16:05                1606
gearman.installation.php                           24-May-2024 16:05                1713
gearman.requirements.php                           24-May-2024 16:05                1537
gearman.resources.php                              24-May-2024 16:05                1255
gearman.setup.php                                  24-May-2024 16:05                1627
gearmanclient.addoptions.php                       24-May-2024 16:05                3365
gearmanclient.addserver.php                        24-May-2024 16:05                5526
gearmanclient.addservers.php                       24-May-2024 16:05                4942
gearmanclient.addtask.php                          24-May-2024 16:05               15215
gearmanclient.addtaskbackground.php                24-May-2024 16:05               20947
gearmanclient.addtaskhigh.php                      24-May-2024 16:05               11711
gearmanclient.addtaskhighbackground.php            24-May-2024 16:05                6618
gearmanclient.addtasklow.php                       24-May-2024 16:05               11693
gearmanclient.addtasklowbackground.php             24-May-2024 16:05                6611
gearmanclient.addtaskstatus.php                    24-May-2024 16:05                9842
gearmanclient.clearcallbacks.php                   24-May-2024 16:05                4391
gearmanclient.clone.php                            24-May-2024 16:05                2694
gearmanclient.construct.php                        24-May-2024 16:05                2865
gearmanclient.context.php                          24-May-2024 16:05                2933
gearmanclient.data.php                             24-May-2024 16:05                3200
gearmanclient.do.php                               24-May-2024 16:05               22213
gearmanclient.dobackground.php                     24-May-2024 16:05                9691
gearmanclient.dohigh.php                           24-May-2024 16:05                5141
gearmanclient.dohighbackground.php                 24-May-2024 16:05                4968
gearmanclient.dojobhandle.php                      24-May-2024 16:05                2990
gearmanclient.dolow.php                            24-May-2024 16:05                5127
gearmanclient.dolowbackground.php                  24-May-2024 16:05                4950
gearmanclient.donormal.php                         24-May-2024 16:05               22781
gearmanclient.dostatus.php                         24-May-2024 16:05                8175
gearmanclient.echo.php                             24-May-2024 16:05                3034
gearmanclient.error.php                            24-May-2024 16:05                2925
gearmanclient.geterrno.php                         24-May-2024 16:05                2700
gearmanclient.jobstatus.php                        24-May-2024 16:05                8364
gearmanclient.ping.php                             24-May-2024 16:05                3007
gearmanclient.removeoptions.php                    24-May-2024 16:05                2713
gearmanclient.returncode.php                       24-May-2024 16:05                2350
gearmanclient.runtasks.php                         24-May-2024 16:05                3773
gearmanclient.setclientcallback.php                24-May-2024 16:05                5405
gearmanclient.setcompletecallback.php              24-May-2024 16:05                5289
gearmanclient.setcontext.php                       24-May-2024 16:05                3251
gearmanclient.setcreatedcallback.php               24-May-2024 16:05                4828
gearmanclient.setdata.php                          24-May-2024 16:05                3451
gearmanclient.setdatacallback.php                  24-May-2024 16:05                4813
gearmanclient.setexceptioncallback.php             24-May-2024 16:05                4733
gearmanclient.setfailcallback.php                  24-May-2024 16:05                4819
gearmanclient.setoptions.php                       24-May-2024 16:05                2699
gearmanclient.setstatuscallback.php                24-May-2024 16:05                4819
gearmanclient.settimeout.php                       24-May-2024 16:05                2743
gearmanclient.setwarningcallback.php               24-May-2024 16:05                4822
gearmanclient.setworkloadcallback.php              24-May-2024 16:05                4976
gearmanclient.timeout.php                          24-May-2024 16:05                2795
gearmanclient.wait.php                             24-May-2024 16:05                2842
gearmanjob.complete.php                            24-May-2024 16:05                3628
gearmanjob.construct.php                           24-May-2024 16:05                2384
gearmanjob.data.php                                24-May-2024 16:05                3588
gearmanjob.exception.php                           24-May-2024 16:05                3795
gearmanjob.fail.php                                24-May-2024 16:05                3736
gearmanjob.functionname.php                        24-May-2024 16:05                2971
gearmanjob.handle.php                              24-May-2024 16:05                2858
gearmanjob.returncode.php                          24-May-2024 16:05                2655
gearmanjob.sendcomplete.php                        24-May-2024 16:05                3347
gearmanjob.senddata.php                            24-May-2024 16:05                3314
gearmanjob.sendexception.php                       24-May-2024 16:05                3527
gearmanjob.sendfail.php                            24-May-2024 16:05                3453
gearmanjob.sendstatus.php                          24-May-2024 16:05                4042
gearmanjob.sendwarning.php                         24-May-2024 16:05                3523
gearmanjob.setreturn.php                           24-May-2024 16:05                2585
gearmanjob.status.php                              24-May-2024 16:05                4325
gearmanjob.unique.php                              24-May-2024 16:05                3095
gearmanjob.warning.php                             24-May-2024 16:05                3806
gearmanjob.workload.php                            24-May-2024 16:05                2853
gearmanjob.workloadsize.php                        24-May-2024 16:05                2671
gearmantask.construct.php                          24-May-2024 16:05                2409
gearmantask.create.php                             24-May-2024 16:05                2858
gearmantask.data.php                               24-May-2024 16:05                2832
gearmantask.datasize.php                           24-May-2024 16:05                2855
gearmantask.function.php                           24-May-2024 16:05                2696
gearmantask.functionname.php                       24-May-2024 16:05                2631
gearmantask.isknown.php                            24-May-2024 16:05                2507
gearmantask.isrunning.php                          24-May-2024 16:05                2507
gearmantask.jobhandle.php                          24-May-2024 16:05                3004
gearmantask.recvdata.php                           24-May-2024 16:05                3609
gearmantask.returncode.php                         24-May-2024 16:05                2682
gearmantask.senddata.php                           24-May-2024 16:05                3422
gearmantask.sendworkload.php                       24-May-2024 16:05                3571
gearmantask.taskdenominator.php                    24-May-2024 16:05                3048
gearmantask.tasknumerator.php                      24-May-2024 16:05                3020
gearmantask.unique.php                             24-May-2024 16:05                3265
gearmantask.uuid.php                               24-May-2024 16:05                3440
gearmanworker.addfunction.php                      24-May-2024 16:05                7928
gearmanworker.addoptions.php                       24-May-2024 16:05                3419
gearmanworker.addserver.php                        24-May-2024 16:05                5253
gearmanworker.addservers.php                       24-May-2024 16:05                4664
gearmanworker.clone.php                            24-May-2024 16:05                2365
gearmanworker.construct.php                        24-May-2024 16:05                2838
gearmanworker.echo.php                             24-May-2024 16:05                3045
gearmanworker.error.php                            24-May-2024 16:05                2892
gearmanworker.geterrno.php                         24-May-2024 16:05                2667
gearmanworker.options.php                          24-May-2024 16:05                2674
gearmanworker.register.php                         24-May-2024 16:05                3802
gearmanworker.removeoptions.php                    24-May-2024 16:05                3441
gearmanworker.returncode.php                       24-May-2024 16:05                2862
gearmanworker.setid.php                            24-May-2024 16:05                4141
gearmanworker.setoptions.php                       24-May-2024 16:05                3574
gearmanworker.settimeout.php                       24-May-2024 16:05                7810
gearmanworker.timeout.php                          24-May-2024 16:05                2774
gearmanworker.unregister.php                       24-May-2024 16:05                3366
gearmanworker.unregisterall.php                    24-May-2024 16:05                3038
gearmanworker.wait.php                             24-May-2024 16:05                7921
gearmanworker.work.php                             24-May-2024 16:05                5623
gender-gender.connect.php                          24-May-2024 16:04                2680
gender-gender.construct.php                        24-May-2024 16:04                2570
gender-gender.country.php                          24-May-2024 16:04                3860
gender-gender.get.php                              24-May-2024 16:04                2939
gender-gender.isnick.php                           24-May-2024 16:04                3587
gender-gender.similarnames.php                     24-May-2024 16:04                3061
gender.example.admin.php                           24-May-2024 16:04                8243
gender.examples.php                                24-May-2024 16:04                1387
gender.installation.php                            24-May-2024 16:04                2166
gender.setup.php                                   24-May-2024 16:04                1439
generator.current.php                              24-May-2024 16:04                2166
generator.getreturn.php                            24-May-2024 16:04                3892
generator.key.php                                  24-May-2024 16:04                3977
generator.next.php                                 24-May-2024 16:04                2523
generator.rewind.php                               24-May-2024 16:04                2254
generator.send.php                                 24-May-2024 16:04                5600
generator.throw.php                                24-May-2024 16:04                5205
generator.valid.php                                24-May-2024 16:04                2427
generator.wakeup.php                               24-May-2024 16:04                2278
geoip.configuration.php                            24-May-2024 16:04                2567
geoip.constants.php                                24-May-2024 16:04                6397
geoip.installation.php                             24-May-2024 16:04                1877
geoip.requirements.php                             24-May-2024 16:04                1988
geoip.resources.php                                24-May-2024 16:04                1211
geoip.setup.php                                    24-May-2024 16:04                1588
gettext.configuration.php                          24-May-2024 16:04                1250
gettext.constants.php                              24-May-2024 16:04                1192
gettext.installation.php                           24-May-2024 16:04                1528
gettext.requirements.php                           24-May-2024 16:04                1481
gettext.resources.php                              24-May-2024 16:04                1225
gettext.setup.php                                  24-May-2024 16:04                1632
getting-started.php                                24-May-2024 16:04                2010
globiterator.construct.php                         24-May-2024 16:05                7971
globiterator.count.php                             24-May-2024 16:05                4592
gmagick.addimage.php                               24-May-2024 16:04                3038
gmagick.addnoiseimage.php                          24-May-2024 16:04                3049
gmagick.annotateimage.php                          24-May-2024 16:04                4632
gmagick.blurimage.php                              24-May-2024 16:04                3450
gmagick.borderimage.php                            24-May-2024 16:04                3875
gmagick.charcoalimage.php                          24-May-2024 16:04                3359
gmagick.chopimage.php                              24-May-2024 16:04                4005
gmagick.clear.php                                  24-May-2024 16:04                2788
gmagick.commentimage.php                           24-May-2024 16:04                2963
gmagick.compositeimage.php                         24-May-2024 16:04                4182
gmagick.configuration.php                          24-May-2024 16:04                1253
gmagick.constants.php                              24-May-2024 16:04              103221
gmagick.construct.php                              24-May-2024 16:04                2720
gmagick.cropimage.php                              24-May-2024 16:04                4077
gmagick.cropthumbnailimage.php                     24-May-2024 16:04                3448
gmagick.current.php                                24-May-2024 16:04                2665
gmagick.cyclecolormapimage.php                     24-May-2024 16:04                3098
gmagick.deconstructimages.php                      24-May-2024 16:04                2816
gmagick.despeckleimage.php                         24-May-2024 16:04                3610
gmagick.destroy.php                                24-May-2024 16:04                2868
gmagick.drawimage.php                              24-May-2024 16:04                3117
gmagick.edgeimage.php                              24-May-2024 16:04                3030
gmagick.embossimage.php                            24-May-2024 16:04                3622
gmagick.enhanceimage.php                           24-May-2024 16:04                2754
gmagick.equalizeimage.php                          24-May-2024 16:04                2695
gmagick.examples.php                               24-May-2024 16:04                3574
gmagick.flipimage.php                              24-May-2024 16:04                3059
gmagick.flopimage.php                              24-May-2024 16:04                3053
gmagick.frameimage.php                             24-May-2024 16:04                4685
gmagick.gammaimage.php                             24-May-2024 16:04                3372
gmagick.getcopyright.php                           24-May-2024 16:04                2680
gmagick.getfilename.php                            24-May-2024 16:04                2680
gmagick.getimagebackgroundcolor.php                24-May-2024 16:04                2736
gmagick.getimageblueprimary.php                    24-May-2024 16:04                3004
gmagick.getimagebordercolor.php                    24-May-2024 16:04                2808
gmagick.getimagechanneldepth.php                   24-May-2024 16:04                2876
gmagick.getimagecolors.php                         24-May-2024 16:04                2673
gmagick.getimagecolorspace.php                     24-May-2024 16:04                2637
gmagick.getimagecompose.php                        24-May-2024 16:04                2679
gmagick.getimagedelay.php                          24-May-2024 16:04                2578
gmagick.getimagedepth.php                          24-May-2024 16:04                2579
gmagick.getimagedispose.php                        24-May-2024 16:04                2618
gmagick.getimageextrema.php                        24-May-2024 16:04                2776
gmagick.getimagefilename.php                       24-May-2024 16:04                2713
gmagick.getimageformat.php                         24-May-2024 16:04                2721
gmagick.getimagegamma.php                          24-May-2024 16:04                2612
gmagick.getimagegreenprimary.php                   24-May-2024 16:04                2823
gmagick.getimageheight.php                         24-May-2024 16:04                2621
gmagick.getimagehistogram.php                      24-May-2024 16:04                3065
gmagick.getimageindex.php                          24-May-2024 16:04                2828
gmagick.getimageinterlacescheme.php                24-May-2024 16:04                2783
gmagick.getimageiterations.php                     24-May-2024 16:04                2667
gmagick.getimagematte.php                          24-May-2024 16:04                3134
gmagick.getimagemattecolor.php                     24-May-2024 16:04                2777
gmagick.getimageprofile.php                        24-May-2024 16:04                2866
gmagick.getimageredprimary.php                     24-May-2024 16:04                2827
gmagick.getimagerenderingintent.php                24-May-2024 16:04                2760
gmagick.getimageresolution.php                     24-May-2024 16:04                2689
gmagick.getimagescene.php                          24-May-2024 16:04                2606
gmagick.getimagesignature.php                      24-May-2024 16:04                2749
gmagick.getimagetype.php                           24-May-2024 16:04                2567
gmagick.getimageunits.php                          24-May-2024 16:04                2343
gmagick.getimagewhitepoint.php                     24-May-2024 16:04                2823
gmagick.getimagewidth.php                          24-May-2024 16:04                2572
gmagick.getpackagename.php                         24-May-2024 16:04                2656
gmagick.getquantumdepth.php                        24-May-2024 16:04                2800
gmagick.getreleasedate.php                         24-May-2024 16:04                2672
gmagick.getsamplingfactors.php                     24-May-2024 16:04                2791
gmagick.getsize.php                                24-May-2024 16:04                2951
gmagick.getversion.php                             24-May-2024 16:04                2633
gmagick.hasnextimage.php                           24-May-2024 16:04                3080
gmagick.haspreviousimage.php                       24-May-2024 16:04                3132
gmagick.implodeimage.php                           24-May-2024 16:04                3103
gmagick.installation.php                           24-May-2024 16:04                2118
gmagick.labelimage.php                             24-May-2024 16:04                2858
gmagick.levelimage.php                             24-May-2024 16:04                4900
gmagick.magnifyimage.php                           24-May-2024 16:04                2682
gmagick.mapimage.php                               24-May-2024 16:04                3353
gmagick.medianfilterimage.php                      24-May-2024 16:04                3192
gmagick.minifyimage.php                            24-May-2024 16:04                2699
gmagick.modulateimage.php                          24-May-2024 16:04                3952
gmagick.motionblurimage.php                        24-May-2024 16:04                4214
gmagick.newimage.php                               24-May-2024 16:04                4035
gmagick.nextimage.php                              24-May-2024 16:04                2861
gmagick.normalizeimage.php                         24-May-2024 16:04                3120
gmagick.oilpaintimage.php                          24-May-2024 16:04                3116
gmagick.previousimage.php                          24-May-2024 16:04                2860
gmagick.profileimage.php                           24-May-2024 16:04                3840
gmagick.quantizeimage.php                          24-May-2024 16:04                5596
gmagick.quantizeimages.php                         24-May-2024 16:04                5631
gmagick.queryfontmetrics.php                       24-May-2024 16:04                3059
gmagick.queryfonts.php                             24-May-2024 16:04                2809
gmagick.queryformats.php                           24-May-2024 16:04                3165
gmagick.radialblurimage.php                        24-May-2024 16:04                3355
gmagick.raiseimage.php                             24-May-2024 16:04                4600
gmagick.read.php                                   24-May-2024 16:04                2856
gmagick.readimage.php                              24-May-2024 16:04                2906
gmagick.readimageblob.php                          24-May-2024 16:04                3338
gmagick.readimagefile.php                          24-May-2024 16:04                3257
gmagick.reducenoiseimage.php                       24-May-2024 16:04                3345
gmagick.removeimage.php                            24-May-2024 16:04                2682
gmagick.removeimageprofile.php                     24-May-2024 16:04                3055
gmagick.requirements.php                           24-May-2024 16:04                1832
gmagick.resampleimage.php                          24-May-2024 16:04                4126
gmagick.resizeimage.php                            24-May-2024 16:04                4365
gmagick.rollimage.php                              24-May-2024 16:04                3126
gmagick.rotateimage.php                            24-May-2024 16:04                3251
gmagick.scaleimage.php                             24-May-2024 16:04                3643
gmagick.separateimagechannel.php                   24-May-2024 16:04                3343
gmagick.setcompressionquality.php                  24-May-2024 16:04                4317
gmagick.setfilename.php                            24-May-2024 16:04                3026
gmagick.setimagebackgroundcolor.php                24-May-2024 16:04                3071
gmagick.setimageblueprimary.php                    24-May-2024 16:04                3368
gmagick.setimagebordercolor.php                    24-May-2024 16:04                3052
gmagick.setimagechanneldepth.php                   24-May-2024 16:04                3555
gmagick.setimagecolorspace.php                     24-May-2024 16:04                3184
gmagick.setimagecompose.php                        24-May-2024 16:04                2944
gmagick.setimagedelay.php                          24-May-2024 16:04                2971
gmagick.setimagedepth.php                          24-May-2024 16:04                2971
gmagick.setimagedispose.php                        24-May-2024 16:04                2989
gmagick.setimagefilename.php                       24-May-2024 16:04                3064
gmagick.setimageformat.php                         24-May-2024 16:04                3038
gmagick.setimagegamma.php                          24-May-2024 16:04                2958
gmagick.setimagegreenprimary.php                   24-May-2024 16:04                3346
gmagick.setimageindex.php                          24-May-2024 16:04                3127
gmagick.setimageinterlacescheme.php                24-May-2024 16:04                3274
gmagick.setimageiterations.php                     24-May-2024 16:04                3056
gmagick.setimageprofile.php                        24-May-2024 16:04                3665
gmagick.setimageredprimary.php                     24-May-2024 16:04                3294
gmagick.setimagerenderingintent.php                24-May-2024 16:04                3311
gmagick.setimageresolution.php                     24-May-2024 16:04                3298
gmagick.setimagescene.php                          24-May-2024 16:04                2953
gmagick.setimagetype.php                           24-May-2024 16:04                3086
gmagick.setimageunits.php                          24-May-2024 16:04                3268
gmagick.setimagewhitepoint.php                     24-May-2024 16:04                3321
gmagick.setsamplingfactors.php                     24-May-2024 16:04                3192
gmagick.setsize.php                                24-May-2024 16:04                3731
gmagick.setup.php                                  24-May-2024 16:04                1553
gmagick.shearimage.php                             24-May-2024 16:04                4073
gmagick.solarizeimage.php                          24-May-2024 16:04                3208
gmagick.spreadimage.php                            24-May-2024 16:04                3077
gmagick.stripimage.php                             24-May-2024 16:04                2699
gmagick.swirlimage.php                             24-May-2024 16:04                3130
gmagick.thumbnailimage.php                         24-May-2024 16:04                4041
gmagick.trimimage.php                              24-May-2024 16:04                3266
gmagick.write.php                                  24-May-2024 16:04                1792
gmagick.writeimage.php                             24-May-2024 16:04                3634
gmagickdraw.annotate.php                           24-May-2024 16:04                3327
gmagickdraw.arc.php                                24-May-2024 16:04                4354
gmagickdraw.bezier.php                             24-May-2024 16:04                2692
gmagickdraw.ellipse.php                            24-May-2024 16:04                4324
gmagickdraw.getfillcolor.php                       24-May-2024 16:04                2535
gmagickdraw.getfillopacity.php                     24-May-2024 16:04                2477
gmagickdraw.getfont.php                            24-May-2024 16:04                2520
gmagickdraw.getfontsize.php                        24-May-2024 16:04                2561
gmagickdraw.getfontstyle.php                       24-May-2024 16:04                2678
gmagickdraw.getfontweight.php                      24-May-2024 16:04                2510
gmagickdraw.getstrokecolor.php                     24-May-2024 16:04                2564
gmagickdraw.getstrokeopacity.php                   24-May-2024 16:04                2550
gmagickdraw.getstrokewidth.php                     24-May-2024 16:04                2554
gmagickdraw.gettextdecoration.php                  24-May-2024 16:04                2573
gmagickdraw.gettextencoding.php                    24-May-2024 16:04                2671
gmagickdraw.line.php                               24-May-2024 16:04                3719
gmagickdraw.point.php                              24-May-2024 16:04                2954
gmagickdraw.polygon.php                            24-May-2024 16:04                2783
gmagickdraw.polyline.php                           24-May-2024 16:04                2820
gmagickdraw.rectangle.php                          24-May-2024 16:04                3775
gmagickdraw.rotate.php                             24-May-2024 16:04                2731
gmagickdraw.roundrectangle.php                     24-May-2024 16:04                4565
gmagickdraw.scale.php                              24-May-2024 16:04                3011
gmagickdraw.setfillcolor.php                       24-May-2024 16:04                2969
gmagickdraw.setfillopacity.php                     24-May-2024 16:04                2910
gmagickdraw.setfont.php                            24-May-2024 16:04                2804
gmagickdraw.setfontsize.php                        24-May-2024 16:04                2854
gmagickdraw.setfontstyle.php                       24-May-2024 16:04                3001
gmagickdraw.setfontweight.php                      24-May-2024 16:04                2851
gmagickdraw.setstrokecolor.php                     24-May-2024 16:04                2994
gmagickdraw.setstrokeopacity.php                   24-May-2024 16:04                2891
gmagickdraw.setstrokewidth.php                     24-May-2024 16:04                2841
gmagickdraw.settextdecoration.php                  24-May-2024 16:04                2985
gmagickdraw.settextencoding.php                    24-May-2024 16:04                3297
gmagickpixel.construct.php                         24-May-2024 16:04                2656
gmagickpixel.getcolor.php                          24-May-2024 16:04                3993
gmagickpixel.getcolorcount.php                     24-May-2024 16:04                2579
gmagickpixel.getcolorvalue.php                     24-May-2024 16:04                2995
gmagickpixel.setcolor.php                          24-May-2024 16:04                3076
gmagickpixel.setcolorvalue.php                     24-May-2024 16:04                3418
gmp.configuration.php                              24-May-2024 16:04                1225
gmp.constants.php                                  24-May-2024 16:04                4568
gmp.construct.php                                  24-May-2024 16:04                4110
gmp.examples.php                                   24-May-2024 16:04                3090
gmp.installation.php                               24-May-2024 16:04                1457
gmp.requirements.php                               24-May-2024 16:04                1900
gmp.serialize.php                                  24-May-2024 16:04                2366
gmp.setup.php                                      24-May-2024 16:04                1516
gmp.unserialize.php                                24-May-2024 16:04                2653
gnupg.configuration.php                            24-May-2024 16:04                1234
gnupg.constants.php                                24-May-2024 16:04                9418
gnupg.examples-clearsign.php                       24-May-2024 16:04                6652
gnupg.examples.php                                 24-May-2024 16:04                1408
gnupg.installation.php                             24-May-2024 16:04                1694
gnupg.requirements.php                             24-May-2024 16:04                1329
gnupg.resources.php                                24-May-2024 16:04                1211
gnupg.setup.php                                    24-May-2024 16:04                1607
hash.configuration.php                             24-May-2024 16:04                1229
hash.constants.php                                 24-May-2024 16:04                1949
hash.installation.php                              24-May-2024 16:04                1837
hash.requirements.php                              24-May-2024 16:04                1247
hash.resources.php                                 24-May-2024 16:04                1401
hash.setup.php                                     24-May-2024 16:04                1586
hashcontext.construct.php                          24-May-2024 16:04                1994
hashcontext.serialize.php                          24-May-2024 16:04                2495
hashcontext.unserialize.php                        24-May-2024 16:04                2763
history.php                                        24-May-2024 16:05                2434
history.php.books.php                              24-May-2024 16:05                3137
history.php.php                                    24-May-2024 16:05               13352
history.php.publications.php                       24-May-2024 16:05                1958
history.php.related.php                            24-May-2024 16:05                7439
hrtime-performancecounter.getfrequency.php         24-May-2024 16:04                2783
hrtime-performancecounter.getticks.php             24-May-2024 16:04                2656
hrtime-performancecounter.gettickssince.php        24-May-2024 16:04                2945
hrtime-stopwatch.getelapsedticks.php               24-May-2024 16:04                2558
hrtime-stopwatch.getelapsedtime.php                24-May-2024 16:04                2940
hrtime-stopwatch.getlastelapsedticks.php           24-May-2024 16:04                2626
hrtime-stopwatch.getlastelapsedtime.php            24-May-2024 16:04                2964
hrtime-stopwatch.isrunning.php                     24-May-2024 16:04                2519
hrtime-stopwatch.start.php                         24-May-2024 16:04                2420
hrtime-stopwatch.stop.php                          24-May-2024 16:04                2299
hrtime.example.basic.php                           24-May-2024 16:04                5463
hrtime.examples.php                                24-May-2024 16:04                1391
hrtime.installation.php                            24-May-2024 16:04                2143
hrtime.setup.php                                   24-May-2024 16:04                1436
ibase.configuration.php                            24-May-2024 16:04                8265
ibase.constants.php                                24-May-2024 16:04               22477
ibase.installation.php                             24-May-2024 16:04                4053
ibase.requirements.php                             24-May-2024 16:04                1210
ibase.resources.php                                24-May-2024 16:04                1211
ibase.setup.php                                    24-May-2024 16:04                1627
ibm-db2.configuration.php                          24-May-2024 16:04               22827
ibm-db2.constants.php                              24-May-2024 16:04                9443
ibm-db2.installation.php                           24-May-2024 16:04                4212
ibm-db2.requirements.php                           24-May-2024 16:04                3682
ibm-db2.resources.php                              24-May-2024 16:04                1331
ibm-db2.setup.php                                  24-May-2024 16:04                1637
iconv.configuration.php                            24-May-2024 16:04                5123
iconv.constants.php                                24-May-2024 16:04                3760
iconv.installation.php                             24-May-2024 16:04                1709
iconv.requirements.php                             24-May-2024 16:04                1636
iconv.resources.php                                24-May-2024 16:04                1211
iconv.setup.php                                    24-May-2024 16:04                1614
igbinary.configuration.php                         24-May-2024 16:04                3631
igbinary.installation.php                          24-May-2024 16:04                2174
igbinary.requirements.php                          24-May-2024 16:04                1231
igbinary.setup.php                                 24-May-2024 16:04                1562
image.configuration.php                            24-May-2024 16:04                3538
image.constants.php                                24-May-2024 16:04               55818
image.examples-png.php                             24-May-2024 16:04                4910
image.examples-watermark.php                       24-May-2024 16:04                6097
image.examples.merged-watermark.php                24-May-2024 16:04                8815
image.examples.php                                 24-May-2024 16:04                1640
image.installation.php                             24-May-2024 16:04                6916
image.requirements.php                             24-May-2024 16:04                4836
image.resources.php                                24-May-2024 16:04                2139
image.setup.php                                    24-May-2024 16:04                1612
imagick.adaptiveblurimage.php                      24-May-2024 16:04                7276
imagick.adaptiveresizeimage.php                    24-May-2024 16:04                9710
imagick.adaptivesharpenimage.php                   24-May-2024 16:04                6713
imagick.adaptivethresholdimage.php                 24-May-2024 16:04                6256
imagick.addimage.php                               24-May-2024 16:04                3095
imagick.addnoiseimage.php                          24-May-2024 16:04                5718
imagick.affinetransformimage.php                   24-May-2024 16:04                6683
imagick.animateimages.php                          24-May-2024 16:04                3307
imagick.annotateimage.php                          24-May-2024 16:04                8955
imagick.appendimages.php                           24-May-2024 16:04                6914
imagick.autolevelimage.php                         24-May-2024 16:04                4489
imagick.averageimages.php                          24-May-2024 16:04                2857
imagick.blackthresholdimage.php                    24-May-2024 16:04                5435
imagick.blueshiftimage.php                         24-May-2024 16:04                4534
imagick.blurimage.php                              24-May-2024 16:04                6052
imagick.borderimage.php                            24-May-2024 16:04                6208
imagick.brightnesscontrastimage.php                24-May-2024 16:04                5694
imagick.charcoalimage.php                          24-May-2024 16:04                5051
imagick.chopimage.php                              24-May-2024 16:04                7132
imagick.clampimage.php                             24-May-2024 16:04                2770
imagick.clear.php                                  24-May-2024 16:04                2421
imagick.clipimage.php                              24-May-2024 16:04                2652
imagick.clipimagepath.php                          24-May-2024 16:04                3210
imagick.clippathimage.php                          24-May-2024 16:04                3736
imagick.clone.php                                  24-May-2024 16:04                4252
imagick.clutimage.php                              24-May-2024 16:04                6346
imagick.coalesceimages.php                         24-May-2024 16:04                3056
imagick.colorfloodfillimage.php                    24-May-2024 16:04                5601
imagick.colorizeimage.php                          24-May-2024 16:04                7103
imagick.colormatriximage.php                       24-May-2024 16:04                7657
imagick.combineimages.php                          24-May-2024 16:04                3532
imagick.commentimage.php                           24-May-2024 16:04                5153
imagick.compareimagechannels.php                   24-May-2024 16:04                4105
imagick.compareimagelayers.php                     24-May-2024 16:04                5653
imagick.compareimages.php                          24-May-2024 16:04                5726
imagick.compositeimage.php                         24-May-2024 16:04                8233
imagick.configuration.php                          24-May-2024 16:04                4711
imagick.constants.php                              24-May-2024 16:04              166264
imagick.construct.php                              24-May-2024 16:04                2776
imagick.contrastimage.php                          24-May-2024 16:04                5119
imagick.contraststretchimage.php                   24-May-2024 16:04                4144
imagick.convolveimage.php                          24-May-2024 16:04                6043
imagick.count.php                                  24-May-2024 16:04                2737
imagick.cropimage.php                              24-May-2024 16:04                6160
imagick.cropthumbnailimage.php                     24-May-2024 16:04                3658
imagick.current.php                                24-May-2024 16:04                2603
imagick.cyclecolormapimage.php                     24-May-2024 16:04                3100
imagick.decipherimage.php                          24-May-2024 16:04                3367
imagick.deconstructimages.php                      24-May-2024 16:04                2693
imagick.deleteimageartifact.php                    24-May-2024 16:04                3917
imagick.deleteimageproperty.php                    24-May-2024 16:04                2692
imagick.deskewimage.php                            24-May-2024 16:04               11105
imagick.despeckleimage.php                         24-May-2024 16:04                4353
imagick.destroy.php                                24-May-2024 16:04                2541
imagick.displayimage.php                           24-May-2024 16:04                2896
imagick.displayimages.php                          24-May-2024 16:04                2957
imagick.distortimage.php                           24-May-2024 16:04               12065
imagick.drawimage.php                              24-May-2024 16:04                2743
imagick.edgeimage.php                              24-May-2024 16:04                4749
imagick.embossimage.php                            24-May-2024 16:04                5507
imagick.encipherimage.php                          24-May-2024 16:04                3357
imagick.enhanceimage.php                           24-May-2024 16:04                4327
imagick.equalizeimage.php                          24-May-2024 16:04                4286
imagick.evaluateimage.php                          24-May-2024 16:04                6140
imagick.examples-1.php                             24-May-2024 16:04               31417
imagick.examples.php                               24-May-2024 16:04                1410
imagick.exportimagepixels.php                      24-May-2024 16:04                8308
imagick.extentimage.php                            24-May-2024 16:04                5629
imagick.filter.php                                 24-May-2024 16:04                7718
imagick.flattenimages.php                          24-May-2024 16:04                3019
imagick.flipimage.php                              24-May-2024 16:04                4642
imagick.floodfillpaintimage.php                    24-May-2024 16:04               11964
imagick.flopimage.php                              24-May-2024 16:04                4672
imagick.forwardfouriertransformimage.php           24-May-2024 16:04               12121
imagick.frameimage.php                             24-May-2024 16:04                8463
imagick.functionimage.php                          24-May-2024 16:04               13854
imagick.fximage.php                                24-May-2024 16:04                6150
imagick.gammaimage.php                             24-May-2024 16:04                5957
imagick.gaussianblurimage.php                      24-May-2024 16:04                6488
imagick.getcolorspace.php                          24-May-2024 16:04                2578
imagick.getcompression.php                         24-May-2024 16:04                2356
imagick.getcompressionquality.php                  24-May-2024 16:04                2424
imagick.getcopyright.php                           24-May-2024 16:04                2449
imagick.getfilename.php                            24-May-2024 16:04                2581
imagick.getfont.php                                24-May-2024 16:04                3295
imagick.getformat.php                              24-May-2024 16:04                2524
imagick.getgravity.php                             24-May-2024 16:04                2567
imagick.gethomeurl.php                             24-May-2024 16:04                2344
imagick.getimage.php                               24-May-2024 16:04                2603
imagick.getimagealphachannel.php                   24-May-2024 16:04                3819
imagick.getimageartifact.php                       24-May-2024 16:04                3821
imagick.getimageattribute.php                      24-May-2024 16:04                2877
imagick.getimagebackgroundcolor.php                24-May-2024 16:04                2670
imagick.getimageblob.php                           24-May-2024 16:04                2856
imagick.getimageblueprimary.php                    24-May-2024 16:04                2914
imagick.getimagebordercolor.php                    24-May-2024 16:04                2707
imagick.getimagechanneldepth.php                   24-May-2024 16:04                3316
imagick.getimagechanneldistortion.php              24-May-2024 16:04                4247
imagick.getimagechanneldistortions.php             24-May-2024 16:04                4686
imagick.getimagechannelextrema.php                 24-May-2024 16:04                3864
imagick.getimagechannelkurtosis.php                24-May-2024 16:04                3753
imagick.getimagechannelmean.php                    24-May-2024 16:04                3359
imagick.getimagechannelrange.php                   24-May-2024 16:04                3648
imagick.getimagechannelstatistics.php              24-May-2024 16:04                2704
imagick.getimageclipmask.php                       24-May-2024 16:04                3153
imagick.getimagecolormapcolor.php                  24-May-2024 16:04                3095
imagick.getimagecolors.php                         24-May-2024 16:04                2502
imagick.getimagecolorspace.php                     24-May-2024 16:04                2459
imagick.getimagecompose.php                        24-May-2024 16:04                2467
imagick.getimagecompression.php                    24-May-2024 16:04                2425
imagick.getimagecompressionquality.php             24-May-2024 16:04                2501
imagick.getimagedelay.php                          24-May-2024 16:04                2533
imagick.getimagedepth.php                          24-May-2024 16:04                2296
imagick.getimagedispose.php                        24-May-2024 16:04                2569
imagick.getimagedistortion.php                     24-May-2024 16:04                3363
imagick.getimageextrema.php                        24-May-2024 16:04                3022
imagick.getimagefilename.php                       24-May-2024 16:04                2641
imagick.getimageformat.php                         24-May-2024 16:04                2649
imagick.getimagegamma.php                          24-May-2024 16:04                2538
imagick.getimagegeometry.php                       24-May-2024 16:04                4205
imagick.getimagegravity.php                        24-May-2024 16:04                2878
imagick.getimagegreenprimary.php                   24-May-2024 16:04                2827
imagick.getimageheight.php                         24-May-2024 16:04                2549
imagick.getimagehistogram.php                      24-May-2024 16:04               17313
imagick.getimageindex.php                          24-May-2024 16:04                3189
imagick.getimageinterlacescheme.php                24-May-2024 16:04                2631
imagick.getimageinterpolatemethod.php              24-May-2024 16:04                2816
imagick.getimageiterations.php                     24-May-2024 16:04                2610
imagick.getimagelength.php                         24-May-2024 16:04                3478
imagick.getimagematte.php                          24-May-2024 16:04                3046
imagick.getimagemattecolor.php                     24-May-2024 16:04                2938
imagick.getimagemimetype.php                       24-May-2024 16:04                2319
imagick.getimageorientation.php                    24-May-2024 16:04                2737
imagick.getimagepage.php                           24-May-2024 16:04                2801
imagick.getimagepixelcolor.php                     24-May-2024 16:04                3220
imagick.getimageprofile.php                        24-May-2024 16:04                2924
imagick.getimageprofiles.php                       24-May-2024 16:04                3777
imagick.getimageproperties.php                     24-May-2024 16:04                6014
imagick.getimageproperty.php                       24-May-2024 16:04                5145
imagick.getimageredprimary.php                     24-May-2024 16:04                2871
imagick.getimageregion.php                         24-May-2024 16:04                3981
imagick.getimagerenderingintent.php                24-May-2024 16:04                2772
imagick.getimageresolution.php                     24-May-2024 16:04                2641
imagick.getimagesblob.php                          24-May-2024 16:04                2713
imagick.getimagescene.php                          24-May-2024 16:04                2524
imagick.getimagesignature.php                      24-May-2024 16:04                2682
imagick.getimagesize.php                           24-May-2024 16:04                2804
imagick.getimagetickspersecond.php                 24-May-2024 16:04                2664
imagick.getimagetotalinkdensity.php                24-May-2024 16:04                2573
imagick.getimagetype.php                           24-May-2024 16:04                4932
imagick.getimageunits.php                          24-May-2024 16:04                2571
imagick.getimagevirtualpixelmethod.php             24-May-2024 16:04                2744
imagick.getimagewhitepoint.php                     24-May-2024 16:04                2782
imagick.getimagewidth.php                          24-May-2024 16:04                2509
imagick.getinterlacescheme.php                     24-May-2024 16:04                2727
imagick.getiteratorindex.php                       24-May-2024 16:04                6321
imagick.getnumberimages.php                        24-May-2024 16:04                2649
imagick.getoption.php                              24-May-2024 16:04                2827
imagick.getpackagename.php                         24-May-2024 16:04                2592
imagick.getpage.php                                24-May-2024 16:04                2704
imagick.getpixeliterator.php                       24-May-2024 16:04                6057
imagick.getpixelregioniterator.php                 24-May-2024 16:04                6795
imagick.getpointsize.php                           24-May-2024 16:04                2966
imagick.getquantum.php                             24-May-2024 16:04                2347
imagick.getquantumdepth.php                        24-May-2024 16:04                2709
imagick.getquantumrange.php                        24-May-2024 16:04                2960
imagick.getregistry.php                            24-May-2024 16:04                2546
imagick.getreleasedate.php                         24-May-2024 16:04                2616
imagick.getresource.php                            24-May-2024 16:04                3055
imagick.getresourcelimit.php                       24-May-2024 16:04                3462
imagick.getsamplingfactors.php                     24-May-2024 16:04                2727
imagick.getsize.php                                24-May-2024 16:04                5885
imagick.getsizeoffset.php                          24-May-2024 16:04                2713
imagick.getversion.php                             24-May-2024 16:04                2603
imagick.haldclutimage.php                          24-May-2024 16:04                6273
imagick.hasnextimage.php                           24-May-2024 16:04                2811
imagick.haspreviousimage.php                       24-May-2024 16:04                2857
imagick.identifyformat.php                         24-May-2024 16:04                4499
imagick.identifyimage.php                          24-May-2024 16:04                4144
imagick.implodeimage.php                           24-May-2024 16:04                4775
imagick.importimagepixels.php                      24-May-2024 16:04               11855
imagick.installation.php                           24-May-2024 16:04                3302
imagick.inversefouriertransformimage.php           24-May-2024 16:04                3581
imagick.labelimage.php                             24-May-2024 16:04                2667
imagick.levelimage.php                             24-May-2024 16:04                7915
imagick.linearstretchimage.php                     24-May-2024 16:04                5727
imagick.liquidrescaleimage.php                     24-May-2024 16:04                4744
imagick.listregistry.php                           24-May-2024 16:04                2406
imagick.magnifyimage.php                           24-May-2024 16:04                4263
imagick.mapimage.php                               24-May-2024 16:04                3340
imagick.mattefloodfillimage.php                    24-May-2024 16:04                5921
imagick.medianfilterimage.php                      24-May-2024 16:04                5270
imagick.mergeimagelayers.php                       24-May-2024 16:04                6656
imagick.minifyimage.php                            24-May-2024 16:04                2425
imagick.modulateimage.php                          24-May-2024 16:04                5689
imagick.montageimage.php                           24-May-2024 16:04                4740
imagick.morphimages.php                            24-May-2024 16:04                2922
imagick.morphology.php                             24-May-2024 16:04               66439
imagick.mosaicimages.php                           24-May-2024 16:04                2865
imagick.motionblurimage.php                        24-May-2024 16:04                7117
imagick.negateimage.php                            24-May-2024 16:04                5694
imagick.newimage.php                               24-May-2024 16:04                6552
imagick.newpseudoimage.php                         24-May-2024 16:04                5925
imagick.nextimage.php                              24-May-2024 16:04                2403
imagick.normalizeimage.php                         24-May-2024 16:04                6518
imagick.oilpaintimage.php                          24-May-2024 16:04                4640
imagick.opaquepaintimage.php                       24-May-2024 16:04                5245
imagick.optimizeimagelayers.php                    24-May-2024 16:04                5527
imagick.orderedposterizeimage.php                  24-May-2024 16:04                7012
imagick.paintfloodfillimage.php                    24-May-2024 16:04                5896
imagick.paintopaqueimage.php                       24-May-2024 16:04                5712
imagick.painttransparentimage.php                  24-May-2024 16:04                4866
imagick.pingimage.php                              24-May-2024 16:04                2800
imagick.pingimageblob.php                          24-May-2024 16:04                6246
imagick.pingimagefile.php                          24-May-2024 16:04                6109
imagick.polaroidimage.php                          24-May-2024 16:04                4915
imagick.posterizeimage.php                         24-May-2024 16:04                5660
imagick.previewimages.php                          24-May-2024 16:04                3269
imagick.previousimage.php                          24-May-2024 16:04                2461
imagick.profileimage.php                           24-May-2024 16:04                3407
imagick.quantizeimage.php                          24-May-2024 16:04                6739
imagick.quantizeimages.php                         24-May-2024 16:04                4095
imagick.queryfontmetrics.php                       24-May-2024 16:04                5809
imagick.queryfonts.php                             24-May-2024 16:04                4777
imagick.queryformats.php                           24-May-2024 16:04                7202
imagick.radialblurimage.php                        24-May-2024 16:04                5650
imagick.raiseimage.php                             24-May-2024 16:04                6629
imagick.randomthresholdimage.php                   24-May-2024 16:04                6573
imagick.readimage.php                              24-May-2024 16:04                2637
imagick.readimageblob.php                          24-May-2024 16:04                5527
imagick.readimagefile.php                          24-May-2024 16:04                3362
imagick.readimages.php                             24-May-2024 16:04                2647
imagick.recolorimage.php                           24-May-2024 16:04                6480
imagick.reducenoiseimage.php                       24-May-2024 16:04                5342
imagick.remapimage.php                             24-May-2024 16:04                3601
imagick.removeimage.php                            24-May-2024 16:04                2612
imagick.removeimageprofile.php                     24-May-2024 16:04                2904
imagick.render.php                                 24-May-2024 16:04                2415
imagick.requirements.php                           24-May-2024 16:04                1693
imagick.resampleimage.php                          24-May-2024 16:04                5715
imagick.resetimagepage.php                         24-May-2024 16:04                2942
imagick.resizeimage.php                            24-May-2024 16:04               11751
imagick.resources.php                              24-May-2024 16:04                1225
imagick.rollimage.php                              24-May-2024 16:04                4870
imagick.rotateimage.php                            24-May-2024 16:04                5732
imagick.rotationalblurimage.php                    24-May-2024 16:04                5830
imagick.roundcorners.php                           24-May-2024 16:04                6932
imagick.sampleimage.php                            24-May-2024 16:04                3144
imagick.scaleimage.php                             24-May-2024 16:04                7327
imagick.segmentimage.php                           24-May-2024 16:04                6859
imagick.selectiveblurimage.php                     24-May-2024 16:04                6693
imagick.separateimagechannel.php                   24-May-2024 16:04                5514
imagick.sepiatoneimage.php                         24-May-2024 16:04                4992
imagick.setbackgroundcolor.php                     24-May-2024 16:04                3426
imagick.setcolorspace.php                          24-May-2024 16:04                3142
imagick.setcompression.php                         24-May-2024 16:04                2866
imagick.setcompressionquality.php                  24-May-2024 16:04                7110
imagick.setfilename.php                            24-May-2024 16:04                2710
imagick.setfirstiterator.php                       24-May-2024 16:04                2457
imagick.setfont.php                                24-May-2024 16:04                5987
imagick.setformat.php                              24-May-2024 16:04                2644
imagick.setgravity.php                             24-May-2024 16:04                2850
imagick.setimage.php                               24-May-2024 16:04                4862
imagick.setimagealphachannel.php                   24-May-2024 16:04                3850
imagick.setimageartifact.php                       24-May-2024 16:04                7555
imagick.setimageattribute.php                      24-May-2024 16:04                3244
imagick.setimagebackgroundcolor.php                24-May-2024 16:04                3656
imagick.setimagebias.php                           24-May-2024 16:04                6918
imagick.setimagebiasquantum.php                    24-May-2024 16:04                2952
imagick.setimageblueprimary.php                    24-May-2024 16:04                3212
imagick.setimagebordercolor.php                    24-May-2024 16:04                3640
imagick.setimagechanneldepth.php                   24-May-2024 16:04                3263
imagick.setimageclipmask.php                       24-May-2024 16:04                8910
imagick.setimagecolormapcolor.php                  24-May-2024 16:04                3306
imagick.setimagecolorspace.php                     24-May-2024 16:04                3373
imagick.setimagecompose.php                        24-May-2024 16:04                3047
imagick.setimagecompression.php                    24-May-2024 16:04                3027
imagick.setimagecompressionquality.php             24-May-2024 16:04                4939
imagick.setimagedelay.php                          24-May-2024 16:04                6234
imagick.setimagedepth.php                          24-May-2024 16:04                2850
imagick.setimagedispose.php                        24-May-2024 16:04                2886
imagick.setimageextent.php                         24-May-2024 16:04                3185
imagick.setimagefilename.php                       24-May-2024 16:04                2951
imagick.setimageformat.php                         24-May-2024 16:04                2881
imagick.setimagegamma.php                          24-May-2024 16:04                2860
imagick.setimagegravity.php                        24-May-2024 16:04                3049
imagick.setimagegreenprimary.php                   24-May-2024 16:04                3203
imagick.setimageindex.php                          24-May-2024 16:04                3537
imagick.setimageinterlacescheme.php                24-May-2024 16:04                3023
imagick.setimageinterpolatemethod.php              24-May-2024 16:04                3111
imagick.setimageiterations.php                     24-May-2024 16:04                5091
imagick.setimagematte.php                          24-May-2024 16:04                2921
imagick.setimagemattecolor.php                     24-May-2024 16:04                3901
imagick.setimageopacity.php                        24-May-2024 16:04                5251
imagick.setimageorientation.php                    24-May-2024 16:04                4757
imagick.setimagepage.php                           24-May-2024 16:04                3820
imagick.setimageprofile.php                        24-May-2024 16:04                3513
imagick.setimageproperty.php                       24-May-2024 16:04                5333
imagick.setimageredprimary.php                     24-May-2024 16:04                3203
imagick.setimagerenderingintent.php                24-May-2024 16:04                3034
imagick.setimageresolution.php                     24-May-2024 16:04                5073
imagick.setimagescene.php                          24-May-2024 16:04                2880
imagick.setimagetickspersecond.php                 24-May-2024 16:04                7784
imagick.setimagetype.php                           24-May-2024 16:04                2643
imagick.setimageunits.php                          24-May-2024 16:04                2679
imagick.setimagevirtualpixelmethod.php             24-May-2024 16:04                2821
imagick.setimagewhitepoint.php                     24-May-2024 16:04                3225
imagick.setinterlacescheme.php                     24-May-2024 16:04                2719
imagick.setiteratorindex.php                       24-May-2024 16:04                6430
imagick.setlastiterator.php                        24-May-2024 16:04                2473
imagick.setoption.php                              24-May-2024 16:04               11585
imagick.setpage.php                                24-May-2024 16:04                3564
imagick.setpointsize.php                           24-May-2024 16:04                5527
imagick.setprogressmonitor.php                     24-May-2024 16:04               10266
imagick.setregistry.php                            24-May-2024 16:04                3104
imagick.setresolution.php                          24-May-2024 16:04                3876
imagick.setresourcelimit.php                       24-May-2024 16:04                3741
imagick.setsamplingfactors.php                     24-May-2024 16:04                6838
imagick.setsize.php                                24-May-2024 16:04                3010
imagick.setsizeoffset.php                          24-May-2024 16:04                3592
imagick.settype.php                                24-May-2024 16:04                2587
imagick.setup.php                                  24-May-2024 16:04                1631
imagick.shadeimage.php                             24-May-2024 16:04                5742
imagick.shadowimage.php                            24-May-2024 16:04                5506
imagick.sharpenimage.php                           24-May-2024 16:04                5721
imagick.shaveimage.php                             24-May-2024 16:04                4813
imagick.shearimage.php                             24-May-2024 16:04                6640
imagick.sigmoidalcontrastimage.php                 24-May-2024 16:04                8177
imagick.sketchimage.php                            24-May-2024 16:04                6077
imagick.smushimages.php                            24-May-2024 16:04                5805
imagick.solarizeimage.php                          24-May-2024 16:04                4887
imagick.sparsecolorimage.php                       24-May-2024 16:04               26800
imagick.spliceimage.php                            24-May-2024 16:04                5834
imagick.spreadimage.php                            24-May-2024 16:04                4749
imagick.statisticimage.php                         24-May-2024 16:04                6763
imagick.steganoimage.php                           24-May-2024 16:04                3136
imagick.stereoimage.php                            24-May-2024 16:04                2939
imagick.stripimage.php                             24-May-2024 16:04                2647
imagick.subimagematch.php                          24-May-2024 16:04                7519
imagick.swirlimage.php                             24-May-2024 16:04                4809
imagick.textureimage.php                           24-May-2024 16:04                6237
imagick.thresholdimage.php                         24-May-2024 16:04                5318
imagick.thumbnailimage.php                         24-May-2024 16:04                7829
imagick.tintimage.php                              24-May-2024 16:04                8009
imagick.tostring.php                               24-May-2024 16:04                2990
imagick.transformimage.php                         24-May-2024 16:04                6284
imagick.transformimagecolorspace.php               24-May-2024 16:04                5757
imagick.transparentpaintimage.php                  24-May-2024 16:04                7364
imagick.transposeimage.php                         24-May-2024 16:04                4715
imagick.transverseimage.php                        24-May-2024 16:04                4702
imagick.trimimage.php                              24-May-2024 16:04                5954
imagick.uniqueimagecolors.php                      24-May-2024 16:04                5661
imagick.unsharpmaskimage.php                       24-May-2024 16:04                6876
imagick.valid.php                                  24-May-2024 16:04                2365
imagick.vignetteimage.php                          24-May-2024 16:04                6710
imagick.waveimage.php                              24-May-2024 16:04                6466
imagick.whitethresholdimage.php                    24-May-2024 16:04                5367
imagick.writeimage.php                             24-May-2024 16:04                3127
imagick.writeimagefile.php                         24-May-2024 16:04                4092
imagick.writeimages.php                            24-May-2024 16:04                2971
imagick.writeimagesfile.php                        24-May-2024 16:04                4171
imagickdraw.affine.php                             24-May-2024 16:04               16972
imagickdraw.annotation.php                         24-May-2024 16:04                3442
imagickdraw.arc.php                                24-May-2024 16:04                9674
imagickdraw.bezier.php                             24-May-2024 16:04               16899
imagickdraw.circle.php                             24-May-2024 16:04                9105
imagickdraw.clear.php                              24-May-2024 16:04                2445
imagickdraw.clone.php                              24-May-2024 16:04                2496
imagickdraw.color.php                              24-May-2024 16:04                3581
imagickdraw.comment.php                            24-May-2024 16:04                2839
imagickdraw.composite.php                          24-May-2024 16:04               11912
imagickdraw.construct.php                          24-May-2024 16:04                2308
imagickdraw.destroy.php                            24-May-2024 16:04                2463
imagickdraw.ellipse.php                            24-May-2024 16:04               12290
imagickdraw.getclippath.php                        24-May-2024 16:04                2467
imagickdraw.getcliprule.php                        24-May-2024 16:04                2578
imagickdraw.getclipunits.php                       24-May-2024 16:04                2390
imagickdraw.getfillcolor.php                       24-May-2024 16:04                2500
imagickdraw.getfillopacity.php                     24-May-2024 16:04                2458
imagickdraw.getfillrule.php                        24-May-2024 16:04                2508
imagickdraw.getfont.php                            24-May-2024 16:04                2428
imagickdraw.getfontfamily.php                      24-May-2024 16:04                2543
imagickdraw.getfontsize.php                        24-May-2024 16:04                2582
imagickdraw.getfontstretch.php                     24-May-2024 16:04                2414
imagickdraw.getfontstyle.php                       24-May-2024 16:04                2783
imagickdraw.getfontweight.php                      24-May-2024 16:04                2469
imagickdraw.getgravity.php                         24-May-2024 16:04                2633
imagickdraw.getstrokeantialias.php                 24-May-2024 16:04                2971
imagickdraw.getstrokecolor.php                     24-May-2024 16:04                2876
imagickdraw.getstrokedasharray.php                 24-May-2024 16:04                2571
imagickdraw.getstrokedashoffset.php                24-May-2024 16:04                2580
imagickdraw.getstrokelinecap.php                   24-May-2024 16:04                2707
imagickdraw.getstrokelinejoin.php                  24-May-2024 16:04                2721
imagickdraw.getstrokemiterlimit.php                24-May-2024 16:04                2862
imagickdraw.getstrokeopacity.php                   24-May-2024 16:04                2542
imagickdraw.getstrokewidth.php                     24-May-2024 16:04                2557
imagickdraw.gettextalignment.php                   24-May-2024 16:04                2610
imagickdraw.gettextantialias.php                   24-May-2024 16:04                2911
imagickdraw.gettextdecoration.php                  24-May-2024 16:04                2661
imagickdraw.gettextencoding.php                    24-May-2024 16:04                2632
imagickdraw.gettextinterlinespacing.php            24-May-2024 16:04                2451
imagickdraw.gettextinterwordspacing.php            24-May-2024 16:04                2475
imagickdraw.gettextkerning.php                     24-May-2024 16:04                2370
imagickdraw.gettextundercolor.php                  24-May-2024 16:04                2570
imagickdraw.getvectorgraphics.php                  24-May-2024 16:04                2705
imagickdraw.line.php                               24-May-2024 16:04                8435
imagickdraw.matte.php                              24-May-2024 16:04                8419
imagickdraw.pathclose.php                          24-May-2024 16:04                2515
imagickdraw.pathcurvetoabsolute.php                24-May-2024 16:04                4970
imagickdraw.pathcurvetoquadraticbezierabsolute.php 24-May-2024 16:04               11214
imagickdraw.pathcurvetoquadraticbezierrelative.php 24-May-2024 16:04                4397
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 24-May-2024 16:04               10538
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 24-May-2024 16:04               10509
imagickdraw.pathcurvetorelative.php                24-May-2024 16:04                4998
imagickdraw.pathcurvetosmoothabsolute.php          24-May-2024 16:04                4701
imagickdraw.pathcurvetosmoothrelative.php          24-May-2024 16:04                4709
imagickdraw.pathellipticarcabsolute.php            24-May-2024 16:04                5934
imagickdraw.pathellipticarcrelative.php            24-May-2024 16:04                5904
imagickdraw.pathfinish.php                         24-May-2024 16:04                2353
imagickdraw.pathlinetoabsolute.php                 24-May-2024 16:04                3290
imagickdraw.pathlinetohorizontalabsolute.php       24-May-2024 16:04                3125
imagickdraw.pathlinetohorizontalrelative.php       24-May-2024 16:04                3125
imagickdraw.pathlinetorelative.php                 24-May-2024 16:04                3338
imagickdraw.pathlinetoverticalabsolute.php         24-May-2024 16:04                3101
imagickdraw.pathlinetoverticalrelative.php         24-May-2024 16:04                3101
imagickdraw.pathmovetoabsolute.php                 24-May-2024 16:04                3321
imagickdraw.pathmovetorelative.php                 24-May-2024 16:04                3287
imagickdraw.pathstart.php                          24-May-2024 16:04               11924
imagickdraw.point.php                              24-May-2024 16:04                6914
imagickdraw.polygon.php                            24-May-2024 16:04                9100
imagickdraw.polyline.php                           24-May-2024 16:04                9127
imagickdraw.pop.php                                24-May-2024 16:04                2881
imagickdraw.popclippath.php                        24-May-2024 16:04                2324
imagickdraw.popdefs.php                            24-May-2024 16:04                7779
imagickdraw.poppattern.php                         24-May-2024 16:04                2517
imagickdraw.push.php                               24-May-2024 16:04                8584
imagickdraw.pushclippath.php                       24-May-2024 16:04                3077
imagickdraw.pushdefs.php                           24-May-2024 16:04                2655
imagickdraw.pushpattern.php                        24-May-2024 16:04               14755
imagickdraw.rectangle.php                          24-May-2024 16:04                8574
imagickdraw.render.php                             24-May-2024 16:04                2617
imagickdraw.resetvectorgraphics.php                24-May-2024 16:04                2480
imagickdraw.rotate.php                             24-May-2024 16:04                7783
imagickdraw.roundrectangle.php                     24-May-2024 16:04                9484
imagickdraw.scale.php                              24-May-2024 16:04                8147
imagickdraw.setclippath.php                        24-May-2024 16:04                8532
imagickdraw.setcliprule.php                        24-May-2024 16:04                9552
imagickdraw.setclipunits.php                       24-May-2024 16:04                8882
imagickdraw.setfillalpha.php                       24-May-2024 16:04                7886
imagickdraw.setfillcolor.php                       24-May-2024 16:04                7836
imagickdraw.setfillopacity.php                     24-May-2024 16:04                7933
imagickdraw.setfillpatternurl.php                  24-May-2024 16:04                3504
imagickdraw.setfillrule.php                        24-May-2024 16:04               13089
imagickdraw.setfont.php                            24-May-2024 16:04                9381
imagickdraw.setfontfamily.php                      24-May-2024 16:04               10056
imagickdraw.setfontsize.php                        24-May-2024 16:04                8413
imagickdraw.setfontstretch.php                     24-May-2024 16:04                9864
imagickdraw.setfontstyle.php                       24-May-2024 16:04                9169
imagickdraw.setfontweight.php                      24-May-2024 16:04                9238
imagickdraw.setgravity.php                         24-May-2024 16:04               10673
imagickdraw.setresolution.php                      24-May-2024 16:04                2946
imagickdraw.setstrokealpha.php                     24-May-2024 16:04                8494
imagickdraw.setstrokeantialias.php                 24-May-2024 16:04                9188
imagickdraw.setstrokecolor.php                     24-May-2024 16:04                8565
imagickdraw.setstrokedasharray.php                 24-May-2024 16:04               13536
imagickdraw.setstrokedashoffset.php                24-May-2024 16:04                9954
imagickdraw.setstrokelinecap.php                   24-May-2024 16:04                8646
imagickdraw.setstrokelinejoin.php                  24-May-2024 16:04               11518
imagickdraw.setstrokemiterlimit.php                24-May-2024 16:04               11372
imagickdraw.setstrokeopacity.php                   24-May-2024 16:04               10314
imagickdraw.setstrokepatternurl.php                24-May-2024 16:04                3099
imagickdraw.setstrokewidth.php                     24-May-2024 16:04                8544
imagickdraw.settextalignment.php                   24-May-2024 16:04                9507
imagickdraw.settextantialias.php                   24-May-2024 16:04                9042
imagickdraw.settextdecoration.php                  24-May-2024 16:04                7551
imagickdraw.settextencoding.php                    24-May-2024 16:04                3355
imagickdraw.settextinterlinespacing.php            24-May-2024 16:04                3017
imagickdraw.settextinterwordspacing.php            24-May-2024 16:04                2810
imagickdraw.settextkerning.php                     24-May-2024 16:04                2926
imagickdraw.settextundercolor.php                  24-May-2024 16:04                7824
imagickdraw.setvectorgraphics.php                  24-May-2024 16:04                9168
imagickdraw.setviewbox.php                         24-May-2024 16:04               10525
imagickdraw.skewx.php                              24-May-2024 16:04                8168
imagickdraw.skewy.php                              24-May-2024 16:04                8161
imagickdraw.translate.php                          24-May-2024 16:04                8498
imagickkernel.addkernel.php                        24-May-2024 16:04                7035
imagickkernel.addunitykernel.php                   24-May-2024 16:04               13696
imagickkernel.frombuiltin.php                      24-May-2024 16:04               26240
imagickkernel.frommatrix.php                       24-May-2024 16:04               23172
imagickkernel.getmatrix.php                        24-May-2024 16:04                7110
imagickkernel.scale.php                            24-May-2024 16:04               13202
imagickkernel.separate.php                         24-May-2024 16:04                9722
imagickpixel.clear.php                             24-May-2024 16:04                2540
imagickpixel.construct.php                         24-May-2024 16:04               11975
imagickpixel.destroy.php                           24-May-2024 16:04                2660
imagickpixel.getcolor.php                          24-May-2024 16:04                8085
imagickpixel.getcolorasstring.php                  24-May-2024 16:04                4948
imagickpixel.getcolorcount.php                     24-May-2024 16:04                5052
imagickpixel.getcolorquantum.php                   24-May-2024 16:04                2971
imagickpixel.getcolorvalue.php                     24-May-2024 16:04                8765
imagickpixel.getcolorvaluequantum.php              24-May-2024 16:04                6126
imagickpixel.gethsl.php                            24-May-2024 16:04                4560
imagickpixel.getindex.php                          24-May-2024 16:04                2317
imagickpixel.ispixelsimilar.php                    24-May-2024 16:04                3667
imagickpixel.ispixelsimilarquantum.php             24-May-2024 16:04                3251
imagickpixel.issimilar.php                         24-May-2024 16:04               16752
imagickpixel.setcolor.php                          24-May-2024 16:04                7602
imagickpixel.setcolorcount.php                     24-May-2024 16:04                2719
imagickpixel.setcolorvalue.php                     24-May-2024 16:04                5335
imagickpixel.setcolorvaluequantum.php              24-May-2024 16:04                8524
imagickpixel.sethsl.php                            24-May-2024 16:04                7669
imagickpixel.setindex.php                          24-May-2024 16:04                2648
imagickpixeliterator.clear.php                     24-May-2024 16:04                6407
imagickpixeliterator.construct.php                 24-May-2024 16:04                6066
imagickpixeliterator.destroy.php                   24-May-2024 16:04                2664
imagickpixeliterator.getcurrentiteratorrow.php     24-May-2024 16:04                2736
imagickpixeliterator.getiteratorrow.php            24-May-2024 16:04                2649
imagickpixeliterator.getnextiteratorrow.php        24-May-2024 16:04                6815
imagickpixeliterator.getpreviousiteratorrow.php    24-May-2024 16:04                2783
imagickpixeliterator.newpixeliterator.php          24-May-2024 16:04                2884
imagickpixeliterator.newpixelregioniterator.php    24-May-2024 16:04                4417
imagickpixeliterator.resetiterator.php             24-May-2024 16:04                8833
imagickpixeliterator.setiteratorfirstrow.php       24-May-2024 16:04                2690
imagickpixeliterator.setiteratorlastrow.php        24-May-2024 16:04                2685
imagickpixeliterator.setiteratorrow.php            24-May-2024 16:04                7211
imagickpixeliterator.synciterator.php              24-May-2024 16:04                2552
imap.configuration.php                             24-May-2024 16:04                3461
imap.constants.php                                 24-May-2024 16:04               26175
imap.installation.php                              24-May-2024 16:04                3023
imap.requirements.php                              24-May-2024 16:04                3694
imap.resources.php                                 24-May-2024 16:04                1477
imap.setup.php                                     24-May-2024 16:04                1602
index.php                                          24-May-2024 16:05               13242
indexes.examples.php                               24-May-2024 16:05              733843
indexes.functions.php                              24-May-2024 16:05             1241705
indexes.php                                        24-May-2024 16:05                1430
infiniteiterator.construct.php                     24-May-2024 16:05                5011
infiniteiterator.next.php                          24-May-2024 16:05                3155
info.configuration.php                             24-May-2024 16:04               14542
info.constants.php                                 24-May-2024 16:04               25455
info.installation.php                              24-May-2024 16:04                1263
info.requirements.php                              24-May-2024 16:04                1203
info.resources.php                                 24-May-2024 16:04                1204
info.setup.php                                     24-May-2024 16:04                1589
ini.core.php                                       24-May-2024 16:05               81631
ini.list.php                                       24-May-2024 16:05              107475
ini.php                                            24-May-2024 16:05                1683
ini.sections.php                                   24-May-2024 16:05                4449
inotify.configuration.php                          24-May-2024 16:04                1246
inotify.constants.php                              24-May-2024 16:04               11258
inotify.install.php                                24-May-2024 16:04                1887
inotify.requirements.php                           24-May-2024 16:04                1270
inotify.resources.php                              24-May-2024 16:04                1389
inotify.setup.php                                  24-May-2024 16:04                1621
install.cloud.azure.php                            24-May-2024 16:04                4708
install.cloud.digitalocean.php                     24-May-2024 16:04                3463
install.cloud.ec2.php                              24-May-2024 16:04                1540
install.cloud.php                                  24-May-2024 16:04                1875
install.fpm.configuration.php                      24-May-2024 16:04               40533
install.fpm.install.php                            24-May-2024 16:04                3564
install.fpm.php                                    24-May-2024 16:04                4007
install.general.php                                24-May-2024 16:04                5666
install.macosx.bundled.php                         24-May-2024 16:04               11960
install.macosx.compile.php                         24-May-2024 16:04                1526
install.macosx.packages.php                        24-May-2024 16:04                3348
install.macosx.php                                 24-May-2024 16:04                2175
install.pecl.downloads.php                         24-May-2024 16:04                4177
install.pecl.intro.php                             24-May-2024 16:04                3509
install.pecl.pear.php                              24-May-2024 16:04                3393
install.pecl.php                                   24-May-2024 16:04                2149
install.pecl.php-config.php                        24-May-2024 16:04                4608
install.pecl.phpize.php                            24-May-2024 16:04                3637
install.pecl.static.php                            24-May-2024 16:04                3765
install.pecl.windows.php                           24-May-2024 16:04               11207
install.php                                        24-May-2024 16:04                6012
install.problems.bugs.php                          24-May-2024 16:04                1982
install.problems.faq.php                           24-May-2024 16:04                1417
install.problems.php                               24-May-2024 16:04                1626
install.problems.support.php                       24-May-2024 16:04                2699
install.unix.apache2.php                           24-May-2024 16:04               15034
install.unix.commandline.php                       24-May-2024 16:04                4382
install.unix.debian.php                            24-May-2024 16:04                7739
install.unix.lighttpd-14.php                       24-May-2024 16:04                6705
install.unix.litespeed.php                         24-May-2024 16:04               10701
install.unix.nginx.php                             24-May-2024 16:04                9818
install.unix.openbsd.php                           24-May-2024 16:04                6776
install.unix.php                                   24-May-2024 16:04                8877
install.unix.solaris.php                           24-May-2024 16:04                4280
install.windows.apache2.php                        24-May-2024 16:04                7924
install.windows.building.php                       24-May-2024 16:04                1871
install.windows.commandline.php                    24-May-2024 16:04                9226
install.windows.manual.php                         24-May-2024 16:04                5931
install.windows.pecl.php                           24-May-2024 16:04                1736
install.windows.php                                24-May-2024 16:04                3413
install.windows.recommended.php                    24-May-2024 16:04                5959
install.windows.requirements.php                   24-May-2024 16:04                2741
install.windows.tools.php                          24-May-2024 16:04                2019
install.windows.troubleshooting.php                24-May-2024 16:04                2040
internaliterator.construct.php                     24-May-2024 16:04                2053
internaliterator.current.php                       24-May-2024 16:04                2328
internaliterator.key.php                           24-May-2024 16:04                2311
internaliterator.next.php                          24-May-2024 16:04                2290
internaliterator.rewind.php                        24-May-2024 16:04                2346
internaliterator.valid.php                         24-May-2024 16:04                2340
intl.configuration.php                             24-May-2024 16:04                5656
intl.constants.php                                 24-May-2024 16:04               13411
intl.examples.basic.php                            24-May-2024 16:04                4433
intl.examples.php                                  24-May-2024 16:04                1386
intl.installation.php                              24-May-2024 16:04                1905
intl.requirements.php                              24-May-2024 16:04                1454
intl.resources.php                                 24-May-2024 16:04                1204
intl.setup.php                                     24-May-2024 16:04                1600
intlbreakiterator.construct.php                    24-May-2024 16:04                4207
intlbreakiterator.createcharacterinstance.php      24-May-2024 16:04                3408
intlbreakiterator.createcodepointinstance.php      24-May-2024 16:04                2868
intlbreakiterator.createlineinstance.php           24-May-2024 16:04                3352
intlbreakiterator.createsentenceinstance.php       24-May-2024 16:04                3348
intlbreakiterator.createtitleinstance.php          24-May-2024 16:04                3348
intlbreakiterator.createwordinstance.php           24-May-2024 16:04                3298
intlbreakiterator.current.php                      24-May-2024 16:04                2564
intlbreakiterator.first.php                        24-May-2024 16:04                2539
intlbreakiterator.following.php                    24-May-2024 16:04                2832
intlbreakiterator.geterrorcode.php                 24-May-2024 16:04                3113
intlbreakiterator.geterrormessage.php              24-May-2024 16:04                3165
intlbreakiterator.getlocale.php                    24-May-2024 16:04                2961
intlbreakiterator.getpartsiterator.php             24-May-2024 16:04                3920
intlbreakiterator.gettext.php                      24-May-2024 16:04                2681
intlbreakiterator.isboundary.php                   24-May-2024 16:04                2813
intlbreakiterator.last.php                         24-May-2024 16:04                2540
intlbreakiterator.next.php                         24-May-2024 16:04                2949
intlbreakiterator.preceding.php                    24-May-2024 16:04                2827
intlbreakiterator.previous.php                     24-May-2024 16:04                2590
intlbreakiterator.settext.php                      24-May-2024 16:04                3781
intlcalendar.add.php                               24-May-2024 16:04                9290
intlcalendar.after.php                             24-May-2024 16:04                7107
intlcalendar.before.php                            24-May-2024 16:04                4519
intlcalendar.clear.php                             24-May-2024 16:04               19407
intlcalendar.construct.php                         24-May-2024 16:04                2483
intlcalendar.createinstance.php                    24-May-2024 16:04               14096
intlcalendar.equals.php                            24-May-2024 16:04               11289
intlcalendar.fielddifference.php                   24-May-2024 16:04               11575
intlcalendar.fromdatetime.php                      24-May-2024 16:04                8205
intlcalendar.get.php                               24-May-2024 16:04                8973
intlcalendar.getactualmaximum.php                  24-May-2024 16:04                8996
intlcalendar.getactualminimum.php                  24-May-2024 16:04                6175
intlcalendar.getavailablelocales.php               24-May-2024 16:04                4470
intlcalendar.getdayofweektype.php                  24-May-2024 16:04               10818
intlcalendar.geterrorcode.php                      24-May-2024 16:04                9687
intlcalendar.geterrormessage.php                   24-May-2024 16:04                6485
intlcalendar.getfirstdayofweek.php                 24-May-2024 16:04                8921
intlcalendar.getgreatestminimum.php                24-May-2024 16:04                4999
intlcalendar.getkeywordvaluesforlocale.php         24-May-2024 16:04                7787
intlcalendar.getleastmaximum.php                   24-May-2024 16:04                8651
intlcalendar.getlocale.php                         24-May-2024 16:04                6721
intlcalendar.getmaximum.php                        24-May-2024 16:04                5685
intlcalendar.getminimaldaysinfirstweek.php         24-May-2024 16:04                9040
intlcalendar.getminimum.php                        24-May-2024 16:04                4907
intlcalendar.getnow.php                            24-May-2024 16:04                5479
intlcalendar.getrepeatedwalltimeoption.php         24-May-2024 16:04               10554
intlcalendar.getskippedwalltimeoption.php          24-May-2024 16:04               13004
intlcalendar.gettime.php                           24-May-2024 16:04                6789
intlcalendar.gettimezone.php                       24-May-2024 16:04                7781
intlcalendar.gettype.php                           24-May-2024 16:04                5897
intlcalendar.getweekendtransition.php              24-May-2024 16:04                5542
intlcalendar.indaylighttime.php                    24-May-2024 16:04                8917
intlcalendar.isequivalentto.php                    24-May-2024 16:04                8733
intlcalendar.islenient.php                         24-May-2024 16:04                8616
intlcalendar.isset.php                             24-May-2024 16:04                5230
intlcalendar.isweekend.php                         24-May-2024 16:04                9355
intlcalendar.roll.php                              24-May-2024 16:04                9873
intlcalendar.set.php                               24-May-2024 16:04               16605
intlcalendar.setdate.php                           24-May-2024 16:04                4952
intlcalendar.setdatetime.php                       24-May-2024 16:04                6878
intlcalendar.setfirstdayofweek.php                 24-May-2024 16:04                9087
intlcalendar.setlenient.php                        24-May-2024 16:04                5446
intlcalendar.setminimaldaysinfirstweek.php         24-May-2024 16:04                5662
intlcalendar.setrepeatedwalltimeoption.php         24-May-2024 16:04                6883
intlcalendar.setskippedwalltimeoption.php          24-May-2024 16:04                7863
intlcalendar.settime.php                           24-May-2024 16:04                8819
intlcalendar.settimezone.php                       24-May-2024 16:04               11875
intlcalendar.todatetime.php                        24-May-2024 16:04                7451
intlchar.charage.php                               24-May-2024 16:04                6116
intlchar.chardigitvalue.php                        24-May-2024 16:04                5669
intlchar.chardirection.php                         24-May-2024 16:04               10897
intlchar.charfromname.php                          24-May-2024 16:04                7503
intlchar.charmirror.php                            24-May-2024 16:04                6993
intlchar.charname.php                              24-May-2024 16:04                7872
intlchar.chartype.php                              24-May-2024 16:04               11651
intlchar.chr.php                                   24-May-2024 16:04                5841
intlchar.digit.php                                 24-May-2024 16:04                9016
intlchar.enumcharnames.php                         24-May-2024 16:04                9344
intlchar.enumchartypes.php                         24-May-2024 16:04                6168
intlchar.foldcase.php                              24-May-2024 16:04                4355
intlchar.fordigit.php                              24-May-2024 16:04                7158
intlchar.getbidipairedbracket.php                  24-May-2024 16:04                6461
intlchar.getblockcode.php                          24-May-2024 16:04                5715
intlchar.getcombiningclass.php                     24-May-2024 16:04                5099
intlchar.getfc-nfkc-closure.php                    24-May-2024 16:04                5130
intlchar.getintpropertymaxvalue.php                24-May-2024 16:04                6626
intlchar.getintpropertyminvalue.php                24-May-2024 16:04                6613
intlchar.getintpropertyvalue.php                   24-May-2024 16:04                8448
intlchar.getnumericvalue.php                       24-May-2024 16:04                5958
intlchar.getpropertyenum.php                       24-May-2024 16:04                7097
intlchar.getpropertyname.php                       24-May-2024 16:04                9789
intlchar.getpropertyvalueenum.php                  24-May-2024 16:04                8417
intlchar.getpropertyvaluename.php                  24-May-2024 16:04               11827
intlchar.getunicodeversion.php                     24-May-2024 16:04                4102
intlchar.hasbinaryproperty.php                     24-May-2024 16:04                9554
intlchar.isalnum.php                               24-May-2024 16:04                6126
intlchar.isalpha.php                               24-May-2024 16:04                6053
intlchar.isbase.php                                24-May-2024 16:04                6397
intlchar.isblank.php                               24-May-2024 16:04                7246
intlchar.iscntrl.php                               24-May-2024 16:04                7071
intlchar.isdefined.php                             24-May-2024 16:04                7289
intlchar.isdigit.php                               24-May-2024 16:04                6426
intlchar.isgraph.php                               24-May-2024 16:04                6270
intlchar.isidignorable.php                         24-May-2024 16:04                6649
intlchar.isidpart.php                              24-May-2024 16:04                7220
intlchar.isidstart.php                             24-May-2024 16:04                6683
intlchar.isisocontrol.php                          24-May-2024 16:04                5904
intlchar.isjavaidpart.php                          24-May-2024 16:04                7313
intlchar.isjavaidstart.php                         24-May-2024 16:04                7024
intlchar.isjavaspacechar.php                       24-May-2024 16:04                7172
intlchar.islower.php                               24-May-2024 16:04                7697
intlchar.ismirrored.php                            24-May-2024 16:04                5950
intlchar.isprint.php                               24-May-2024 16:04                6441
intlchar.ispunct.php                               24-May-2024 16:04                6039
intlchar.isspace.php                               24-May-2024 16:04                6865
intlchar.istitle.php                               24-May-2024 16:04                7815
intlchar.isualphabetic.php                         24-May-2024 16:04                6225
intlchar.isulowercase.php                          24-May-2024 16:04                7295
intlchar.isupper.php                               24-May-2024 16:04                7689
intlchar.isuuppercase.php                          24-May-2024 16:04                7342
intlchar.isuwhitespace.php                         24-May-2024 16:04                7755
intlchar.iswhitespace.php                          24-May-2024 16:04                7618
intlchar.isxdigit.php                              24-May-2024 16:04                7492
intlchar.ord.php                                   24-May-2024 16:04                5606
intlchar.tolower.php                               24-May-2024 16:04                7838
intlchar.totitle.php                               24-May-2024 16:04                8065
intlchar.toupper.php                               24-May-2024 16:04                7713
intlcodepointbreakiterator.getlastcodepoint.php    24-May-2024 16:04                2835
intldateformatter.create.php                       24-May-2024 16:04               30024
intldateformatter.format.php                       24-May-2024 16:04               27124
intldateformatter.formatobject.php                 24-May-2024 16:04               15106
intldateformatter.getcalendar.php                  24-May-2024 16:04               11265
intldateformatter.getcalendarobject.php            24-May-2024 16:04                7957
intldateformatter.getdatetype.php                  24-May-2024 16:04               11712
intldateformatter.geterrorcode.php                 24-May-2024 16:04                8729
intldateformatter.geterrormessage.php              24-May-2024 16:04                8674
intldateformatter.getlocale.php                    24-May-2024 16:04               12453
intldateformatter.getpattern.php                   24-May-2024 16:04               10468
intldateformatter.gettimetype.php                  24-May-2024 16:04               11702
intldateformatter.gettimezone.php                  24-May-2024 16:04                8934
intldateformatter.gettimezoneid.php                24-May-2024 16:04                9017
intldateformatter.islenient.php                    24-May-2024 16:04               14854
intldateformatter.localtime.php                    24-May-2024 16:04               12022
intldateformatter.parse.php                        24-May-2024 16:04               12759
intldateformatter.setcalendar.php                  24-May-2024 16:04               14824
intldateformatter.setlenient.php                   24-May-2024 16:04               15756
intldateformatter.setpattern.php                   24-May-2024 16:04               11729
intldateformatter.settimezone.php                  24-May-2024 16:04               12854
intldatepatterngenerator.create.php                24-May-2024 16:04                4510
intldatepatterngenerator.getbestpattern.php        24-May-2024 16:04                7068
intlgregoriancalendar.construct.php                24-May-2024 16:04                5740
intlgregoriancalendar.createfromdate.php           24-May-2024 16:04                7624
intlgregoriancalendar.createfromdatetime.php       24-May-2024 16:04                9331
intlgregoriancalendar.getgregorianchange.php       24-May-2024 16:04                2786
intlgregoriancalendar.isleapyear.php               24-May-2024 16:04                3192
intlgregoriancalendar.setgregorianchange.php       24-May-2024 16:04                3172
intliterator.current.php                           24-May-2024 16:04                2429
intliterator.key.php                               24-May-2024 16:04                2402
intliterator.next.php                              24-May-2024 16:04                2396
intliterator.rewind.php                            24-May-2024 16:04                2437
intliterator.valid.php                             24-May-2024 16:04                2418
intlpartsiterator.getbreakiterator.php             24-May-2024 16:04                2663
intlrulebasedbreakiterator.construct.php           24-May-2024 16:04                3274
intlrulebasedbreakiterator.getbinaryrules.php      24-May-2024 16:04                2919
intlrulebasedbreakiterator.getrules.php            24-May-2024 16:04                2892
intlrulebasedbreakiterator.getrulestatus.php       24-May-2024 16:04                2827
intlrulebasedbreakiterator.getrulestatusvec.php    24-May-2024 16:04                2950
intltimezone.construct.php                         24-May-2024 16:04                2042
intltimezone.countequivalentids.php                24-May-2024 16:04                3751
intltimezone.createdefault.php                     24-May-2024 16:04                3110
intltimezone.createenumeration.php                 24-May-2024 16:04                4847
intltimezone.createtimezone.php                    24-May-2024 16:04                3740
intltimezone.createtimezoneidenumeration.php       24-May-2024 16:04                5966
intltimezone.fromdatetimezone.php                  24-May-2024 16:04                3860
intltimezone.getcanonicalid.php                    24-May-2024 16:04                4522
intltimezone.getdisplayname.php                    24-May-2024 16:04                5663
intltimezone.getdstsavings.php                     24-May-2024 16:04                3241
intltimezone.getequivalentid.php                   24-May-2024 16:04                4151
intltimezone.geterrorcode.php                      24-May-2024 16:04                3397
intltimezone.geterrormessage.php                   24-May-2024 16:04                3428
intltimezone.getgmt.php                            24-May-2024 16:04                2945
intltimezone.getid.php                             24-May-2024 16:04                3290
intltimezone.getidforwindowsid.php                 24-May-2024 16:04                6092
intltimezone.getoffset.php                         24-May-2024 16:04                5164
intltimezone.getrawoffset.php                      24-May-2024 16:04                3165
intltimezone.getregion.php                         24-May-2024 16:04                3803
intltimezone.gettzdataversion.php                  24-May-2024 16:04                3338
intltimezone.getunknown.php                        24-May-2024 16:04                3258
intltimezone.getwindowsid.php                      24-May-2024 16:04                4650
intltimezone.hassamerules.php                      24-May-2024 16:04                3650
intltimezone.todatetimezone.php                    24-May-2024 16:04                3533
intltimezone.usedaylighttime.php                   24-May-2024 16:04                3224
intro-whatcando.php                                24-May-2024 16:04                9352
intro-whatis.php                                   24-May-2024 16:04                4686
intro.apache.php                                   24-May-2024 16:05                1234
intro.apcu.php                                     24-May-2024 16:04                2178
intro.array.php                                    24-May-2024 16:05                2054
intro.bc.php                                       24-May-2024 16:04                4836
intro.bzip2.php                                    24-May-2024 16:04                1237
intro.calendar.php                                 24-May-2024 16:04                2390
intro.classobj.php                                 24-May-2024 16:05                1973
intro.cmark.php                                    24-May-2024 16:05                7360
intro.com.php                                      24-May-2024 16:05                3889
intro.componere.php                                24-May-2024 16:04                6686
intro.ctype.php                                    24-May-2024 16:05                4491
intro.cubrid.php                                   24-May-2024 16:04                1583
intro.curl.php                                     24-May-2024 16:05                1791
intro.datetime.php                                 24-May-2024 16:04                2963
intro.dba.php                                      24-May-2024 16:04                1626
intro.dbase.php                                    24-May-2024 16:04                6868
intro.dio.php                                      24-May-2024 16:04                1793
intro.dom.php                                      24-May-2024 16:05                1819
intro.ds.php                                       24-May-2024 16:05                1473
intro.eio.php                                      24-May-2024 16:04               15403
intro.enchant.php                                  24-May-2024 16:04                2918
intro.errorfunc.php                                24-May-2024 16:04                2239
intro.ev.php                                       24-May-2024 16:04                2650
intro.event.php                                    24-May-2024 16:05                1980
intro.exec.php                                     24-May-2024 16:04                1939
intro.exif.php                                     24-May-2024 16:04                1579
intro.expect.php                                   24-May-2024 16:04                1533
intro.fann.php                                     24-May-2024 16:04                1426
intro.fdf.php                                      24-May-2024 16:04                4511
intro.ffi.php                                      24-May-2024 16:04                2869
intro.fileinfo.php                                 24-May-2024 16:04                1476
intro.filesystem.php                               24-May-2024 16:04                1596
intro.filter.php                                   24-May-2024 16:05                3181
intro.fpm.php                                      24-May-2024 16:05                1387
intro.ftp.php                                      24-May-2024 16:05                1984
intro.funchand.php                                 24-May-2024 16:05                1224
intro.gearman.php                                  24-May-2024 16:05                1920
intro.gender.php                                   24-May-2024 16:04                1458
intro.geoip.php                                    24-May-2024 16:04                1671
intro.gettext.php                                  24-May-2024 16:04                1643
intro.gmagick.php                                  24-May-2024 16:04                1898
intro.gmp.php                                      24-May-2024 16:04                3413
intro.gnupg.php                                    24-May-2024 16:04                1269
intro.hash.php                                     24-May-2024 16:04                1357
intro.hrtime.php                                   24-May-2024 16:04                1679
intro.ibase.php                                    24-May-2024 16:04                3734
intro.ibm-db2.php                                  24-May-2024 16:04                1352
intro.iconv.php                                    24-May-2024 16:04                2261
intro.igbinary.php                                 24-May-2024 16:04                1850
intro.image.php                                    24-May-2024 16:04                7866
intro.imagick.php                                  24-May-2024 16:04                1973
intro.imap.php                                     24-May-2024 16:04                1859
intro.info.php                                     24-May-2024 16:04                1580
intro.inotify.php                                  24-May-2024 16:04                2514
intro.intl.php                                     24-May-2024 16:04                5345
intro.json.php                                     24-May-2024 16:04                1757
intro.ldap.php                                     24-May-2024 16:05                4675
intro.libxml.php                                   24-May-2024 16:05                1861
intro.lua.php                                      24-May-2024 16:04                1358
intro.luasandbox.php                               24-May-2024 16:04                2379
intro.lzf.php                                      24-May-2024 16:04                1618
intro.mail.php                                     24-May-2024 16:04                1270
intro.mailparse.php                                24-May-2024 16:04                2241
intro.math.php                                     24-May-2024 16:04                2082
intro.mbstring.php                                 24-May-2024 16:04                3249
intro.mcrypt.php                                   24-May-2024 16:04                2474
intro.memcache.php                                 24-May-2024 16:05                1887
intro.memcached.php                                24-May-2024 16:05                2103
intro.mhash.php                                    24-May-2024 16:04                3298
intro.misc.php                                     24-May-2024 16:05                1214
intro.mqseries.php                                 24-May-2024 16:05                1967
intro.mysql-xdevapi.php                            24-May-2024 16:04                2178
intro.mysql.php                                    24-May-2024 16:04                2046
intro.mysqli.php                                   24-May-2024 16:04                2440
intro.mysqlnd.php                                  24-May-2024 16:04                2336
intro.network.php                                  24-May-2024 16:05                1217
intro.oauth.php                                    24-May-2024 16:05                1515
intro.oci8.php                                     24-May-2024 16:04                1709
intro.opcache.php                                  24-May-2024 16:04                1654
intro.openal.php                                   24-May-2024 16:04                1322
intro.openssl.php                                  24-May-2024 16:04                1753
intro.outcontrol.php                               24-May-2024 16:04                1948
intro.parallel.php                                 24-May-2024 16:04                6904
intro.parle.php                                    24-May-2024 16:05                3453
intro.password.php                                 24-May-2024 16:04                1521
intro.pcntl.php                                    24-May-2024 16:04                3035
intro.pcre.php                                     24-May-2024 16:05                3055
intro.pdo.php                                      24-May-2024 16:04                2654
intro.pgsql.php                                    24-May-2024 16:04                1925
intro.phar.php                                     24-May-2024 16:04               11701
intro.phpdbg.php                                   24-May-2024 16:04                7185
intro.posix.php                                    24-May-2024 16:04                1840
intro.ps.php                                       24-May-2024 16:04                2004
intro.pspell.php                                   24-May-2024 16:04                1262
intro.pthreads.php                                 24-May-2024 16:04               10895
intro.quickhash.php                                24-May-2024 16:05                1281
intro.radius.php                                   24-May-2024 16:04                2285
intro.random.php                                   24-May-2024 16:05                1123
intro.rar.php                                      24-May-2024 16:04                1737
intro.readline.php                                 24-May-2024 16:04                2300
intro.recode.php                                   24-May-2024 16:04                2590
intro.reflection.php                               24-May-2024 16:05                2114
intro.rnp.php                                      24-May-2024 16:04                1294
intro.rpminfo.php                                  24-May-2024 16:04                1411
intro.rrd.php                                      24-May-2024 16:05                1450
intro.runkit7.php                                  24-May-2024 16:04                1493
intro.scoutapm.php                                 24-May-2024 16:05                1577
intro.seaslog.php                                  24-May-2024 16:05                3947
intro.sem.php                                      24-May-2024 16:04                3681
intro.session.php                                  24-May-2024 16:05                5584
intro.shmop.php                                    24-May-2024 16:04                1296
intro.simdjson.php                                 24-May-2024 16:04                1243
intro.simplexml.php                                24-May-2024 16:05                1454
intro.snmp.php                                     24-May-2024 16:05                1783
intro.soap.php                                     24-May-2024 16:05                1599
intro.sockets.php                                  24-May-2024 16:05                3000
intro.sodium.php                                   24-May-2024 16:04                1455
intro.solr.php                                     24-May-2024 16:05                2005
intro.spl.php                                      24-May-2024 16:05                1633
intro.sqlite3.php                                  24-May-2024 16:04                1208
intro.sqlsrv.php                                   24-May-2024 16:04                2382
intro.ssdeep.php                                   24-May-2024 16:05                1773
intro.ssh2.php                                     24-May-2024 16:05                1430
intro.stats.php                                    24-May-2024 16:04                1525
intro.stomp.php                                    24-May-2024 16:05                1358
intro.stream.php                                   24-May-2024 16:05                5325
intro.strings.php                                  24-May-2024 16:05                1733
intro.svm.php                                      24-May-2024 16:05                1334
intro.svn.php                                      24-May-2024 16:05                1955
intro.swoole.php                                   24-May-2024 16:05                1676
intro.sync.php                                     24-May-2024 16:04                2368
intro.taint.php                                    24-May-2024 16:05                4453
intro.tcpwrap.php                                  24-May-2024 16:05                1365
intro.tidy.php                                     24-May-2024 16:05                1505
intro.tokenizer.php                                24-May-2024 16:05                1586
intro.trader.php                                   24-May-2024 16:04                2402
intro.ui.php                                       24-May-2024 16:05                1215
intro.uodbc.php                                    24-May-2024 16:04                2982
intro.uopz.php                                     24-May-2024 16:04                2618
intro.url.php                                      24-May-2024 16:05                1178
intro.v8js.php                                     24-May-2024 16:05                1272
intro.var.php                                      24-May-2024 16:05                1382
intro.var_representation.php                       24-May-2024 16:05                1443
intro.varnish.php                                  24-May-2024 16:05                1440
intro.wddx.php                                     24-May-2024 16:05                2521
intro.win32service.php                             24-May-2024 16:05                1463
intro.wincache.php                                 24-May-2024 16:04                6160
intro.wkhtmltox.php                                24-May-2024 16:04                1377
intro.xattr.php                                    24-May-2024 16:04                1210
intro.xdiff.php                                    24-May-2024 16:04                3246
intro.xhprof.php                                   24-May-2024 16:04                3281
intro.xlswriter.php                                24-May-2024 16:04                1229
intro.xml.php                                      24-May-2024 16:05                2561
intro.xmldiff.php                                  24-May-2024 16:05                1425
intro.xmlreader.php                                24-May-2024 16:05                1703
intro.xmlrpc.php                                   24-May-2024 16:05                2110
intro.xmlwriter.php                                24-May-2024 16:05                1717
intro.xsl.php                                      24-May-2024 16:05                1393
intro.yac.php                                      24-May-2024 16:04                1216
intro.yaconf.php                                   24-May-2024 16:05                2892
intro.yaf.php                                      24-May-2024 16:05                1661
intro.yaml.php                                     24-May-2024 16:05                1503
intro.yar.php                                      24-May-2024 16:05                1285
intro.yaz.php                                      24-May-2024 16:05                2992
intro.zip.php                                      24-May-2024 16:04                1265
intro.zlib.php                                     24-May-2024 16:04                1813
intro.zmq.php                                      24-May-2024 16:05                1401
intro.zookeeper.php                                24-May-2024 16:05                1462
introduction.php                                   24-May-2024 16:04                1472
iterator.current.php                               24-May-2024 16:04                2209
iterator.key.php                                   24-May-2024 16:04                2603
iterator.next.php                                  24-May-2024 16:04                2455
iterator.rewind.php                                24-May-2024 16:04                2666
iterator.valid.php                                 24-May-2024 16:04                2868
iteratoraggregate.getiterator.php                  24-May-2024 16:04                2957
iteratoriterator.construct.php                     24-May-2024 16:05                3554
iteratoriterator.current.php                       24-May-2024 16:05                2768
iteratoriterator.getinneriterator.php              24-May-2024 16:05                3285
iteratoriterator.key.php                           24-May-2024 16:05                2726
iteratoriterator.next.php                          24-May-2024 16:05                2872
iteratoriterator.rewind.php                        24-May-2024 16:05                2896
iteratoriterator.valid.php                         24-May-2024 16:05                3141
json.configuration.php                             24-May-2024 16:04                1229
json.constants.php                                 24-May-2024 16:04               18203
json.installation.php                              24-May-2024 16:04                1976
json.requirements.php                              24-May-2024 16:04                1247
json.resources.php                                 24-May-2024 16:04                1204
json.setup.php                                     24-May-2024 16:04                1570
jsonserializable.jsonserialize.php                 24-May-2024 16:04               12324
langref.php                                        24-May-2024 16:04               21521
language.attributes.classes.php                    24-May-2024 16:04                6945
language.attributes.overview.php                   24-May-2024 16:04               11006
language.attributes.php                            24-May-2024 16:04                1876
language.attributes.reflection.php                 24-May-2024 16:04                8888
language.attributes.syntax.php                     24-May-2024 16:04                6450
language.basic-syntax.comments.php                 24-May-2024 16:04                4158
language.basic-syntax.instruction-separation.php   24-May-2024 16:04                4445
language.basic-syntax.php                          24-May-2024 16:04                1699
language.basic-syntax.phpmode.php                  24-May-2024 16:04                4879
language.basic-syntax.phptags.php                  24-May-2024 16:04                5376
language.constants.magic.php                       24-May-2024 16:04                5974
language.constants.php                             24-May-2024 16:04                6531
language.constants.predefined.php                  24-May-2024 16:04                1669
language.constants.syntax.php                      24-May-2024 16:04               11270
language.control-structures.php                    24-May-2024 16:04                2775
language.enumerations.backed.php                   24-May-2024 16:04               11377
language.enumerations.basics.php                   24-May-2024 16:04                8951
language.enumerations.constants.php                24-May-2024 16:04                2540
language.enumerations.examples.php                 24-May-2024 16:04                7649
language.enumerations.expressions.php              24-May-2024 16:04                6664
language.enumerations.listing.php                  24-May-2024 16:04                2401
language.enumerations.methods.php                  24-May-2024 16:04               14294
language.enumerations.object-differences.inheri..> 24-May-2024 16:04                6556
language.enumerations.object-differences.php       24-May-2024 16:04                5603
language.enumerations.overview.php                 24-May-2024 16:04                2644
language.enumerations.php                          24-May-2024 16:04                2531
language.enumerations.serialization.php            24-May-2024 16:04                5353
language.enumerations.static-methods.php           24-May-2024 16:04                3419
language.enumerations.traits.php                   24-May-2024 16:04                4642
language.errors.basics.php                         24-May-2024 16:04                5856
language.errors.php                                24-May-2024 16:04                2051
language.errors.php7.php                           24-May-2024 16:04                6007
language.exceptions.extending.php                  24-May-2024 16:04               19896
language.exceptions.php                            24-May-2024 16:04               29349
language.expressions.php                           24-May-2024 16:04               17102
language.fibers.php                                24-May-2024 16:04                7105
language.functions.php                             24-May-2024 16:04                1953
language.generators.comparison.php                 24-May-2024 16:04                9081
language.generators.overview.php                   24-May-2024 16:04                9791
language.generators.php                            24-May-2024 16:04                1906
language.generators.syntax.php                     24-May-2024 16:04               24949
language.namespaces.basics.php                     24-May-2024 16:04               11812
language.namespaces.definition.php                 24-May-2024 16:04                4573
language.namespaces.definitionmultiple.php         24-May-2024 16:04                9385
language.namespaces.dynamic.php                    24-May-2024 16:04                8439
language.namespaces.fallback.php                   24-May-2024 16:04                6194
language.namespaces.faq.php                        24-May-2024 16:04               33080
language.namespaces.global.php                     24-May-2024 16:04                2885
language.namespaces.importing.php                  24-May-2024 16:04               16269
language.namespaces.nested.php                     24-May-2024 16:04                2835
language.namespaces.nsconstants.php                24-May-2024 16:04                9186
language.namespaces.php                            24-May-2024 16:04                2364
language.namespaces.rationale.php                  24-May-2024 16:04                6806
language.namespaces.rules.php                      24-May-2024 16:04               13876
language.oop5.abstract.php                         24-May-2024 16:04               11183
language.oop5.anonymous.php                        24-May-2024 16:04               10861
language.oop5.autoload.php                         24-May-2024 16:04                7187
language.oop5.basic.php                            24-May-2024 16:04               51281
language.oop5.changelog.php                        24-May-2024 16:04               15849
language.oop5.cloning.php                          24-May-2024 16:04                9672
language.oop5.constants.php                        24-May-2024 16:04                9253
language.oop5.decon.php                            24-May-2024 16:04               31275
language.oop5.final.php                            24-May-2024 16:04                6146
language.oop5.inheritance.php                      24-May-2024 16:04               14464
language.oop5.interfaces.php                       24-May-2024 16:04               24582
language.oop5.iterations.php                       24-May-2024 16:04                6039
language.oop5.late-static-bindings.php             24-May-2024 16:04               15282
language.oop5.magic.php                            24-May-2024 16:04               45606
language.oop5.object-comparison.php                24-May-2024 16:04                9183
language.oop5.overloading.php                      24-May-2024 16:04               25633
language.oop5.paamayim-nekudotayim.php             24-May-2024 16:04                9018
language.oop5.php                                  24-May-2024 16:04                3585
language.oop5.properties.php                       24-May-2024 16:04               28619
language.oop5.references.php                       24-May-2024 16:04                6117
language.oop5.serialization.php                    24-May-2024 16:04                7645
language.oop5.static.php                           24-May-2024 16:04                9816
language.oop5.traits.php                           24-May-2024 16:04               36251
language.oop5.variance.php                         24-May-2024 16:04               16262
language.oop5.visibility.php                       24-May-2024 16:04               25312
language.operators.arithmetic.php                  24-May-2024 16:04                5783
language.operators.array.php                       24-May-2024 16:04                9010
language.operators.assignment.php                  24-May-2024 16:04               11429
language.operators.bitwise.php                     24-May-2024 16:04               43765
language.operators.comparison.php                  24-May-2024 16:04               42949
language.operators.errorcontrol.php                24-May-2024 16:04                6339
language.operators.execution.php                   24-May-2024 16:04                3486
language.operators.increment.php                   24-May-2024 16:04               15003
language.operators.logical.php                     24-May-2024 16:04                8146
language.operators.php                             24-May-2024 16:04                4085
language.operators.precedence.php                  24-May-2024 16:04               20913
language.operators.string.php                      24-May-2024 16:04                3065
language.operators.type.php                        24-May-2024 16:04               18661
language.references.arent.php                      24-May-2024 16:04                3550
language.references.pass.php                       24-May-2024 16:04                7022
language.references.php                            24-May-2024 16:04                2080
language.references.return.php                     24-May-2024 16:04                7526
language.references.spot.php                       24-May-2024 16:04                2802
language.references.unset.php                      24-May-2024 16:04                2427
language.references.whatare.php                    24-May-2024 16:04                2432
language.references.whatdo.php                     24-May-2024 16:04               19377
language.types.array.php                           24-May-2024 16:04              103746
language.types.boolean.php                         24-May-2024 16:04                9813
language.types.callable.php                        24-May-2024 16:04               12215
language.types.declarations.php                    24-May-2024 16:04               45592
language.types.enumerations.php                    24-May-2024 16:04                3792
language.types.float.php                           24-May-2024 16:04               10279
language.types.integer.php                         24-May-2024 16:04               20805
language.types.intro.php                           24-May-2024 16:04                8618
language.types.iterable.php                        24-May-2024 16:04                3086
language.types.mixed.php                           24-May-2024 16:04                1855
language.types.never.php                           24-May-2024 16:04                2169
language.types.null.php                            24-May-2024 16:04                3750
language.types.numeric-strings.php                 24-May-2024 16:04               11166
language.types.object.php                          24-May-2024 16:04                5617
language.types.php                                 24-May-2024 16:04                2856
language.types.relative-class-types.php            24-May-2024 16:04                2225
language.types.resource.php                        24-May-2024 16:04                3416
language.types.string.php                          24-May-2024 16:04               83350
language.types.type-juggling.php                   24-May-2024 16:04               27902
language.types.type-system.php                     24-May-2024 16:04                8885
language.types.value.php                           24-May-2024 16:04                2382
language.types.void.php                            24-May-2024 16:04                2090
language.variables.basics.php                      24-May-2024 16:04               14521
language.variables.external.php                    24-May-2024 16:04               18627
language.variables.php                             24-May-2024 16:04                1756
language.variables.predefined.php                  24-May-2024 16:04                3198
language.variables.scope.php                       24-May-2024 16:04               29161
language.variables.superglobals.php                24-May-2024 16:04                4581
language.variables.variable.php                    24-May-2024 16:04               10503
ldap.configuration.php                             24-May-2024 16:05                2440
ldap.constants.php                                 24-May-2024 16:05               34249
ldap.controls.php                                  24-May-2024 16:05               11178
ldap.examples-basic.php                            24-May-2024 16:05                8284
ldap.examples-controls.php                         24-May-2024 16:05               16309
ldap.examples.php                                  24-May-2024 16:05                1463
ldap.installation.php                              24-May-2024 16:05                3340
ldap.requirements.php                              24-May-2024 16:05                1656
ldap.resources.php                                 24-May-2024 16:05                1555
ldap.setup.php                                     24-May-2024 16:05                1601
ldap.using.php                                     24-May-2024 16:05                2509
libxml.configuration.php                           24-May-2024 16:05                1272
libxml.constants.php                               24-May-2024 16:05               14248
libxml.installation.php                            24-May-2024 16:05                2139
libxml.installation_old.php                        24-May-2024 16:05                2786
libxml.requirements.php                            24-May-2024 16:05                1450
libxml.resources.php                               24-May-2024 16:05                1218
libxml.setup.php                                   24-May-2024 16:05                1745
limititerator.construct.php                        24-May-2024 16:05                7534
limititerator.current.php                          24-May-2024 16:05                3620
limititerator.getposition.php                      24-May-2024 16:05                5794
limititerator.key.php                              24-May-2024 16:05                3638
limititerator.next.php                             24-May-2024 16:05                3403
limititerator.rewind.php                           24-May-2024 16:05                3583
limititerator.seek.php                             24-May-2024 16:05                4260
limititerator.valid.php                            24-May-2024 16:05                3653
locale.acceptfromhttp.php                          24-May-2024 16:04                6255
locale.canonicalize.php                            24-May-2024 16:04                3283
locale.composelocale.php                           24-May-2024 16:04               13752
locale.filtermatches.php                           24-May-2024 16:04                9467
locale.getallvariants.php                          24-May-2024 16:04                6713
locale.getdefault.php                              24-May-2024 16:04                6009
locale.getdisplaylanguage.php                      24-May-2024 16:04               10000
locale.getdisplayname.php                          24-May-2024 16:04               11773
locale.getdisplayregion.php                        24-May-2024 16:04                9956
locale.getdisplayscript.php                        24-May-2024 16:04                9963
locale.getdisplayvariant.php                       24-May-2024 16:04               10006
locale.getkeywords.php                             24-May-2024 16:04                7303
locale.getprimarylanguage.php                      24-May-2024 16:04                6178
locale.getregion.php                               24-May-2024 16:04                6176
locale.getscript.php                               24-May-2024 16:04                5800
locale.lookup.php                                  24-May-2024 16:04               10274
locale.parselocale.php                             24-May-2024 16:04                7542
locale.setdefault.php                              24-May-2024 16:04                5492
lua.assign.php                                     24-May-2024 16:04                4706
lua.call.php                                       24-May-2024 16:04                7621
lua.configuration.php                              24-May-2024 16:04                1222
lua.construct.php                                  24-May-2024 16:04                2470
lua.eval.php                                       24-May-2024 16:04                3904
lua.getversion.php                                 24-May-2024 16:04                2358
lua.include.php                                    24-May-2024 16:04                2866
lua.installation.php                               24-May-2024 16:04                2173
lua.registercallback.php                           24-May-2024 16:04                4671
lua.requirements.php                               24-May-2024 16:04                1382
lua.resources.php                                  24-May-2024 16:04                1204
lua.setup.php                                      24-May-2024 16:04                1557
luaclosure.invoke.php                              24-May-2024 16:04                4180
luasandbox.callfunction.php                        24-May-2024 16:04                5077
luasandbox.configuration.php                       24-May-2024 16:04                1271
luasandbox.disableprofiler.php                     24-May-2024 16:04                2898
luasandbox.enableprofiler.php                      24-May-2024 16:04                3518
luasandbox.examples-basic.php                      24-May-2024 16:04                6634
luasandbox.examples.php                            24-May-2024 16:04                1483
luasandbox.getcpuusage.php                         24-May-2024 16:04                3650
luasandbox.getmemoryusage.php                      24-May-2024 16:04                3228
luasandbox.getpeakmemoryusage.php                  24-May-2024 16:04                3278
luasandbox.getprofilerfunctionreport.php           24-May-2024 16:04                6010
luasandbox.getversioninfo.php                      24-May-2024 16:04                3145
luasandbox.installation.php                        24-May-2024 16:04                2267
luasandbox.loadbinary.php                          24-May-2024 16:04                3647
luasandbox.loadstring.php                          24-May-2024 16:04                5638
luasandbox.pauseusagetimer.php                     24-May-2024 16:04                9451
luasandbox.registerlibrary.php                     24-May-2024 16:04                6635
luasandbox.requirements.php                        24-May-2024 16:04                1791
luasandbox.resources.php                           24-May-2024 16:04                1269
luasandbox.setcpulimit.php                         24-May-2024 16:04                6164
luasandbox.setmemorylimit.php                      24-May-2024 16:04                5567
luasandbox.setup.php                               24-May-2024 16:04                1648
luasandbox.unpauseusagetimer.php                   24-May-2024 16:04                3194
luasandbox.wrapphpfunction.php                     24-May-2024 16:04                4385
luasandboxfunction.call.php                        24-May-2024 16:04                8065
luasandboxfunction.construct.php                   24-May-2024 16:04                2730
luasandboxfunction.dump.php                        24-May-2024 16:05                2486
lzf.configuration.php                              24-May-2024 16:04                1222
lzf.constants.php                                  24-May-2024 16:04                1156
lzf.installation.php                               24-May-2024 16:04                2746
lzf.requirements.php                               24-May-2024 16:04                1196
lzf.resources.php                                  24-May-2024 16:04                1197
lzf.setup.php                                      24-May-2024 16:04                1579
mail.configuration.php                             24-May-2024 16:04                8589
mail.constants.php                                 24-May-2024 16:04                1175
mail.installation.php                              24-May-2024 16:04                1263
mail.requirements.php                              24-May-2024 16:04                2138
mail.resources.php                                 24-May-2024 16:04                1204
mail.setup.php                                     24-May-2024 16:04                1599
mailparse.configuration.php                        24-May-2024 16:04                2573
mailparse.constants.php                            24-May-2024 16:04                2441
mailparse.installation.php                         24-May-2024 16:04                2826
mailparse.requirements.php                         24-May-2024 16:04                1238
mailparse.resources.php                            24-May-2024 16:04                1618
mailparse.setup.php                                24-May-2024 16:04                1658
manual.php                                         24-May-2024 16:04                1308
math.configuration.php                             24-May-2024 16:04                1229
math.constants.php                                 24-May-2024 16:04                7252
math.installation.php                              24-May-2024 16:04                1263
math.requirements.php                              24-May-2024 16:04                1203
math.resources.php                                 24-May-2024 16:04                1204
math.setup.php                                     24-May-2024 16:04                1586
mbstring.configuration.php                         24-May-2024 16:04               17794
mbstring.constants.php                             24-May-2024 16:04                7664
mbstring.encodings.php                             24-May-2024 16:04               16943
mbstring.http.php                                  24-May-2024 16:04                5715
mbstring.installation.php                          24-May-2024 16:04                3969
mbstring.ja-basic.php                              24-May-2024 16:04                4429
mbstring.overload.php                              24-May-2024 16:04                7627
mbstring.php4.req.php                              24-May-2024 16:04                4564
mbstring.requirements.php                          24-May-2024 16:04                1231
mbstring.resources.php                             24-May-2024 16:04                1232
mbstring.setup.php                                 24-May-2024 16:04                1672
mbstring.supported-encodings.php                   24-May-2024 16:04                8687
mcrypt.ciphers.php                                 24-May-2024 16:04                6740
mcrypt.configuration.php                           24-May-2024 16:04                3815
mcrypt.constants.php                               24-May-2024 16:04                6924
mcrypt.installation.php                            24-May-2024 16:04                1974
mcrypt.requirements.php                            24-May-2024 16:04                2394
mcrypt.resources.php                               24-May-2024 16:04                1327
mcrypt.setup.php                                   24-May-2024 16:04                1627
memcache.add.php                                   24-May-2024 16:05                7569
memcache.addserver.php                             24-May-2024 16:05               15691
memcache.close.php                                 24-May-2024 16:05                5443
memcache.connect.php                               24-May-2024 16:05                8058
memcache.constants.php                             24-May-2024 16:05                5435
memcache.decrement.php                             24-May-2024 16:05                7537
memcache.delete.php                                24-May-2024 16:05                6815
memcache.examples-overview.php                     24-May-2024 16:05                6673
memcache.examples.php                              24-May-2024 16:05                1430
memcache.flush.php                                 24-May-2024 16:05                4852
memcache.get.php                                   24-May-2024 16:05                9205
memcache.getextendedstats.php                      24-May-2024 16:05                8581
memcache.getserverstatus.php                       24-May-2024 16:05                6463
memcache.getstats.php                              24-May-2024 16:05                5148
memcache.getversion.php                            24-May-2024 16:05                5226
memcache.increment.php                             24-May-2024 16:05                7328
memcache.ini.php                                   24-May-2024 16:05               11493
memcache.installation.php                          24-May-2024 16:05                2411
memcache.pconnect.php                              24-May-2024 16:05                6757
memcache.replace.php                               24-May-2024 16:05                7658
memcache.requirements.php                          24-May-2024 16:05                1489
memcache.resources.php                             24-May-2024 16:05                1327
memcache.set.php                                   24-May-2024 16:05               10492
memcache.setcompressthreshold.php                  24-May-2024 16:05                6181
memcache.setserverparams.php                       24-May-2024 16:05               12031
memcache.setup.php                                 24-May-2024 16:05                1640
memcached.add.php                                  24-May-2024 16:05                4822
memcached.addbykey.php                             24-May-2024 16:05                5904
memcached.addserver.php                            24-May-2024 16:05                8387
memcached.addservers.php                           24-May-2024 16:05                5720
memcached.append.php                               24-May-2024 16:05                7756
memcached.appendbykey.php                          24-May-2024 16:05                5450
memcached.callbacks.php                            24-May-2024 16:05                1586
memcached.callbacks.read-through.php               24-May-2024 16:05                4758
memcached.callbacks.result.php                     24-May-2024 16:05                5091
memcached.cas.php                                  24-May-2024 16:05                9980
memcached.casbykey.php                             24-May-2024 16:05                6233
memcached.configuration.php                        24-May-2024 16:05               32814
memcached.constants.php                            24-May-2024 16:05               32897
memcached.construct.php                            24-May-2024 16:05                5953
memcached.decrement.php                            24-May-2024 16:05                9272
memcached.decrementbykey.php                       24-May-2024 16:05                6175
memcached.delete.php                               24-May-2024 16:05                5840
memcached.deletebykey.php                          24-May-2024 16:05                5924
memcached.deletemulti.php                          24-May-2024 16:05                5136
memcached.deletemultibykey.php                     24-May-2024 16:05                6199
memcached.expiration.php                           24-May-2024 16:05                2121
memcached.fetch.php                                24-May-2024 16:05                6881
memcached.fetchall.php                             24-May-2024 16:05                6668
memcached.flush.php                                24-May-2024 16:05                4965
memcached.get.php                                  24-May-2024 16:05               10860
memcached.getallkeys.php                           24-May-2024 16:05                3359
memcached.getbykey.php                             24-May-2024 16:05                6955
memcached.getdelayed.php                           24-May-2024 16:05                9155
memcached.getdelayedbykey.php                      24-May-2024 16:05                6081
memcached.getmulti.php                             24-May-2024 16:05               21347
memcached.getmultibykey.php                        24-May-2024 16:05                6010
memcached.getoption.php                            24-May-2024 16:05                5326
memcached.getresultcode.php                        24-May-2024 16:05                4343
memcached.getresultmessage.php                     24-May-2024 16:05                4836
memcached.getserverbykey.php                       24-May-2024 16:05                7634
memcached.getserverlist.php                        24-May-2024 16:05                4718
memcached.getstats.php                             24-May-2024 16:05                5915
memcached.getversion.php                           24-May-2024 16:05                4194
memcached.increment.php                            24-May-2024 16:05                8587
memcached.incrementbykey.php                       24-May-2024 16:05                6093
memcached.installation.php                         24-May-2024 16:05                3190
memcached.ispersistent.php                         24-May-2024 16:05                3148
memcached.ispristine.php                           24-May-2024 16:05                3111
memcached.prepend.php                              24-May-2024 16:05                7825
memcached.prependbykey.php                         24-May-2024 16:05                5517
memcached.quit.php                                 24-May-2024 16:05                2534
memcached.replace.php                              24-May-2024 16:05                4875
memcached.replacebykey.php                         24-May-2024 16:05                5981
memcached.requirements.php                         24-May-2024 16:05                1695
memcached.resetserverlist.php                      24-May-2024 16:05                3332
memcached.resources.php                            24-May-2024 16:05                1239
memcached.sessions.php                             24-May-2024 16:05                2873
memcached.set.php                                  24-May-2024 16:05                9510
memcached.setbykey.php                             24-May-2024 16:05                7311
memcached.setmulti.php                             24-May-2024 16:05                6469
memcached.setmultibykey.php                        24-May-2024 16:05                5257
memcached.setoption.php                            24-May-2024 16:05                7650
memcached.setoptions.php                           24-May-2024 16:05                7148
memcached.setsaslauthdata.php                      24-May-2024 16:05                3662
memcached.setup.php                                24-May-2024 16:05                1657
memcached.touch.php                                24-May-2024 16:05                3927
memcached.touchbykey.php                           24-May-2024 16:05                4934
messageformatter.create.php                        24-May-2024 16:04               11253
messageformatter.format.php                        24-May-2024 16:04                9997
messageformatter.formatmessage.php                 24-May-2024 16:04               14620
messageformatter.geterrorcode.php                  24-May-2024 16:04                3851
messageformatter.geterrormessage.php               24-May-2024 16:04                7756
messageformatter.getlocale.php                     24-May-2024 16:04                5588
messageformatter.getpattern.php                    24-May-2024 16:04               10176
messageformatter.parse.php                         24-May-2024 16:04                9684
messageformatter.parsemessage.php                  24-May-2024 16:04               10147
messageformatter.setpattern.php                    24-May-2024 16:04               10763
mhash.configuration.php                            24-May-2024 16:04                1236
mhash.constants.php                                24-May-2024 16:04                7352
mhash.examples.php                                 24-May-2024 16:04                3335
mhash.installation.php                             24-May-2024 16:04                1867
mhash.requirements.php                             24-May-2024 16:04                1439
mhash.resources.php                                24-May-2024 16:04                1211
mhash.setup.php                                    24-May-2024 16:04                1605
migration56.changed-functions.php                  24-May-2024 16:05                7507
migration56.constants.php                          24-May-2024 16:05                6847
migration56.deprecated.php                         24-May-2024 16:05                6682
migration56.extensions.php                         24-May-2024 16:05                4764
migration56.incompatible.php                       24-May-2024 16:05                9694
migration56.new-features.php                       24-May-2024 16:05               30281
migration56.new-functions.php                      24-May-2024 16:05                7585
migration56.openssl.php                            24-May-2024 16:05               28973
migration56.php                                    24-May-2024 16:05                2609
migration70.changed-functions.php                  24-May-2024 16:05                5799
migration70.classes.php                            24-May-2024 16:05                4011
migration70.constants.php                          24-May-2024 16:05                9582
migration70.deprecated.php                         24-May-2024 16:05                6124
migration70.incompatible.php                       24-May-2024 16:05               67354
migration70.new-features.php                       24-May-2024 16:05               43822
migration70.new-functions.php                      24-May-2024 16:05                7464
migration70.other-changes.php                      24-May-2024 16:05                3897
migration70.php                                    24-May-2024 16:05                3104
migration70.removed-exts-sapis.php                 24-May-2024 16:05                3271
migration70.sapi-changes.php                       24-May-2024 16:05                2340
migration71.changed-functions.php                  24-May-2024 16:05                8288
migration71.constants.php                          24-May-2024 16:05                8858
migration71.deprecated.php                         24-May-2024 16:05                2445
migration71.incompatible.php                       24-May-2024 16:05               36414
migration71.new-features.php                       24-May-2024 16:05               28736
migration71.new-functions.php                      24-May-2024 16:05                5105
migration71.other-changes.php                      24-May-2024 16:05                9793
migration71.php                                    24-May-2024 16:05                2623
migration71.windows-support.php                    24-May-2024 16:05                9344
migration72.constants.php                          24-May-2024 16:05               32044
migration72.deprecated.php                         24-May-2024 16:05               11421
migration72.incompatible.php                       24-May-2024 16:05               22086
migration72.new-features.php                       24-May-2024 16:05               20527
migration72.new-functions.php                      24-May-2024 16:05               24460
migration72.other-changes.php                      24-May-2024 16:05                6467
migration72.php                                    24-May-2024 16:05                2507
migration73.constants.php                          24-May-2024 16:05               26187
migration73.deprecated.php                         24-May-2024 16:05                9455
migration73.incompatible.php                       24-May-2024 16:05               20801
migration73.new-features.php                       24-May-2024 16:05               19065
migration73.new-functions.php                      24-May-2024 16:05                7473
migration73.other-changes.php                      24-May-2024 16:05               18681
migration73.php                                    24-May-2024 16:05                2649
migration73.windows-support.php                    24-May-2024 16:05                2244
migration74.constants.php                          24-May-2024 16:05                7873
migration74.deprecated.php                         24-May-2024 16:05               17037
migration74.incompatible.php                       24-May-2024 16:05               21265
migration74.new-classes.php                        24-May-2024 16:05                1595
migration74.new-features.php                       24-May-2024 16:05               24063
migration74.new-functions.php                      24-May-2024 16:05                3838
migration74.other-changes.php                      24-May-2024 16:05               23953
migration74.php                                    24-May-2024 16:05                2902
migration74.removed-extensions.php                 24-May-2024 16:05                2077
migration74.windows-support.php                    24-May-2024 16:05                4445
migration80.deprecated.php                         24-May-2024 16:05               20340
migration80.incompatible.php                       24-May-2024 16:05              113183
migration80.new-features.php                       24-May-2024 16:05               36488
migration80.other-changes.php                      24-May-2024 16:05               16977
migration80.php                                    24-May-2024 16:05                2489
migration81.constants.php                          24-May-2024 16:05                8467
migration81.deprecated.php                         24-May-2024 16:05               21589
migration81.incompatible.php                       24-May-2024 16:05               27146
migration81.new-classes.php                        24-May-2024 16:05                2242
migration81.new-features.php                       24-May-2024 16:05               26804
migration81.new-functions.php                      24-May-2024 16:05                8623
migration81.other-changes.php                      24-May-2024 16:05               11941
migration81.php                                    24-May-2024 16:05                2788
migration82.constants.php                          24-May-2024 16:05               22281
migration82.deprecated.php                         24-May-2024 16:05                6937
migration82.incompatible.php                       24-May-2024 16:05               11035
migration82.new-features.php                       24-May-2024 16:05                8444
migration82.new-functions.php                      24-May-2024 16:05                4385
migration82.other-changes.php                      24-May-2024 16:05               27823
migration82.php                                    24-May-2024 16:05                2823
migration82.windows-support.php                    24-May-2024 16:05                2612
migration83.constants.php                          24-May-2024 16:05               15631
migration83.deprecated.php                         24-May-2024 16:05                8599
migration83.incompatible.php                       24-May-2024 16:05               17306
migration83.new-classes.php                        24-May-2024 16:05                3483
migration83.new-features.php                       24-May-2024 16:05                8501
migration83.new-functions.php                      24-May-2024 16:05                7442
migration83.other-changes.php                      24-May-2024 16:05               37771
migration83.php                                    24-May-2024 16:05                2960
migration83.windows-support.php                    24-May-2024 16:05                1497
misc.configuration.php                             24-May-2024 16:05                6175
misc.constants.php                                 24-May-2024 16:05                2667
misc.installation.php                              24-May-2024 16:05                1263
misc.requirements.php                              24-May-2024 16:05                1203
misc.resources.php                                 24-May-2024 16:05                1204
misc.setup.php                                     24-May-2024 16:05                1582
mongodb-bson-binary.construct.php                  24-May-2024 16:04                7976
mongodb-bson-binary.getdata.php                    24-May-2024 16:04                4459
mongodb-bson-binary.gettype.php                    24-May-2024 16:04                4441
mongodb-bson-binary.jsonserialize.php              24-May-2024 16:04                5435
mongodb-bson-binary.serialize.php                  24-May-2024 16:04                3521
mongodb-bson-binary.tostring.php                   24-May-2024 16:04                4279
mongodb-bson-binary.unserialize.php                24-May-2024 16:04                4333
mongodb-bson-binaryinterface.getdata.php           24-May-2024 16:04                2881
mongodb-bson-binaryinterface.gettype.php           24-May-2024 16:04                2891
mongodb-bson-binaryinterface.tostring.php          24-May-2024 16:04                3382
mongodb-bson-dbpointer.construct.php               24-May-2024 16:04                2712
mongodb-bson-dbpointer.jsonserialize.php           24-May-2024 16:04                5504
mongodb-bson-dbpointer.serialize.php               24-May-2024 16:04                3596
mongodb-bson-dbpointer.tostring.php                24-May-2024 16:04                2723
mongodb-bson-dbpointer.unserialize.php             24-May-2024 16:04                3832
mongodb-bson-decimal128.construct.php              24-May-2024 16:04                5823
mongodb-bson-decimal128.jsonserialize.php          24-May-2024 16:04                5525
mongodb-bson-decimal128.serialize.php              24-May-2024 16:04                3621
mongodb-bson-decimal128.tostring.php               24-May-2024 16:04                4600
mongodb-bson-decimal128.unserialize.php            24-May-2024 16:04                4425
mongodb-bson-decimal128interface.tostring.php      24-May-2024 16:04                3044
mongodb-bson-document.construct.php                24-May-2024 16:04                3326
mongodb-bson-document.frombson.php                 24-May-2024 16:04                4080
mongodb-bson-document.fromjson.php                 24-May-2024 16:04                4593
mongodb-bson-document.fromphp.php                  24-May-2024 16:04                4315
mongodb-bson-document.get.php                      24-May-2024 16:04                4281
mongodb-bson-document.getiterator.php              24-May-2024 16:04                3563
mongodb-bson-document.has.php                      24-May-2024 16:04                3805
mongodb-bson-document.serialize.php                24-May-2024 16:04                3585
mongodb-bson-document.tocanonicalextendedjson.php  24-May-2024 16:04               12773
mongodb-bson-document.tophp.php                    24-May-2024 16:04                5459
mongodb-bson-document.torelaxedextendedjson.php    24-May-2024 16:04               12490
mongodb-bson-document.tostring.php                 24-May-2024 16:04                2797
mongodb-bson-document.unserialize.php              24-May-2024 16:04                4381
mongodb-bson-int64.construct.php                   24-May-2024 16:04                4796
mongodb-bson-int64.jsonserialize.php               24-May-2024 16:04                5179
mongodb-bson-int64.serialize.php                   24-May-2024 16:04                3498
mongodb-bson-int64.tostring.php                    24-May-2024 16:04                3918
mongodb-bson-int64.unserialize.php                 24-May-2024 16:04                4304
mongodb-bson-iterator.construct.php                24-May-2024 16:04                3414
mongodb-bson-iterator.current.php                  24-May-2024 16:04                3656
mongodb-bson-iterator.key.php                      24-May-2024 16:04                3649
mongodb-bson-iterator.next.php                     24-May-2024 16:04                2438
mongodb-bson-iterator.rewind.php                   24-May-2024 16:04                2493
mongodb-bson-iterator.valid.php                    24-May-2024 16:04                2870
mongodb-bson-javascript.construct.php              24-May-2024 16:04                7287
mongodb-bson-javascript.getcode.php                24-May-2024 16:04                4431
mongodb-bson-javascript.getscope.php               24-May-2024 16:04                5407
mongodb-bson-javascript.jsonserialize.php          24-May-2024 16:04                5521
mongodb-bson-javascript.serialize.php              24-May-2024 16:04                3621
mongodb-bson-javascript.tostring.php               24-May-2024 16:04                4273
mongodb-bson-javascript.unserialize.php            24-May-2024 16:04                4417
mongodb-bson-javascriptinterface.getcode.php       24-May-2024 16:04                2975
mongodb-bson-javascriptinterface.getscope.php      24-May-2024 16:04                3140
mongodb-bson-javascriptinterface.tostring.php      24-May-2024 16:04                3480
mongodb-bson-maxkey.construct.php                  24-May-2024 16:04                3692
mongodb-bson-maxkey.jsonserialize.php              24-May-2024 16:04                5441
mongodb-bson-maxkey.serialize.php                  24-May-2024 16:04                3525
mongodb-bson-maxkey.unserialize.php                24-May-2024 16:04                3765
mongodb-bson-minkey.construct.php                  24-May-2024 16:04                3692
mongodb-bson-minkey.jsonserialize.php              24-May-2024 16:04                5441
mongodb-bson-minkey.serialize.php                  24-May-2024 16:04                3525
mongodb-bson-minkey.unserialize.php                24-May-2024 16:04                3769
mongodb-bson-objectid.construct.php                24-May-2024 16:04                5311
mongodb-bson-objectid.gettimestamp.php             24-May-2024 16:04                5544
mongodb-bson-objectid.jsonserialize.php            24-May-2024 16:04                5487
mongodb-bson-objectid.serialize.php                24-May-2024 16:04                3573
mongodb-bson-objectid.tostring.php                 24-May-2024 16:04                4246
mongodb-bson-objectid.unserialize.php              24-May-2024 16:04                4371
mongodb-bson-objectidinterface.gettimestamp.php    24-May-2024 16:04                3044
mongodb-bson-objectidinterface.tostring.php        24-May-2024 16:04                3028
mongodb-bson-packedarray.construct.php             24-May-2024 16:04                2946
mongodb-bson-packedarray.fromphp.php               24-May-2024 16:04                3996
mongodb-bson-packedarray.get.php                   24-May-2024 16:04                4332
mongodb-bson-packedarray.getiterator.php           24-May-2024 16:04                3617
mongodb-bson-packedarray.has.php                   24-May-2024 16:04                3859
mongodb-bson-packedarray.serialize.php             24-May-2024 16:04                3617
mongodb-bson-packedarray.tophp.php                 24-May-2024 16:04                4678
mongodb-bson-packedarray.tostring.php              24-May-2024 16:04                2813
mongodb-bson-packedarray.unserialize.php           24-May-2024 16:04                4437
mongodb-bson-persistable.bsonserialize.php         24-May-2024 16:04                6186
mongodb-bson-regex.construct.php                   24-May-2024 16:04                7050
mongodb-bson-regex.getflags.php                    24-May-2024 16:04                4557
mongodb-bson-regex.getpattern.php                  24-May-2024 16:04                4419
mongodb-bson-regex.jsonserialize.php               24-May-2024 16:04                5420
mongodb-bson-regex.serialize.php                   24-May-2024 16:04                3496
mongodb-bson-regex.tostring.php                    24-May-2024 16:04                3938
mongodb-bson-regex.unserialize.php                 24-May-2024 16:04                4308
mongodb-bson-regexinterface.getflags.php           24-May-2024 16:04                2880
mongodb-bson-regexinterface.getpattern.php         24-May-2024 16:04                2923
mongodb-bson-regexinterface.tostring.php           24-May-2024 16:04                2954
mongodb-bson-serializable.bsonserialize.php        24-May-2024 16:04               16661
mongodb-bson-symbol.construct.php                  24-May-2024 16:04                2652
mongodb-bson-symbol.jsonserialize.php              24-May-2024 16:04                5441
mongodb-bson-symbol.serialize.php                  24-May-2024 16:04                3521
mongodb-bson-symbol.tostring.php                   24-May-2024 16:04                2701
mongodb-bson-symbol.unserialize.php                24-May-2024 16:04                3771
mongodb-bson-timestamp.construct.php               24-May-2024 16:04                4854
mongodb-bson-timestamp.getincrement.php            24-May-2024 16:04                4347
mongodb-bson-timestamp.gettimestamp.php            24-May-2024 16:04                4332
mongodb-bson-timestamp.jsonserialize.php           24-May-2024 16:04                5508
mongodb-bson-timestamp.serialize.php               24-May-2024 16:04                3596
mongodb-bson-timestamp.tostring.php                24-May-2024 16:04                4088
mongodb-bson-timestamp.unserialize.php             24-May-2024 16:04                4404
mongodb-bson-timestampinterface.getincrement.php   24-May-2024 16:04                3407
mongodb-bson-timestampinterface.gettimestamp.php   24-May-2024 16:04                3422
mongodb-bson-timestampinterface.tostring.php       24-May-2024 16:04                3046
mongodb-bson-undefined.construct.php               24-May-2024 16:04                2712
mongodb-bson-undefined.jsonserialize.php           24-May-2024 16:04                5504
mongodb-bson-undefined.serialize.php               24-May-2024 16:04                3596
mongodb-bson-undefined.tostring.php                24-May-2024 16:04                2723
mongodb-bson-undefined.unserialize.php             24-May-2024 16:04                3833
mongodb-bson-unserializable.bsonunserialize.php    24-May-2024 16:04                7097
mongodb-bson-utcdatetime.construct.php             24-May-2024 16:04                8206
mongodb-bson-utcdatetime.jsonserialize.php         24-May-2024 16:04                5546
mongodb-bson-utcdatetime.serialize.php             24-May-2024 16:04                3648
mongodb-bson-utcdatetime.todatetime.php            24-May-2024 16:04                5888
mongodb-bson-utcdatetime.tostring.php              24-May-2024 16:04                4036
mongodb-bson-utcdatetime.unserialize.php           24-May-2024 16:04                4436
mongodb-bson-utcdatetimeinterface.todatetime.php   24-May-2024 16:04                3323
mongodb-bson-utcdatetimeinterface.tostring.php     24-May-2024 16:04                3062
mongodb-driver-bulkwrite.construct.php             24-May-2024 16:04               18690
mongodb-driver-bulkwrite.count.php                 24-May-2024 16:04                6987
mongodb-driver-bulkwrite.delete.php                24-May-2024 16:04               12054
mongodb-driver-bulkwrite.insert.php                24-May-2024 16:04                9647
mongodb-driver-bulkwrite.update.php                24-May-2024 16:04               15664
mongodb-driver-clientencryption.addkeyaltname.php  24-May-2024 16:04                5583
mongodb-driver-clientencryption.construct.php      24-May-2024 16:04               11310
mongodb-driver-clientencryption.createdatakey.php  24-May-2024 16:04               11023
mongodb-driver-clientencryption.decrypt.php        24-May-2024 16:04                4224
mongodb-driver-clientencryption.deletekey.php      24-May-2024 16:04                4331
mongodb-driver-clientencryption.encrypt.php        24-May-2024 16:04               12844
mongodb-driver-clientencryption.encryptexpressi..> 24-May-2024 16:04               14551
mongodb-driver-clientencryption.getkey.php         24-May-2024 16:04                4464
mongodb-driver-clientencryption.getkeybyaltname..> 24-May-2024 16:04                5053
mongodb-driver-clientencryption.getkeys.php        24-May-2024 16:04                3902
mongodb-driver-clientencryption.removekeyaltnam..> 24-May-2024 16:04                5648
mongodb-driver-clientencryption.rewrapmanydatak..> 24-May-2024 16:04               12199
mongodb-driver-command.construct.php               24-May-2024 16:04               14294
mongodb-driver-commandexception.getresultdocume..> 24-May-2024 16:04                3296
mongodb-driver-cursor.construct.php                24-May-2024 16:04                3386
mongodb-driver-cursor.current.php                  24-May-2024 16:04                3140
mongodb-driver-cursor.getid.php                    24-May-2024 16:04                7659
mongodb-driver-cursor.getserver.php                24-May-2024 16:04                7552
mongodb-driver-cursor.isdead.php                   24-May-2024 16:04               10668
mongodb-driver-cursor.key.php                      24-May-2024 16:04                2693
mongodb-driver-cursor.next.php                     24-May-2024 16:04                3540
mongodb-driver-cursor.rewind.php                   24-May-2024 16:04                4011
mongodb-driver-cursor.settypemap.php               24-May-2024 16:04                8004
mongodb-driver-cursor.toarray.php                  24-May-2024 16:04                7745
mongodb-driver-cursor.valid.php                    24-May-2024 16:04                2895
mongodb-driver-cursorid.construct.php              24-May-2024 16:04                2874
mongodb-driver-cursorid.serialize.php              24-May-2024 16:04                3619
mongodb-driver-cursorid.tostring.php               24-May-2024 16:04                7042
mongodb-driver-cursorid.unserialize.php            24-May-2024 16:04                4443
mongodb-driver-cursorinterface.getid.php           24-May-2024 16:04                4057
mongodb-driver-cursorinterface.getserver.php       24-May-2024 16:04                4158
mongodb-driver-cursorinterface.isdead.php          24-May-2024 16:04                4121
mongodb-driver-cursorinterface.settypemap.php      24-May-2024 16:04                4136
mongodb-driver-cursorinterface.toarray.php         24-May-2024 16:04                4020
mongodb-driver-manager.addsubscriber.php           24-May-2024 16:04                5565
mongodb-driver-manager.construct.php               24-May-2024 16:04               80117
mongodb-driver-manager.createclientencryption.php  24-May-2024 16:04               12636
mongodb-driver-manager.executebulkwrite.php        24-May-2024 16:04               23248
mongodb-driver-manager.executecommand.php          24-May-2024 16:04               25047
mongodb-driver-manager.executequery.php            24-May-2024 16:04               16547
mongodb-driver-manager.executereadcommand.php      24-May-2024 16:04               10199
mongodb-driver-manager.executereadwritecommand.php 24-May-2024 16:04               11285
mongodb-driver-manager.executewritecommand.php     24-May-2024 16:04               11374
mongodb-driver-manager.getencryptedfieldsmap.php   24-May-2024 16:04                3955
mongodb-driver-manager.getreadconcern.php          24-May-2024 16:04                5956
mongodb-driver-manager.getreadpreference.php       24-May-2024 16:04                6551
mongodb-driver-manager.getservers.php              24-May-2024 16:04                7994
mongodb-driver-manager.getwriteconcern.php         24-May-2024 16:04                6009
mongodb-driver-manager.removesubscriber.php        24-May-2024 16:04                4957
mongodb-driver-manager.selectserver.php            24-May-2024 16:04                7232
mongodb-driver-manager.startsession.php            24-May-2024 16:04               12629
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                3755
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                3682
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                3854
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                3683
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                4883
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                4074
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                4310
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                4236
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                4083
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:04                3867
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:04                4081
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:04                3791
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:04                3693
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:04                5192
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:04                4771
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:04                4527
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:04                4103
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:04                3887
mongodb-driver-monitoring-commandsubscriber.com..> 24-May-2024 16:04                4937
mongodb-driver-monitoring-commandsubscriber.com..> 24-May-2024 16:04                4987
mongodb-driver-monitoring-commandsubscriber.com..> 24-May-2024 16:04                5000
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:04                3812
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:04                3739
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:04                3923
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:04                4970
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:04                4131
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:04                4373
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:04                4741
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:04                4143
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:04                3913
mongodb-driver-monitoring-logsubscriber.log.php    24-May-2024 16:04                4667
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:04                4820
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:04                4790
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:04                5357
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:04                5402
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:04                5433
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:04                4820
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-May-2024 16:04                4895
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-May-2024 16:04                4832
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-May-2024 16:04                4815
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:04                3232
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:04                3548
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:04                3300
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:04                3625
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:04                3348
mongodb-driver-monitoring-serverclosedevent.get..> 24-May-2024 16:04                3194
mongodb-driver-monitoring-serverclosedevent.get..> 24-May-2024 16:04                3244
mongodb-driver-monitoring-serverclosedevent.get..> 24-May-2024 16:04                3304
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:04                3680
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:04                3532
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:04                3369
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:04                3398
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:04                3754
mongodb-driver-monitoring-serverheartbeatstarte..> 24-May-2024 16:04                3374
mongodb-driver-monitoring-serverheartbeatstarte..> 24-May-2024 16:04                3416
mongodb-driver-monitoring-serverheartbeatstarte..> 24-May-2024 16:04                3774
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:04                3732
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:04                3441
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:04                3450
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:04                4268
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:04                3790
mongodb-driver-monitoring-serveropeningevent.ge..> 24-May-2024 16:04                3212
mongodb-driver-monitoring-serveropeningevent.ge..> 24-May-2024 16:04                3262
mongodb-driver-monitoring-serveropeningevent.ge..> 24-May-2024 16:04                3336
mongodb-driver-monitoring-topologychangedevent...> 24-May-2024 16:04                3617
mongodb-driver-monitoring-topologychangedevent...> 24-May-2024 16:04                3695
mongodb-driver-monitoring-topologychangedevent...> 24-May-2024 16:04                3356
mongodb-driver-monitoring-topologyclosedevent.g..> 24-May-2024 16:04                3301
mongodb-driver-monitoring-topologyopeningevent...> 24-May-2024 16:04                3311
mongodb-driver-query.construct.php                 24-May-2024 16:04               32862
mongodb-driver-readconcern.bsonserialize.php       24-May-2024 16:04                6847
mongodb-driver-readconcern.construct.php           24-May-2024 16:04                5741
mongodb-driver-readconcern.getlevel.php            24-May-2024 16:04                5836
mongodb-driver-readconcern.isdefault.php           24-May-2024 16:04                8110
mongodb-driver-readconcern.serialize.php           24-May-2024 16:04                3696
mongodb-driver-readconcern.unserialize.php         24-May-2024 16:04                4494
mongodb-driver-readpreference.bsonserialize.php    24-May-2024 16:04               10499
mongodb-driver-readpreference.construct.php        24-May-2024 16:04               18473
mongodb-driver-readpreference.gethedge.php         24-May-2024 16:04                3467
mongodb-driver-readpreference.getmaxstalenessse..> 24-May-2024 16:04                8208
mongodb-driver-readpreference.getmode.php          24-May-2024 16:04                7532
mongodb-driver-readpreference.getmodestring.php    24-May-2024 16:04                7738
mongodb-driver-readpreference.gettagsets.php       24-May-2024 16:04                8093
mongodb-driver-readpreference.serialize.php        24-May-2024 16:04                3773
mongodb-driver-readpreference.unserialize.php      24-May-2024 16:04                4573
mongodb-driver-runtimeexception.haserrorlabel.php  24-May-2024 16:04                4300
mongodb-driver-server.construct.php                24-May-2024 16:04                3418
mongodb-driver-server.executebulkwrite.php         24-May-2024 16:04               11528
mongodb-driver-server.executecommand.php           24-May-2024 16:04               13362
mongodb-driver-server.executequery.php             24-May-2024 16:04                8964
mongodb-driver-server.executereadcommand.php       24-May-2024 16:04               10795
mongodb-driver-server.executereadwritecommand.php  24-May-2024 16:04               11799
mongodb-driver-server.executewritecommand.php      24-May-2024 16:04               11854
mongodb-driver-server.gethost.php                  24-May-2024 16:04                5499
mongodb-driver-server.getinfo.php                  24-May-2024 16:04               10664
mongodb-driver-server.getlatency.php               24-May-2024 16:04                7177
mongodb-driver-server.getport.php                  24-May-2024 16:04                5541
mongodb-driver-server.getserverdescription.php     24-May-2024 16:04                3472
mongodb-driver-server.gettags.php                  24-May-2024 16:04                3828
mongodb-driver-server.gettype.php                  24-May-2024 16:04                3864
mongodb-driver-server.isarbiter.php                24-May-2024 16:04                3681
mongodb-driver-server.ishidden.php                 24-May-2024 16:04                3675
mongodb-driver-server.ispassive.php                24-May-2024 16:04                3743
mongodb-driver-server.isprimary.php                24-May-2024 16:04                3688
mongodb-driver-server.issecondary.php              24-May-2024 16:04                3723
mongodb-driver-serverapi.bsonserialize.php         24-May-2024 16:04                3350
mongodb-driver-serverapi.construct.php             24-May-2024 16:04                5248
mongodb-driver-serverapi.serialize.php             24-May-2024 16:04                3649
mongodb-driver-serverapi.unserialize.php           24-May-2024 16:04                4461
mongodb-driver-serverdescription.gethellorespon..> 24-May-2024 16:04                5241
mongodb-driver-serverdescription.gethost.php       24-May-2024 16:04                3490
mongodb-driver-serverdescription.getlastupdatet..> 24-May-2024 16:04                3649
mongodb-driver-serverdescription.getport.php       24-May-2024 16:04                3545
mongodb-driver-serverdescription.getroundtripti..> 24-May-2024 16:04                3944
mongodb-driver-serverdescription.gettype.php       24-May-2024 16:04                3880
mongodb-driver-session.aborttransaction.php        24-May-2024 16:04                4245
mongodb-driver-session.advanceclustertime.php      24-May-2024 16:04                4904
mongodb-driver-session.advanceoperationtime.php    24-May-2024 16:04                4844
mongodb-driver-session.committransaction.php       24-May-2024 16:04                5601
mongodb-driver-session.construct.php               24-May-2024 16:04                2941
mongodb-driver-session.endsession.php              24-May-2024 16:04                4379
mongodb-driver-session.getclustertime.php          24-May-2024 16:04                4018
mongodb-driver-session.getlogicalsessionid.php     24-May-2024 16:04                3182
mongodb-driver-session.getoperationtime.php        24-May-2024 16:04                4098
mongodb-driver-session.getserver.php               24-May-2024 16:04                3997
mongodb-driver-session.gettransactionoptions.php   24-May-2024 16:04                3873
mongodb-driver-session.gettransactionstate.php     24-May-2024 16:04                3777
mongodb-driver-session.isdirty.php                 24-May-2024 16:04                3067
mongodb-driver-session.isintransaction.php         24-May-2024 16:04                3839
mongodb-driver-session.starttransaction.php        24-May-2024 16:04                9109
mongodb-driver-topologydescription.getservers.php  24-May-2024 16:04                3509
mongodb-driver-topologydescription.gettype.php     24-May-2024 16:04                3557
mongodb-driver-topologydescription.hasreadables..> 24-May-2024 16:04                3996
mongodb-driver-topologydescription.haswritables..> 24-May-2024 16:04                3277
mongodb-driver-writeconcern.bsonserialize.php      24-May-2024 16:04                7292
mongodb-driver-writeconcern.construct.php          24-May-2024 16:04               10543
mongodb-driver-writeconcern.getjournal.php         24-May-2024 16:04                6022
mongodb-driver-writeconcern.getw.php               24-May-2024 16:04                5312
mongodb-driver-writeconcern.getwtimeout.php        24-May-2024 16:04                5939
mongodb-driver-writeconcern.isdefault.php          24-May-2024 16:04                7897
mongodb-driver-writeconcern.serialize.php          24-May-2024 16:04                3721
mongodb-driver-writeconcern.unserialize.php        24-May-2024 16:04                4533
mongodb-driver-writeconcernerror.getcode.php       24-May-2024 16:04                6366
mongodb-driver-writeconcernerror.getinfo.php       24-May-2024 16:04                6692
mongodb-driver-writeconcernerror.getmessage.php    24-May-2024 16:04                6457
mongodb-driver-writeerror.getcode.php              24-May-2024 16:04                5715
mongodb-driver-writeerror.getindex.php             24-May-2024 16:04                6237
mongodb-driver-writeerror.getinfo.php              24-May-2024 16:04                3179
mongodb-driver-writeerror.getmessage.php           24-May-2024 16:04                5851
mongodb-driver-writeexception.getwriteresult.php   24-May-2024 16:04                7967
mongodb-driver-writeresult.getdeletedcount.php     24-May-2024 16:04                8191
mongodb-driver-writeresult.getinsertedcount.php    24-May-2024 16:04                8273
mongodb-driver-writeresult.getmatchedcount.php     24-May-2024 16:04                8836
mongodb-driver-writeresult.getmodifiedcount.php    24-May-2024 16:04                9134
mongodb-driver-writeresult.getserver.php           24-May-2024 16:04                6566
mongodb-driver-writeresult.getupsertedcount.php    24-May-2024 16:04                8362
mongodb-driver-writeresult.getupsertedids.php      24-May-2024 16:04                8854
mongodb-driver-writeresult.getwriteconcernerror..> 24-May-2024 16:04                7244
mongodb-driver-writeresult.getwriteerrors.php      24-May-2024 16:04               13075
mongodb-driver-writeresult.isacknowledged.php      24-May-2024 16:04                8219
mongodb.architecture.php                           24-May-2024 16:04                1982
mongodb.configuration.php                          24-May-2024 16:04                4005
mongodb.connection-handling.php                    24-May-2024 16:04                8740
mongodb.constants.php                              24-May-2024 16:04                2199
mongodb.exceptions.php                             24-May-2024 16:04                5209
mongodb.exceptions.tree.php                        24-May-2024 16:04                5633
mongodb.installation.homebrew.php                  24-May-2024 16:04                2047
mongodb.installation.manual.php                    24-May-2024 16:04                6170
mongodb.installation.pecl.php                      24-May-2024 16:04                5091
mongodb.installation.php                           24-May-2024 16:04                1852
mongodb.installation.windows.php                   24-May-2024 16:04                4622
mongodb.monitoring.php                             24-May-2024 16:04               19440
mongodb.overview.php                               24-May-2024 16:04                4673
mongodb.persistence.deserialization.php            24-May-2024 16:04               21840
mongodb.persistence.php                            24-May-2024 16:04                1871
mongodb.persistence.serialization.php              24-May-2024 16:04               20134
mongodb.requirements.php                           24-May-2024 16:04                3188
mongodb.security.php                               24-May-2024 16:04                1544
mongodb.security.request_injection.php             24-May-2024 16:04                3044
mongodb.security.script_injection.php              24-May-2024 16:04                9233
mongodb.setup.php                                  24-May-2024 16:04                2066
mongodb.tutorial.apm.php                           24-May-2024 16:04               18801
mongodb.tutorial.library.php                       24-May-2024 16:04               10740
mongodb.tutorial.php                               24-May-2024 16:04                1752
mqseries.configure.php                             24-May-2024 16:05                3273