Index of /pub/php/manual/zh/


../
feeds/                                             29-May-2024 02:08                   -
images/                                            29-May-2024 02:08                   -
styles/                                            29-May-2024 02:08                   -
toc/                                               29-May-2024 02:08                   -
about.formats.php                                  29-May-2024 02:08                4244
about.generate.php                                 29-May-2024 02:08                2723
about.howtohelp.php                                29-May-2024 02:08                2962
about.more.php                                     29-May-2024 02:08                1782
about.notes.php                                    29-May-2024 02:08                2237
about.php                                          29-May-2024 02:08                1880
about.phpversions.php                              29-May-2024 02:08                3029
about.prototypes.php                               29-May-2024 02:08                7303
about.translations.php                             29-May-2024 02:08                2976
aliases.php                                        29-May-2024 02:08               29689
allowdynamicproperties.construct.php               29-May-2024 02:08                2225
apache.configuration.php                           29-May-2024 02:08                4965
apache.constants.php                               29-May-2024 02:08                1165
apache.installation.php                            29-May-2024 02:08                1226
apache.requirements.php                            29-May-2024 02:08                1166
apache.resources.php                               29-May-2024 02:08                1186
apache.setup.php                                   29-May-2024 02:08                1570
apcu.configuration.php                             29-May-2024 02:08               15805
apcu.constants.php                                 29-May-2024 02:08                7343
apcu.installation.php                              29-May-2024 02:08                3166
apcu.requirements.php                              29-May-2024 02:08                1152
apcu.resources.php                                 29-May-2024 02:08                1172
apcu.setup.php                                     29-May-2024 02:08                1524
apcuiterator.construct.php                         29-May-2024 02:08                7100
apcuiterator.current.php                           29-May-2024 02:08                2967
apcuiterator.gettotalcount.php                     29-May-2024 02:08                3104
apcuiterator.gettotalhits.php                      29-May-2024 02:08                3240
apcuiterator.gettotalsize.php                      29-May-2024 02:08                2996
apcuiterator.key.php                               29-May-2024 02:08                2761
apcuiterator.next.php                              29-May-2024 02:08                3039
apcuiterator.rewind.php                            29-May-2024 02:08                2688
apcuiterator.valid.php                             29-May-2024 02:08                2907
appendices.php                                     29-May-2024 02:08               11796
appenditerator.append.php                          29-May-2024 02:08                5409
appenditerator.construct.php                       29-May-2024 02:08               10071
appenditerator.current.php                         29-May-2024 02:08                3428
appenditerator.getarrayiterator.php                29-May-2024 02:08                3062
appenditerator.getiteratorindex.php                29-May-2024 02:08                6579
appenditerator.key.php                             29-May-2024 02:08                7820
appenditerator.next.php                            29-May-2024 02:08                3327
appenditerator.rewind.php                          29-May-2024 02:08                3317
appenditerator.valid.php                           29-May-2024 02:08                3323
array.configuration.php                            29-May-2024 02:08                1222
array.constants.php                                29-May-2024 02:08               11459
array.installation.php                             29-May-2024 02:08                1201
array.requirements.php                             29-May-2024 02:08                1159
array.resources.php                                29-May-2024 02:08                1179
array.setup.php                                    29-May-2024 02:08                1533
array.sorting.php                                  29-May-2024 02:08                6833
arrayaccess.offsetexists.php                       29-May-2024 02:08                9090
arrayaccess.offsetget.php                          29-May-2024 02:08                4680
arrayaccess.offsetset.php                          29-May-2024 02:08                5075
arrayaccess.offsetunset.php                        29-May-2024 02:08                2838
arrayiterator.append.php                           29-May-2024 02:08                3474
arrayiterator.asort.php                            29-May-2024 02:08                7038
arrayiterator.construct.php                        29-May-2024 02:08                3742
arrayiterator.count.php                            29-May-2024 02:08                3184
arrayiterator.current.php                          29-May-2024 02:08                5165
arrayiterator.getarraycopy.php                     29-May-2024 02:08                3031
arrayiterator.getflags.php                         29-May-2024 02:08                3058
arrayiterator.key.php                              29-May-2024 02:08                3986
arrayiterator.ksort.php                            29-May-2024 02:08                7017
arrayiterator.natcasesort.php                      29-May-2024 02:08                4669
arrayiterator.natsort.php                          29-May-2024 02:08                4577
arrayiterator.next.php                             29-May-2024 02:08                4592
arrayiterator.offsetexists.php                     29-May-2024 02:08                3285
arrayiterator.offsetget.php                        29-May-2024 02:08                3313
arrayiterator.offsetset.php                        29-May-2024 02:08                3573
arrayiterator.offsetunset.php                      29-May-2024 02:08                3747
arrayiterator.rewind.php                           29-May-2024 02:08                4591
arrayiterator.seek.php                             29-May-2024 02:08                2572
arrayiterator.serialize.php                        29-May-2024 02:08                2826
arrayiterator.setflags.php                         29-May-2024 02:08                4112
arrayiterator.uasort.php                           29-May-2024 02:08                6229
arrayiterator.uksort.php                           29-May-2024 02:08                6148
arrayiterator.unserialize.php                      29-May-2024 02:08                3076
arrayiterator.valid.php                            29-May-2024 02:08                4666
arrayobject.append.php                             29-May-2024 02:08                5426
arrayobject.asort.php                              29-May-2024 02:08                9914
arrayobject.construct.php                          29-May-2024 02:08                6242
arrayobject.count.php                              29-May-2024 02:08                5339
arrayobject.exchangearray.php                      29-May-2024 02:08                6475
arrayobject.getarraycopy.php                       29-May-2024 02:08                5255
arrayobject.getflags.php                           29-May-2024 02:08                6076
arrayobject.getiterator.php                        29-May-2024 02:08                5249
arrayobject.getiteratorclass.php                   29-May-2024 02:08                6537
arrayobject.ksort.php                              29-May-2024 02:08                9599
arrayobject.natcasesort.php                        29-May-2024 02:08                8133
arrayobject.natsort.php                            29-May-2024 02:08                7844
arrayobject.offsetexists.php                       29-May-2024 02:08                4941
arrayobject.offsetget.php                          29-May-2024 02:08                5142
arrayobject.offsetset.php                          29-May-2024 02:08                6737
arrayobject.offsetunset.php                        29-May-2024 02:08                4239
arrayobject.serialize.php                          29-May-2024 02:08                5001
arrayobject.setflags.php                           29-May-2024 02:08                6680
arrayobject.setiteratorclass.php                   29-May-2024 02:08                5825
arrayobject.uasort.php                             29-May-2024 02:08               10718
arrayobject.uksort.php                             29-May-2024 02:08               10150
arrayobject.unserialize.php                        29-May-2024 02:08                3484
attribute.construct.php                            29-May-2024 02:08                2338
backedenum.from.php                                29-May-2024 02:08                6043
backedenum.tryfrom.php                             29-May-2024 02:08                6461
bc.configuration.php                               29-May-2024 02:08                2402
bc.constants.php                                   29-May-2024 02:08                1141
bc.installation.php                                29-May-2024 02:08                1365
bc.requirements.php                                29-May-2024 02:08                1138
bc.resources.php                                   29-May-2024 02:08                1158
bc.setup.php                                       29-May-2024 02:08                1528
book.apache.php                                    29-May-2024 02:08                3134
book.apcu.php                                      29-May-2024 02:08                4299
book.array.php                                     29-May-2024 02:08               10877
book.bc.php                                        29-May-2024 02:08                2778
book.bson.php                                      29-May-2024 02:08               25669
book.bzip2.php                                     29-May-2024 02:08                2865
book.calendar.php                                  29-May-2024 02:08                3749
book.classobj.php                                  29-May-2024 02:08                4162
book.cmark.php                                     29-May-2024 02:08                8735
book.com.php                                       29-May-2024 02:08                7964
book.componere.php                                 29-May-2024 02:08                6138
book.ctype.php                                     29-May-2024 02:08                2916
book.cubrid.php                                    29-May-2024 02:08               13795
book.curl.php                                      29-May-2024 02:08                6723
book.datetime.php                                  29-May-2024 02:08               16571
book.dba.php                                       29-May-2024 02:08                3362
book.dbase.php                                     29-May-2024 02:08                3174
book.dio.php                                       29-May-2024 02:08                2810
book.dir.php                                       29-May-2024 02:08                2927
book.dom.php                                       29-May-2024 02:08               20888
book.ds.php                                        29-May-2024 02:08               25090
book.eio.php                                       29-May-2024 02:08                7864
book.enchant.php                                   29-May-2024 02:08                5258
book.errorfunc.php                                 29-May-2024 02:08                3346
book.ev.php                                        29-May-2024 02:08               13313
book.event.php                                     29-May-2024 02:08               23020
book.exec.php                                      29-May-2024 02:08                3102
book.exif.php                                      29-May-2024 02:08                2396
book.expect.php                                    29-May-2024 02:08                2423
book.fann.php                                      29-May-2024 02:08               21803
book.fdf.php                                       29-May-2024 02:08                5570
book.ffi.php                                       29-May-2024 02:08                5578
book.fileinfo.php                                  29-May-2024 02:08                2950
book.filesystem.php                                29-May-2024 02:08                9328
book.filter.php                                    29-May-2024 02:08                3367
book.fpm.php                                       29-May-2024 02:08                1949
book.ftp.php                                       29-May-2024 02:08                5674
book.funchand.php                                  29-May-2024 02:08                3506
book.gearman.php                                   29-May-2024 02:08               14753
book.gender.php                                    29-May-2024 02:08                2543
book.geoip.php                                     29-May-2024 02:08                4152
book.gettext.php                                   29-May-2024 02:08                2869
book.gmagick.php                                   29-May-2024 02:08               22522
book.gmp.php                                       29-May-2024 02:08                6486
book.gnupg.php                                     29-May-2024 02:08                4820
book.hash.php                                      29-May-2024 02:08                4004
book.hrtime.php                                    29-May-2024 02:08                3482
book.ibase.php                                     29-May-2024 02:08               11892
book.ibm-db2.php                                   29-May-2024 02:08                8590
book.iconv.php                                     29-May-2024 02:08                3136
book.igbinary.php                                  29-May-2024 02:08                2093
book.image.php                                     29-May-2024 02:08               14854
book.imagick.php                                   29-May-2024 02:08               63634
book.imap.php                                      29-May-2024 02:08               10147
book.info.php                                      29-May-2024 02:08                7653
book.inotify.php                                   29-May-2024 02:08                2449
book.intl.php                                      29-May-2024 02:08               44952
book.json.php                                      29-May-2024 02:08                2860
book.ldap.php                                      29-May-2024 02:08                9073
book.libxml.php                                    29-May-2024 02:08                3174
book.lua.php                                       29-May-2024 02:08                2585
book.luasandbox.php                                29-May-2024 02:08                5519
book.lzf.php                                       29-May-2024 02:08                2128
book.mail.php                                      29-May-2024 02:08                2022
book.mailparse.php                                 29-May-2024 02:08                3856
book.math.php                                      29-May-2024 02:08                5092
book.mbstring.php                                  29-May-2024 02:08                9586
book.mcrypt.php                                    29-May-2024 02:08                5941
book.memcache.php                                  29-May-2024 02:08                4187
book.memcached.php                                 29-May-2024 02:08                7944
book.mhash.php                                     29-May-2024 02:08                2410
book.misc.php                                      29-May-2024 02:08                5101
book.mongodb.php                                   29-May-2024 02:08               26855
book.mqseries.php                                  29-May-2024 02:08                3126
book.mysql-xdevapi.php                             29-May-2024 02:08               28950
book.mysql.php                                     29-May-2024 02:08                7400
book.mysqli.php                                    29-May-2024 02:08               17592
book.mysqlnd.php                                   29-May-2024 02:08                2452
book.network.php                                   29-May-2024 02:08                5498
book.oauth.php                                     29-May-2024 02:08                7106
book.oci8.php                                      29-May-2024 02:08               16375
book.opcache.php                                   29-May-2024 02:08                2591
book.openal.php                                    29-May-2024 02:08                4363
book.openssl.php                                   29-May-2024 02:08               10446
book.outcontrol.php                                29-May-2024 02:08                5030
book.parallel.php                                  29-May-2024 02:08                5704
book.parle.php                                     29-May-2024 02:08                8756
book.password.php                                  29-May-2024 02:08                2513
book.pcntl.php                                     29-May-2024 02:08                4884
book.pcre.php                                      29-May-2024 02:08                3650
book.pdo.php                                       29-May-2024 02:08                7562
book.pgsql.php                                     29-May-2024 02:08               12095
book.phar.php                                      29-May-2024 02:08               15653
book.phpdbg.php                                    29-May-2024 02:08                2857
book.posix.php                                     29-May-2024 02:08                6651
book.ps.php                                        29-May-2024 02:08                9136
book.pspell.php                                    29-May-2024 02:08                4370
book.pthreads.php                                  29-May-2024 02:08                5331
book.quickhash.php                                 29-May-2024 02:08                8847
book.radius.php                                    29-May-2024 02:08                5468
book.random.php                                    29-May-2024 02:08                8952
book.rar.php                                       29-May-2024 02:08                5187
book.readline.php                                  29-May-2024 02:08                3489
book.recode.php                                    29-May-2024 02:08                2214
book.reflection.php                                29-May-2024 02:08               36575
book.rnp.php                                       29-May-2024 02:08                5984
book.rpminfo.php                                   29-May-2024 02:08                2460
book.rrd.php                                       29-May-2024 02:08                5004
book.runkit7.php                                   29-May-2024 02:08                4170
book.scoutapm.php                                  29-May-2024 02:08                2143
book.seaslog.php                                   29-May-2024 02:08                5134
book.sem.php                                       29-May-2024 02:08                4089
book.session.php                                   29-May-2024 02:08                7564
book.shmop.php                                     29-May-2024 02:08                2731
book.simdjson.php                                  29-May-2024 02:08                2611
book.simplexml.php                                 29-May-2024 02:08                5392
book.snmp.php                                      29-May-2024 02:08                5698
book.soap.php                                      29-May-2024 02:08                6031
book.sockets.php                                   29-May-2024 02:08                6874
book.sodium.php                                    29-May-2024 02:08               17243
book.solr.php                                      29-May-2024 02:08               53021
book.spl.php                                       29-May-2024 02:08                9734
book.sqlite3.php                                   29-May-2024 02:08                7013
book.sqlsrv.php                                    29-May-2024 02:08                5281
book.ssdeep.php                                    29-May-2024 02:08                2264
book.ssh2.php                                      29-May-2024 02:08                5397
book.stats.php                                     29-May-2024 02:08               11747
book.stomp.php                                     29-May-2024 02:08                4082
book.stream.php                                    29-May-2024 02:08               11604
book.strings.php                                   29-May-2024 02:08               12671
book.svm.php                                       29-May-2024 02:08                3619
book.svn.php                                       29-May-2024 02:08                7505
book.swoole.php                                    29-May-2024 02:08               37255
book.sync.php                                      29-May-2024 02:08                4707
book.taint.php                                     29-May-2024 02:08                2467
book.tcpwrap.php                                   29-May-2024 02:08                1989
book.tidy.php                                      29-May-2024 02:08                6518
book.tokenizer.php                                 29-May-2024 02:08                3062
book.trader.php                                    29-May-2024 02:08               17447
book.ui.php                                        29-May-2024 02:08               27914
book.uodbc.php                                     29-May-2024 02:08                6952
book.uopz.php                                      29-May-2024 02:08                5038
book.url.php                                       29-May-2024 02:08                2923
book.v8js.php                                      29-May-2024 02:08                3041
book.var.php                                       29-May-2024 02:08                5262
book.var_representation.php                        29-May-2024 02:08                2090
book.varnish.php                                   29-May-2024 02:08                5308
book.wddx.php                                      29-May-2024 02:08                2734
book.win32service.php                              29-May-2024 02:08                3948
book.wincache.php                                  29-May-2024 02:08                5542
book.wkhtmltox.php                                 29-May-2024 02:08                3267
book.xattr.php                                     29-May-2024 02:08                2375
book.xdiff.php                                     29-May-2024 02:08                4018
book.xhprof.php                                    29-May-2024 02:08                2414
book.xlswriter.php                                 29-May-2024 02:08                4378
book.xml.php                                       29-May-2024 02:08                5259
book.xmldiff.php                                   29-May-2024 02:08                3081
book.xmlreader.php                                 29-May-2024 02:08                4764
book.xmlrpc.php                                    29-May-2024 02:08                3620
book.xmlwriter.php                                 29-May-2024 02:08                6459
book.xsl.php                                       29-May-2024 02:08                3688
book.yac.php                                       29-May-2024 02:08                2533
book.yaconf.php                                    29-May-2024 02:08                2080
book.yaf.php                                       29-May-2024 02:08               34379
book.yaml.php                                      29-May-2024 02:08                2700
book.yar.php                                       29-May-2024 02:08                3645
book.yaz.php                                       29-May-2024 02:08                4289
book.zip.php                                       29-May-2024 02:08                9951
book.zlib.php                                      29-May-2024 02:08                4975
book.zmq.php                                       29-May-2024 02:08                5465
book.zookeeper.php                                 29-May-2024 02:08                6591
bzip2.configuration.php                            29-May-2024 02:08                1222
bzip2.constants.php                                29-May-2024 02:08                1155
bzip2.examples.php                                 29-May-2024 02:08                4063
bzip2.installation.php                             29-May-2024 02:08                1308
bzip2.requirements.php                             29-May-2024 02:08                1328
bzip2.resources.php                                29-May-2024 02:08                1233
bzip2.setup.php                                    29-May-2024 02:08                1554
cachingiterator.construct.php                      29-May-2024 02:08                2791
cachingiterator.count.php                          29-May-2024 02:08                2457
cachingiterator.current.php                        29-May-2024 02:08                2751
cachingiterator.getcache.php                       29-May-2024 02:08                5838
cachingiterator.getflags.php                       29-May-2024 02:08                2451
cachingiterator.hasnext.php                        29-May-2024 02:08                2571
cachingiterator.key.php                            29-May-2024 02:08                2162
cachingiterator.next.php                           29-May-2024 02:08                2368
cachingiterator.offsetexists.php                   29-May-2024 02:08                2928
cachingiterator.offsetget.php                      29-May-2024 02:08                2676
cachingiterator.offsetset.php                      29-May-2024 02:08                3039
cachingiterator.offsetunset.php                    29-May-2024 02:08                2712
cachingiterator.rewind.php                         29-May-2024 02:08                2384
cachingiterator.setflags.php                       29-May-2024 02:08                2744
cachingiterator.tostring.php                       29-May-2024 02:08                2589
cachingiterator.valid.php                          29-May-2024 02:08                2618
calendar.configuration.php                         29-May-2024 02:08                1243
calendar.constants.php                             29-May-2024 02:08               12570
calendar.installation.php                          29-May-2024 02:08                1409
calendar.requirements.php                          29-May-2024 02:08                1180
calendar.resources.php                             29-May-2024 02:08                1200
calendar.setup.php                                 29-May-2024 02:08                1592
callbackfilteriterator.accept.php                  29-May-2024 02:08                3568
callbackfilteriterator.construct.php               29-May-2024 02:08                3942
cc.license.php                                     29-May-2024 02:08               20752
changelog.misc.php                                 29-May-2024 02:08                1295
changelog.mysql.php                                29-May-2024 02:08                2403
changelog.mysql_xdevapi.php                        29-May-2024 02:08                2303
changelog.mysqli.php                               29-May-2024 02:08                1336
changelog.strings.php                              29-May-2024 02:08                1349
class.addressinfo.php                              29-May-2024 02:08                1750
class.allowdynamicproperties.php                   29-May-2024 02:08                4889
class.apcuiterator.php                             29-May-2024 02:08                7294
class.appenditerator.php                           29-May-2024 02:08                7843
class.argumentcounterror.php                       29-May-2024 02:08                8566
class.arithmeticerror.php                          29-May-2024 02:08                8693
class.arrayaccess.php                              29-May-2024 02:08               11732
class.arrayiterator.php                            29-May-2024 02:08               16848
class.arrayobject.php                              29-May-2024 02:08               16710
class.assertionerror.php                           29-May-2024 02:08                8469
class.attribute.php                                29-May-2024 02:08                8521
class.backedenum.php                               29-May-2024 02:08                4192
class.badfunctioncallexception.php                 29-May-2024 02:08                8566
class.badmethodcallexception.php                   29-May-2024 02:08                8566
class.cachingiterator.php                          29-May-2024 02:08               17187
class.callbackfilteriterator.php                   29-May-2024 02:08               11460
class.closedgeneratorexception.php                 29-May-2024 02:08                8702
class.closure.php                                  29-May-2024 02:08                6827
class.collator.php                                 29-May-2024 02:08               36428
class.collectable.php                              29-May-2024 02:08                2544
class.com-exception.php                            29-May-2024 02:08                8403
class.com-safearray-proxy.php                      29-May-2024 02:08                1882
class.com.php                                      29-May-2024 02:08               12495
class.commonmark-cql.php                           29-May-2024 02:08                7338
class.commonmark-interfaces-ivisitable.php         29-May-2024 02:08                2987
class.commonmark-interfaces-ivisitor.php           29-May-2024 02:08                4576
class.commonmark-node-blockquote.php               29-May-2024 02:08                8446
class.commonmark-node-bulletlist.php               29-May-2024 02:08               10606
class.commonmark-node-code.php                     29-May-2024 02:08                9440
class.commonmark-node-codeblock.php                29-May-2024 02:08               10810
class.commonmark-node-customblock.php              29-May-2024 02:08                9190
class.commonmark-node-custominline.php             29-May-2024 02:08                9170
class.commonmark-node-document.php                 29-May-2024 02:08                8398
class.commonmark-node-heading.php                  29-May-2024 02:08                9787
class.commonmark-node-htmlblock.php                29-May-2024 02:08                9498
class.commonmark-node-htmlinline.php               29-May-2024 02:08                9474
class.commonmark-node-image.php                    29-May-2024 02:08               10695
class.commonmark-node-item.php                     29-May-2024 02:08                8413
class.commonmark-node-linebreak.php                29-May-2024 02:08                8427
class.commonmark-node-link.php                     29-May-2024 02:08               10688
class.commonmark-node-orderedlist.php              29-May-2024 02:08               11572
class.commonmark-node-paragraph.php                29-May-2024 02:08                8452
class.commonmark-node-softbreak.php                29-May-2024 02:08                8445
class.commonmark-node-text-emphasis.php            29-May-2024 02:08                8474
class.commonmark-node-text-strong.php              29-May-2024 02:08                8463
class.commonmark-node-text.php                     29-May-2024 02:08                9825
class.commonmark-node-thematicbreak.php            29-May-2024 02:08                8474
class.commonmark-node.php                          29-May-2024 02:08                9351
class.commonmark-parser.php                        29-May-2024 02:08                3838
class.compersisthelper.php                         29-May-2024 02:08                7470
class.compileerror.php                             29-May-2024 02:08                8391
class.componere-abstract-definition.php            29-May-2024 02:08                4732
class.componere-definition.php                     29-May-2024 02:08               10246
class.componere-method.php                         29-May-2024 02:08                4330
class.componere-patch.php                          29-May-2024 02:08                8341
class.componere-value.php                          29-May-2024 02:08                5433
class.countable.php                                29-May-2024 02:08                2529
class.curlfile.php                                 29-May-2024 02:08                8201
class.curlhandle.php                               29-May-2024 02:08                1769
class.curlmultihandle.php                          29-May-2024 02:08                1807
class.curlsharehandle.php                          29-May-2024 02:08                1804
class.curlstringfile.php                           29-May-2024 02:08                5560
class.dateerror.php                                29-May-2024 02:08                9028
class.dateexception.php                            29-May-2024 02:08                9680
class.dateinterval.php                             29-May-2024 02:08               13622
class.dateinvalidoperationexception.php            29-May-2024 02:08                9143
class.dateinvalidtimezoneexception.php             29-May-2024 02:08                8721
class.datemalformedintervalstringexception.php     29-May-2024 02:08                8820
class.datemalformedperiodstringexception.php       29-May-2024 02:08                8802
class.datemalformedstringexception.php             29-May-2024 02:08                9101
class.dateobjecterror.php                          29-May-2024 02:08                8854
class.dateperiod.php                               29-May-2024 02:08               21973
class.daterangeerror.php                           29-May-2024 02:08                9042
class.datetime.php                                 29-May-2024 02:08               23061
class.datetimeimmutable.php                        29-May-2024 02:08               23376
class.datetimeinterface.php                        29-May-2024 02:08               20007
class.datetimezone.php                             29-May-2024 02:08               15480
class.deflatecontext.php                           29-May-2024 02:08                1823
class.directory.php                                29-May-2024 02:08                5478
class.directoryiterator.php                        29-May-2024 02:08               20003
class.divisionbyzeroerror.php                      29-May-2024 02:08                8421
class.domainexception.php                          29-May-2024 02:08                8503
class.domattr.php                                  29-May-2024 02:08               28244
class.domcdatasection.php                          29-May-2024 02:08               32104
class.domcharacterdata.php                         29-May-2024 02:08               33348
class.domchildnode.php                             29-May-2024 02:08                4227
class.domcomment.php                               29-May-2024 02:08               30771
class.domdocument.php                              29-May-2024 02:08               68167
class.domdocumentfragment.php                      29-May-2024 02:08               29112
class.domdocumenttype.php                          29-May-2024 02:08               27243
class.domelement.php                               29-May-2024 02:08               53070
class.domentity.php                                29-May-2024 02:08               27883
class.domentityreference.php                       29-May-2024 02:08               23380
class.domexception.php                             29-May-2024 02:08                9312
class.domimplementation.php                        29-May-2024 02:08                6027
class.domnamednodemap.php                          29-May-2024 02:08                7362
class.domnamespacenode.php                         29-May-2024 02:08                9404
class.domnode.php                                  29-May-2024 02:08               32466
class.domnodelist.php                              29-May-2024 02:08                5978
class.domnotation.php                              29-May-2024 02:08               23654
class.domparentnode.php                            29-May-2024 02:08                3897
class.domprocessinginstruction.php                 29-May-2024 02:08               24900
class.domtext.php                                  29-May-2024 02:08               33692
class.domxpath.php                                 29-May-2024 02:08                8680
class.dotnet.php                                   29-May-2024 02:08                6919
class.ds-collection.php                            29-May-2024 02:08                5988
class.ds-deque.php                                 29-May-2024 02:08               22087
class.ds-hashable.php                              29-May-2024 02:08                4109
class.ds-map.php                                   29-May-2024 02:08               23027
class.ds-pair.php                                  29-May-2024 02:08                4582
class.ds-priorityqueue.php                         29-May-2024 02:08                8348
class.ds-queue.php                                 29-May-2024 02:08                7830
class.ds-sequence.php                              29-May-2024 02:08               23599
class.ds-set.php                                   29-May-2024 02:08               18558
class.ds-stack.php                                 29-May-2024 02:08                7170
class.ds-vector.php                                29-May-2024 02:08               21623
class.emptyiterator.php                            29-May-2024 02:08                4065
class.enchantbroker.php                            29-May-2024 02:08                1835
class.enchantdictionary.php                        29-May-2024 02:08                1825
class.error.php                                    29-May-2024 02:08               10714
class.errorexception.php                           29-May-2024 02:08               14411
class.ev.php                                       29-May-2024 02:08               42323
class.evcheck.php                                  29-May-2024 02:08               10826
class.evchild.php                                  29-May-2024 02:08               12489
class.evembed.php                                  29-May-2024 02:08                9992
class.event.php                                    29-May-2024 02:08               18396
class.eventbase.php                                29-May-2024 02:08               14882
class.eventbuffer.php                              29-May-2024 02:08               23358
class.eventbufferevent.php                         29-May-2024 02:08               37860
class.eventconfig.php                              29-May-2024 02:08                7655
class.eventdnsbase.php                             29-May-2024 02:08               14255
class.eventexception.php                           29-May-2024 02:08                8530
class.eventhttp.php                                29-May-2024 02:08                9696
class.eventhttpconnection.php                      29-May-2024 02:08               10512
class.eventhttprequest.php                         29-May-2024 02:08               22841
class.eventlistener.php                            29-May-2024 02:08               12764
class.eventsslcontext.php                          29-May-2024 02:08               19129
class.eventutil.php                                29-May-2024 02:08               25540
class.evfork.php                                   29-May-2024 02:08                8992
class.evidle.php                                   29-May-2024 02:08                9819
class.evio.php                                     29-May-2024 02:08               12596
class.evloop.php                                   29-May-2024 02:08               31508
class.evperiodic.php                               29-May-2024 02:08               14911
class.evprepare.php                                29-May-2024 02:08               10965
class.evsignal.php                                 29-May-2024 02:08               11900
class.evstat.php                                   29-May-2024 02:08               14376
class.evtimer.php                                  29-May-2024 02:08               14289
class.evwatcher.php                                29-May-2024 02:08                9969
class.exception.php                                29-May-2024 02:08               10899
class.fannconnection.php                           29-May-2024 02:08                6454
class.ffi-cdata.php                                29-May-2024 02:08                6157
class.ffi-ctype.php                                29-May-2024 02:08               31238
class.ffi-exception.php                            29-May-2024 02:08                8216
class.ffi-parserexception.php                      29-May-2024 02:08                8271
class.ffi.php                                      29-May-2024 02:08               18172
class.fiber.php                                    29-May-2024 02:08                7586
class.fibererror.php                               29-May-2024 02:08                8109
class.filesystemiterator.php                       29-May-2024 02:08               31753
class.filteriterator.php                           29-May-2024 02:08                7277
class.finfo.php                                    29-May-2024 02:08                6209
class.ftp-connection.php                           29-May-2024 02:08                1797
class.gdfont.php                                   29-May-2024 02:08                1722
class.gdimage.php                                  29-May-2024 02:08                1717
class.gearmanclient.php                            29-May-2024 02:08               37772
class.gearmanexception.php                         29-May-2024 02:08                7214
class.gearmanjob.php                               29-May-2024 02:08                9234
class.gearmantask.php                              29-May-2024 02:08                8877
class.gearmanworker.php                            29-May-2024 02:08               13448
class.gender.php                                   29-May-2024 02:08               42211
class.generator.php                                29-May-2024 02:08                6453
class.globiterator.php                             29-May-2024 02:08               26469
class.gmagick.php                                  29-May-2024 02:08               87048
class.gmagickdraw.php                              29-May-2024 02:08               24452
class.gmagickpixel.php                             29-May-2024 02:08                5929
class.gmp.php                                      29-May-2024 02:08                4213
class.hashcontext.php                              29-May-2024 02:08                3307
class.hrtime-performancecounter.php                29-May-2024 02:08                3832
class.hrtime-stopwatch.php                         29-May-2024 02:08                7037
class.hrtime-unit.php                              29-May-2024 02:08                4408
class.imagick.php                                  29-May-2024 02:08              286369
class.imagickdraw.php                              29-May-2024 02:08               82896
class.imagickkernel.php                            29-May-2024 02:08                6544
class.imagickpixel.php                             29-May-2024 02:08               13861
class.imagickpixeliterator.php                     29-May-2024 02:08                9636
class.imap-connection.php                          29-May-2024 02:08                1800
class.infiniteiterator.php                         29-May-2024 02:08                5293
class.inflatecontext.php                           29-May-2024 02:08                1797
class.internaliterator.php                         29-May-2024 02:08                4700
class.intlbreakiterator.php                        29-May-2024 02:08               30488
class.intlcalendar.php                             29-May-2024 02:08               72212
class.intlchar.php                                 29-May-2024 02:08              473308
class.intlcodepointbreakiterator.php               29-May-2024 02:08               21522
class.intldateformatter.php                        29-May-2024 02:08               32384
class.intldatepatterngenerator.php                 29-May-2024 02:08                4748
class.intlexception.php                            29-May-2024 02:08                8627
class.intlgregoriancalendar.php                    29-May-2024 02:08               53241
class.intliterator.php                             29-May-2024 02:08                5053
class.intlpartsiterator.php                        29-May-2024 02:08                7124
class.intlrulebasedbreakiterator.php               29-May-2024 02:08               24437
class.intltimezone.php                             29-May-2024 02:08               28329
class.invalidargumentexception.php                 29-May-2024 02:08                8526
class.iterator.php                                 29-May-2024 02:08               11233
class.iteratoraggregate.php                        29-May-2024 02:08                6217
class.iteratoriterator.php                         29-May-2024 02:08                6295
class.jsonexception.php                            29-May-2024 02:08                8857
class.jsonserializable.php                         29-May-2024 02:08                2746
class.ldap-connection.php                          29-May-2024 02:08                1820
class.ldap-result-entry.php                        29-May-2024 02:08                1835
class.ldap-result.php                              29-May-2024 02:08                1812
class.lengthexception.php                          29-May-2024 02:08                8452
class.libxmlerror.php                              29-May-2024 02:08                5625
class.limititerator.php                            29-May-2024 02:08               11207
class.locale.php                                   29-May-2024 02:08               28517
class.logicexception.php                           29-May-2024 02:08                8512
class.lua.php                                      29-May-2024 02:08                7743
class.luaclosure.php                               29-May-2024 02:08                2657
class.luasandbox.php                               29-May-2024 02:08               14147
class.luasandboxerror.php                          29-May-2024 02:08               10083
class.luasandboxerrorerror.php                     29-May-2024 02:08                7629
class.luasandboxfatalerror.php                     29-May-2024 02:08                7751
class.luasandboxfunction.php                       29-May-2024 02:08                3941
class.luasandboxmemoryerror.php                    29-May-2024 02:08                7936
class.luasandboxruntimeerror.php                   29-May-2024 02:08                7771
class.luasandboxsyntaxerror.php                    29-May-2024 02:08                7633
class.luasandboxtimeouterror.php                   29-May-2024 02:08                7921
class.memcache.php                                 29-May-2024 02:08               19203
class.memcached.php                                29-May-2024 02:08               46770
class.memcachedexception.php                       29-May-2024 02:08                7505
class.messageformatter.php                         29-May-2024 02:08               12134
class.mongodb-bson-binary.php                      29-May-2024 02:08               16887
class.mongodb-bson-binaryinterface.php             29-May-2024 02:08                4723
class.mongodb-bson-dbpointer.php                   29-May-2024 02:08                6044
class.mongodb-bson-decimal128.php                  29-May-2024 02:08                7825
class.mongodb-bson-decimal128interface.php         29-May-2024 02:08                3850
class.mongodb-bson-document.php                    29-May-2024 02:08               14088
class.mongodb-bson-int64.php                       29-May-2024 02:08                7514
class.mongodb-bson-iterator.php                    29-May-2024 02:08                5006
class.mongodb-bson-javascript.php                  29-May-2024 02:08                8773
class.mongodb-bson-javascriptinterface.php         29-May-2024 02:08                4953
class.mongodb-bson-maxkey.php                      29-May-2024 02:08                5872
class.mongodb-bson-maxkeyinterface.php             29-May-2024 02:08                2232
class.mongodb-bson-minkey.php                      29-May-2024 02:08                5863
class.mongodb-bson-minkeyinterface.php             29-May-2024 02:08                2213
class.mongodb-bson-objectid.php                    29-May-2024 02:08                9235
class.mongodb-bson-objectidinterface.php           29-May-2024 02:08                4340
class.mongodb-bson-packedarray.php                 29-May-2024 02:08               11909
class.mongodb-bson-persistable.php                 29-May-2024 02:08                6160
class.mongodb-bson-regex.php                       29-May-2024 02:08                8204
class.mongodb-bson-regexinterface.php              29-May-2024 02:08                4742
class.mongodb-bson-serializable.php                29-May-2024 02:08                4240
class.mongodb-bson-symbol.php                      29-May-2024 02:08                5932
class.mongodb-bson-timestamp.php                   29-May-2024 02:08                8451
class.mongodb-bson-timestampinterface.php          29-May-2024 02:08                4900
class.mongodb-bson-type.php                        29-May-2024 02:08                2061
class.mongodb-bson-undefined.php                   29-May-2024 02:08                6020
class.mongodb-bson-unserializable.php              29-May-2024 02:08                3983
class.mongodb-bson-utcdatetime.php                 29-May-2024 02:08                8054
class.mongodb-bson-utcdatetimeinterface.php        29-May-2024 02:08                4413
class.mongodb-driver-bulkwrite.php                 29-May-2024 02:08               24111
class.mongodb-driver-clientencryption.php          29-May-2024 02:08               23454
class.mongodb-driver-command.php                   29-May-2024 02:08               14236
class.mongodb-driver-cursor.php                    29-May-2024 02:08               25796
class.mongodb-driver-cursorid.php                  29-May-2024 02:08                5563
class.mongodb-driver-cursorinterface.php           29-May-2024 02:08                6201
class.mongodb-driver-exception-authenticationex..> 29-May-2024 02:08                9183
class.mongodb-driver-exception-bulkwriteexcepti..> 29-May-2024 02:08               10037
class.mongodb-driver-exception-commandexception..> 29-May-2024 02:08               10918
class.mongodb-driver-exception-connectionexcept..> 29-May-2024 02:08                9252
class.mongodb-driver-exception-connectiontimeou..> 29-May-2024 02:08                9640
class.mongodb-driver-exception-encryptionexcept..> 29-May-2024 02:08                9186
class.mongodb-driver-exception-exception.php       29-May-2024 02:08                2227
class.mongodb-driver-exception-executiontimeout..> 29-May-2024 02:08               10287
class.mongodb-driver-exception-invalidargumente..> 29-May-2024 02:08                8212
class.mongodb-driver-exception-logicexception.php  29-May-2024 02:08                8096
class.mongodb-driver-exception-runtimeexception..> 29-May-2024 02:08               11663
class.mongodb-driver-exception-serverexception.php 29-May-2024 02:08                9263
class.mongodb-driver-exception-sslconnectionexc..> 29-May-2024 02:08                9529
class.mongodb-driver-exception-unexpectedvaluee..> 29-May-2024 02:08                8229
class.mongodb-driver-exception-writeexception.php  29-May-2024 02:08               12181
class.mongodb-driver-manager.php                   29-May-2024 02:08               21812
class.mongodb-driver-monitoring-commandfailedev..> 29-May-2024 02:08                8660
class.mongodb-driver-monitoring-commandstartede..> 29-May-2024 02:08                7583
class.mongodb-driver-monitoring-commandsubscrib..> 29-May-2024 02:08                6289
class.mongodb-driver-monitoring-commandsucceede..> 29-May-2024 02:08                8251
class.mongodb-driver-monitoring-logsubscriber.php  29-May-2024 02:08               10133
class.mongodb-driver-monitoring-sdamsubscriber.php 29-May-2024 02:08               11639
class.mongodb-driver-monitoring-serverchangedev..> 29-May-2024 02:08                5773
class.mongodb-driver-monitoring-serverclosedeve..> 29-May-2024 02:08                4420
class.mongodb-driver-monitoring-serverheartbeat..> 29-May-2024 02:08                5771
class.mongodb-driver-monitoring-serverheartbeat..> 29-May-2024 02:08                4598
class.mongodb-driver-monitoring-serverheartbeat..> 29-May-2024 02:08                5843
class.mongodb-driver-monitoring-serveropeningev..> 29-May-2024 02:08                4440
class.mongodb-driver-monitoring-subscriber.php     29-May-2024 02:08                2676
class.mongodb-driver-monitoring-topologychanged..> 29-May-2024 02:08                4768
class.mongodb-driver-monitoring-topologyclosede..> 29-May-2024 02:08                3379
class.mongodb-driver-monitoring-topologyopening..> 29-May-2024 02:08                3393
class.mongodb-driver-query.php                     29-May-2024 02:08                3452
class.mongodb-driver-readconcern.php               29-May-2024 02:08               17708
class.mongodb-driver-readpreference.php            29-May-2024 02:08               21918
class.mongodb-driver-server.php                    29-May-2024 02:08               27188
class.mongodb-driver-serverapi.php                 29-May-2024 02:08               14079
class.mongodb-driver-serverdescription.php         29-May-2024 02:08               16896
class.mongodb-driver-session.php                   29-May-2024 02:08               15555
class.mongodb-driver-topologydescription.php       29-May-2024 02:08               11660
class.mongodb-driver-writeconcern.php              29-May-2024 02:08               10303
class.mongodb-driver-writeconcernerror.php         29-May-2024 02:08                4411
class.mongodb-driver-writeerror.php                29-May-2024 02:08                4735
class.mongodb-driver-writeresult.php               29-May-2024 02:08                8713
class.multipleiterator.php                         29-May-2024 02:08               11539
class.mysql-xdevapi-baseresult.php                 29-May-2024 02:08                3076
class.mysql-xdevapi-client.php                     29-May-2024 02:08                3158
class.mysql-xdevapi-collection.php                 29-May-2024 02:08               10826
class.mysql-xdevapi-collectionadd.php              29-May-2024 02:08                2977
class.mysql-xdevapi-collectionfind.php             29-May-2024 02:08                8857
class.mysql-xdevapi-collectionmodify.php           29-May-2024 02:08               10314
class.mysql-xdevapi-collectionremove.php           29-May-2024 02:08                5251
class.mysql-xdevapi-columnresult.php               29-May-2024 02:08                6801
class.mysql-xdevapi-crudoperationbindable.php      29-May-2024 02:08                3013
class.mysql-xdevapi-crudoperationlimitable.php     29-May-2024 02:08                3019
class.mysql-xdevapi-crudoperationskippable.php     29-May-2024 02:08                3030
class.mysql-xdevapi-crudoperationsortable.php      29-May-2024 02:08                3006
class.mysql-xdevapi-databaseobject.php             29-May-2024 02:08                3577
class.mysql-xdevapi-docresult.php                  29-May-2024 02:08                4079
class.mysql-xdevapi-exception.php                  29-May-2024 02:08                2243
class.mysql-xdevapi-executable.php                 29-May-2024 02:08                2655
class.mysql-xdevapi-executionstatus.php            29-May-2024 02:08                4887
class.mysql-xdevapi-expression.php                 29-May-2024 02:08                3280
class.mysql-xdevapi-result.php                     29-May-2024 02:08                4463
class.mysql-xdevapi-rowresult.php                  29-May-2024 02:08                5176
class.mysql-xdevapi-schema.php                     29-May-2024 02:08                7880
class.mysql-xdevapi-schemaobject.php               29-May-2024 02:08                2840
class.mysql-xdevapi-session.php                    29-May-2024 02:08                9740
class.mysql-xdevapi-sqlstatement.php               29-May-2024 02:08                6680
class.mysql-xdevapi-sqlstatementresult.php         29-May-2024 02:08                7358
class.mysql-xdevapi-statement.php                  29-May-2024 02:08                5050
class.mysql-xdevapi-table.php                      29-May-2024 02:08                7449
class.mysql-xdevapi-tabledelete.php                29-May-2024 02:08                5216
class.mysql-xdevapi-tableinsert.php                29-May-2024 02:08                3537
class.mysql-xdevapi-tableselect.php                29-May-2024 02:08                8361
class.mysql-xdevapi-tableupdate.php                29-May-2024 02:08                6151
class.mysql-xdevapi-warning.php                    29-May-2024 02:08                3777
class.mysqli-driver.php                            29-May-2024 02:08                7856
class.mysqli-result.php                            29-May-2024 02:08               16016
class.mysqli-sql-exception.php                     29-May-2024 02:08               10026
class.mysqli-stmt.php                              29-May-2024 02:08               18756
class.mysqli-warning.php                           29-May-2024 02:08                4398
class.mysqli.php                                   29-May-2024 02:08               45016
class.norewinditerator.php                         29-May-2024 02:08                6730
class.normalizer.php                               29-May-2024 02:08               13604
class.numberformatter.php                          29-May-2024 02:08               74524
class.oauth.php                                    29-May-2024 02:08               19981
class.oauthexception.php                           29-May-2024 02:08                8510
class.oauthprovider.php                            29-May-2024 02:08               12925
class.ocicollection.php                            29-May-2024 02:08                7134
class.ocilob.php                                   29-May-2024 02:08               15353
class.opensslasymmetrickey.php                     29-May-2024 02:08                1899
class.opensslcertificate.php                       29-May-2024 02:08                1901
class.opensslcertificatesigningrequest.php         29-May-2024 02:08                1988
class.outeriterator.php                            29-May-2024 02:08                4340
class.outofboundsexception.php                     29-May-2024 02:08                8561
class.outofrangeexception.php                      29-May-2024 02:08                8563
class.overflowexception.php                        29-May-2024 02:08                8482
class.override.php                                 29-May-2024 02:08                3992
class.parallel-channel.php                         29-May-2024 02:08                8239
class.parallel-events-event-type.php               29-May-2024 02:08                3409
class.parallel-events-event.php                    29-May-2024 02:08                3562
class.parallel-events-input.php                    29-May-2024 02:08                4787
class.parallel-events.php                          29-May-2024 02:08                7159
class.parallel-future.php                          29-May-2024 02:08                7788
class.parallel-runtime.php                         29-May-2024 02:08                6436
class.parallel-sync.php                            29-May-2024 02:08                5260
class.parentiterator.php                           29-May-2024 02:08                9618
class.parle-errorinfo.php                          29-May-2024 02:08                3879
class.parle-lexer.php                              29-May-2024 02:08               13193
class.parle-lexerexception.php                     29-May-2024 02:08                7764
class.parle-parser.php                             29-May-2024 02:08               18121
class.parle-parserexception.php                    29-May-2024 02:08                7746
class.parle-rlexer.php                             29-May-2024 02:08               15428
class.parle-rparser.php                            29-May-2024 02:08               18294
class.parle-stack.php                              29-May-2024 02:08                4836
class.parle-token.php                              29-May-2024 02:08                4934
class.parseerror.php                               29-May-2024 02:08                8932
class.pdo.php                                      29-May-2024 02:08               42638
class.pdoexception.php                             29-May-2024 02:08               10339
class.pdorow.php                                   29-May-2024 02:08                4065
class.pdostatement.php                             29-May-2024 02:08               22734
class.pgsql-connection.php                         29-May-2024 02:08                1843
class.pgsql-lob.php                                29-May-2024 02:08                1785
class.pgsql-result.php                             29-May-2024 02:08                1817
class.phar.php                                     29-May-2024 02:08               74220
class.phardata.php                                 29-May-2024 02:08               49610
class.pharexception.php                            29-May-2024 02:08                8456
class.pharfileinfo.php                             29-May-2024 02:08               21674
class.php-user-filter.php                          29-May-2024 02:08                6433
class.phptoken.php                                 29-May-2024 02:08                8755
class.pool.php                                     29-May-2024 02:08                7744
class.pspell-config.php                            29-May-2024 02:08                1819
class.pspell-dictionary.php                        29-May-2024 02:08                1856
class.quickhashinthash.php                         29-May-2024 02:08               15112
class.quickhashintset.php                          29-May-2024 02:08               12888
class.quickhashintstringhash.php                   29-May-2024 02:08               16008
class.quickhashstringinthash.php                   29-May-2024 02:08               13677
class.random-brokenrandomengineerror.php           29-May-2024 02:08                8554
class.random-cryptosafeengine.php                  29-May-2024 02:08                2500
class.random-engine-mt19937.php                    29-May-2024 02:08                5370
class.random-engine-pcgoneseq128xslrr64.php        29-May-2024 02:08                6201
class.random-engine-secure.php                     29-May-2024 02:08                3428
class.random-engine-xoshiro256starstar.php         29-May-2024 02:08                6371
class.random-engine.php                            29-May-2024 02:08                3784
class.random-randomerror.php                       29-May-2024 02:08                8478
class.random-randomexception.php                   29-May-2024 02:08                8592
class.random-randomizer.php                        29-May-2024 02:08               10581
class.rangeexception.php                           29-May-2024 02:08                8691
class.rararchive.php                               29-May-2024 02:08                7748
class.rarentry.php                                 29-May-2024 02:08               49799
class.rarexception.php                             29-May-2024 02:08                8308
class.recursivearrayiterator.php                   29-May-2024 02:08               15911
class.recursivecachingiterator.php                 29-May-2024 02:08               14127
class.recursivecallbackfilteriterator.php          29-May-2024 02:08               13202
class.recursivedirectoryiterator.php               29-May-2024 02:08               29821
class.recursivefilteriterator.php                  29-May-2024 02:08                8249
class.recursiveiterator.php                        29-May-2024 02:08                4878
class.recursiveiteratoriterator.php                29-May-2024 02:08               14641
class.recursiveregexiterator.php                   29-May-2024 02:08               14755
class.recursivetreeiterator.php                    29-May-2024 02:08               25647
class.reflection.php                               29-May-2024 02:08                3438
class.reflectionattribute.php                      29-May-2024 02:08                6243
class.reflectionclass.php                          29-May-2024 02:08               37359
class.reflectionclassconstant.php                  29-May-2024 02:08               16233
class.reflectionenum.php                           29-May-2024 02:08               31453
class.reflectionenumbackedcase.php                 29-May-2024 02:08               12929
class.reflectionenumunitcase.php                   29-May-2024 02:08               12494
class.reflectionexception.php                      29-May-2024 02:08                8409
class.reflectionextension.php                      29-May-2024 02:08               10500
class.reflectionfiber.php                          29-May-2024 02:08                5187
class.reflectionfunction.php                       29-May-2024 02:08               21185
class.reflectionfunctionabstract.php               29-May-2024 02:08               19839
class.reflectiongenerator.php                      29-May-2024 02:08                6321
class.reflectionintersectiontype.php               29-May-2024 02:08                3436
class.reflectionmethod.php                         29-May-2024 02:08               32680
class.reflectionnamedtype.php                      29-May-2024 02:08                3764
class.reflectionobject.php                         29-May-2024 02:08               29252
class.reflectionparameter.php                      29-May-2024 02:08               16379
class.reflectionproperty.php                       29-May-2024 02:08               21941
class.reflectionreference.php                      29-May-2024 02:08                4112
class.reflectiontype.php                           29-May-2024 02:08                4462
class.reflectionuniontype.php                      29-May-2024 02:08                3323
class.reflectionzendextension.php                  29-May-2024 02:08                7842
class.reflector.php                                29-May-2024 02:08                3915
class.regexiterator.php                            29-May-2024 02:08               17598
class.resourcebundle.php                           29-May-2024 02:08               10431
class.returntypewillchange.php                     29-May-2024 02:08                3028
class.rnpffi.php                                   29-May-2024 02:08                1676
class.rrdcreator.php                               29-May-2024 02:08                4509
class.rrdgraph.php                                 29-May-2024 02:08                3931
class.rrdupdater.php                               29-May-2024 02:08                3317
class.runtimeexception.php                         29-May-2024 02:08                8469
class.seaslog.php                                  29-May-2024 02:08               21963
class.seekableiterator.php                         29-May-2024 02:08               11260
class.sensitiveparameter.php                       29-May-2024 02:08                6246
class.sensitiveparametervalue.php                  29-May-2024 02:08                4931
class.serializable.php                             29-May-2024 02:08                8036
class.sessionhandler.php                           29-May-2024 02:08               25262
class.sessionhandlerinterface.php                  29-May-2024 02:08               15491
class.sessionidinterface.php                       29-May-2024 02:08                3177
class.sessionupdatetimestamphandlerinterface.php   29-May-2024 02:08                4422
class.shmop.php                                    29-May-2024 02:08                1717
class.simdjsonexception.php                        29-May-2024 02:08                5045
class.simdjsonvalueerror.php                       29-May-2024 02:08                8341
class.simplexmlelement.php                         29-May-2024 02:08               18610
class.simplexmliterator.php                        29-May-2024 02:08               16635
class.snmp.php                                     29-May-2024 02:08               28284
class.snmpexception.php                            29-May-2024 02:08                9054
class.soapclient.php                               29-May-2024 02:08               34261
class.soapfault.php                                29-May-2024 02:08               14306
class.soapheader.php                               29-May-2024 02:08                6042
class.soapparam.php                                29-May-2024 02:08                3720
class.soapserver.php                               29-May-2024 02:08                9916
class.soapvar.php                                  29-May-2024 02:08                7854
class.socket.php                                   29-May-2024 02:08                1773
class.sodiumexception.php                          29-May-2024 02:08                8397
class.solrclient.php                               29-May-2024 02:08               24722
class.solrclientexception.php                      29-May-2024 02:08                9699
class.solrcollapsefunction.php                     29-May-2024 02:08               11782
class.solrdismaxquery.php                          29-May-2024 02:08              111877
class.solrdocument.php                             29-May-2024 02:08               23435
class.solrdocumentfield.php                        29-May-2024 02:08                4647
class.solrexception.php                            29-May-2024 02:08               10077
class.solrgenericresponse.php                      29-May-2024 02:08               12639
class.solrillegalargumentexception.php             29-May-2024 02:08                9823
class.solrillegaloperationexception.php            29-May-2024 02:08                9861
class.solrinputdocument.php                        29-May-2024 02:08               19474
class.solrmissingmandatoryparameterexception.php   29-May-2024 02:08                8992
class.solrmodifiableparams.php                     29-May-2024 02:08                8975
class.solrobject.php                               29-May-2024 02:08                5847
class.solrparams.php                               29-May-2024 02:08                9126
class.solrpingresponse.php                         29-May-2024 02:08               11108
class.solrquery.php                                29-May-2024 02:08              118978
class.solrqueryresponse.php                        29-May-2024 02:08               12558
class.solrresponse.php                             29-May-2024 02:08               14306
class.solrserverexception.php                      29-May-2024 02:08                9705
class.solrupdateresponse.php                       29-May-2024 02:08               12606
class.solrutils.php                                29-May-2024 02:08                4945
class.spldoublylinkedlist.php                      29-May-2024 02:08               17361
class.splfileinfo.php                              29-May-2024 02:08               18026
class.splfileobject.php                            29-May-2024 02:08               37287
class.splfixedarray.php                            29-May-2024 02:08               19845
class.splheap.php                                  29-May-2024 02:08                7757
class.splmaxheap.php                               29-May-2024 02:08                7192
class.splminheap.php                               29-May-2024 02:08                7202
class.splobjectstorage.php                         29-May-2024 02:08               21064
class.splobserver.php                              29-May-2024 02:08                2813
class.splpriorityqueue.php                         29-May-2024 02:08               11783
class.splqueue.php                                 29-May-2024 02:08               17091
class.splstack.php                                 29-May-2024 02:08               14323
class.splsubject.php                               29-May-2024 02:08                3682
class.spltempfileobject.php                        29-May-2024 02:08               31800
class.spoofchecker.php                             29-May-2024 02:08               17579
class.sqlite3.php                                  29-May-2024 02:08               39644
class.sqlite3exception.php                         29-May-2024 02:08                8397
class.sqlite3result.php                            29-May-2024 02:08                5793
class.sqlite3stmt.php                              29-May-2024 02:08                8262
class.stdclass.php                                 29-May-2024 02:08                6399
class.stomp.php                                    29-May-2024 02:08               21668
class.stompexception.php                           29-May-2024 02:08                5864
class.stompframe.php                               29-May-2024 02:08                4346
class.streamwrapper.php                            29-May-2024 02:08               20083
class.stringable.php                               29-May-2024 02:08                8047
class.svm.php                                      29-May-2024 02:08               18449
class.svmmodel.php                                 29-May-2024 02:08                6929
class.swoole-async.php                             29-May-2024 02:08                8021
class.swoole-atomic.php                            29-May-2024 02:08                5050
class.swoole-buffer.php                            29-May-2024 02:08                7505
class.swoole-channel.php                           29-May-2024 02:08                3948
class.swoole-client.php                            29-May-2024 02:08               16496
class.swoole-connection-iterator.php               29-May-2024 02:08                7501
class.swoole-coroutine.php                         29-May-2024 02:08               18637
class.swoole-event.php                             29-May-2024 02:08                7444
class.swoole-exception.php                         29-May-2024 02:08                4560
class.swoole-http-client.php                       29-May-2024 02:08               14755
class.swoole-http-request.php                      29-May-2024 02:08                3013
class.swoole-http-response.php                     29-May-2024 02:08               10889
class.swoole-http-server.php                       29-May-2024 02:08               26414
class.swoole-lock.php                              29-May-2024 02:08                4658
class.swoole-mmap.php                              29-May-2024 02:08                3059
class.swoole-mysql-exception.php                   29-May-2024 02:08                4601
class.swoole-mysql.php                             29-May-2024 02:08                5397
class.swoole-process.php                           29-May-2024 02:08               13638
class.swoole-redis-server.php                      29-May-2024 02:08               32038
class.swoole-serialize.php                         29-May-2024 02:08                3591
class.swoole-server.php                            29-May-2024 02:08               29556
class.swoole-table.php                             29-May-2024 02:08               12688
class.swoole-timer.php                             29-May-2024 02:08                4979
class.swoole-websocket-frame.php                   29-May-2024 02:08                1939
class.swoole-websocket-server.php                  29-May-2024 02:08                7807
class.syncevent.php                                29-May-2024 02:08                4877
class.syncmutex.php                                29-May-2024 02:08                4193
class.syncreaderwriter.php                         29-May-2024 02:08                5186
class.syncsemaphore.php                            29-May-2024 02:08                4634
class.syncsharedmemory.php                         29-May-2024 02:08                5484
class.sysvmessagequeue.php                         29-May-2024 02:08                1827
class.sysvsemaphore.php                            29-May-2024 02:08                1812
class.sysvsharedmemory.php                         29-May-2024 02:08                1815
class.thread.php                                   29-May-2024 02:08               11376
class.threaded.php                                 29-May-2024 02:08                8770
class.throwable.php                                29-May-2024 02:08                7100
class.tidy.php                                     29-May-2024 02:08               18842
class.tidynode.php                                 29-May-2024 02:08               11568
class.transliterator.php                           29-May-2024 02:08               10134
class.traversable.php                              29-May-2024 02:08                4138
class.typeerror.php                                29-May-2024 02:08                9273
class.uconverter.php                               29-May-2024 02:08               40997
class.ui-area.php                                  29-May-2024 02:08               12219
class.ui-control.php                               29-May-2024 02:08                5456
class.ui-controls-box.php                          29-May-2024 02:08               10076
class.ui-controls-button.php                       29-May-2024 02:08                6655
class.ui-controls-check.php                        29-May-2024 02:08                7499
class.ui-controls-colorbutton.php                  29-May-2024 02:08                6534
class.ui-controls-combo.php                        29-May-2024 02:08                6623
class.ui-controls-editablecombo.php                29-May-2024 02:08                6735
class.ui-controls-entry.php                        29-May-2024 02:08                9609
class.ui-controls-form.php                         29-May-2024 02:08                8013
class.ui-controls-grid.php                         29-May-2024 02:08               13107
class.ui-controls-group.php                        29-May-2024 02:08                8321
class.ui-controls-label.php                        29-May-2024 02:08                6406
class.ui-controls-multilineentry.php               29-May-2024 02:08                9852
class.ui-controls-picker.php                       29-May-2024 02:08                7541
class.ui-controls-progress.php                     29-May-2024 02:08                5907
class.ui-controls-radio.php                        29-May-2024 02:08                6602
class.ui-controls-separator.php                    29-May-2024 02:08                7045
class.ui-controls-slider.php                       29-May-2024 02:08                6990
class.ui-controls-spin.php                         29-May-2024 02:08                6860
class.ui-controls-tab.php                          29-May-2024 02:08                9119
class.ui-draw-brush-gradient.php                   29-May-2024 02:08                7315
class.ui-draw-brush-lineargradient.php             29-May-2024 02:08                6569
class.ui-draw-brush-radialgradient.php             29-May-2024 02:08                6755
class.ui-draw-brush.php                            29-May-2024 02:08                4416
class.ui-draw-color.php                            29-May-2024 02:08                8546
class.ui-draw-line-cap.php                         29-May-2024 02:08                3723
class.ui-draw-line-join.php                        29-May-2024 02:08                3707
class.ui-draw-matrix.php                           29-May-2024 02:08                5606
class.ui-draw-path.php                             29-May-2024 02:08               10734
class.ui-draw-pen.php                              29-May-2024 02:08                8113
class.ui-draw-stroke.php                           29-May-2024 02:08                6864
class.ui-draw-text-font-descriptor.php             29-May-2024 02:08                6026
class.ui-draw-text-font-italic.php                 29-May-2024 02:08                4082
class.ui-draw-text-font-stretch.php                29-May-2024 02:08                8278
class.ui-draw-text-font-weight.php                 29-May-2024 02:08                8880
class.ui-draw-text-font.php                        29-May-2024 02:08                4855
class.ui-draw-text-layout.php                      29-May-2024 02:08                5265
class.ui-exception-invalidargumentexception.php    29-May-2024 02:08                7782
class.ui-exception-runtimeexception.php            29-May-2024 02:08                7705
class.ui-executor.php                              29-May-2024 02:08                5416
class.ui-key.php                                   29-May-2024 02:08               21322
class.ui-menu.php                                  29-May-2024 02:08                6274
class.ui-menuitem.php                              29-May-2024 02:08                3744
class.ui-point.php                                 29-May-2024 02:08                6273
class.ui-size.php                                  29-May-2024 02:08                6375
class.ui-window.php                                29-May-2024 02:08               13063
class.underflowexception.php                       29-May-2024 02:08                8553
class.unexpectedvalueexception.php                 29-May-2024 02:08                8710
class.unhandledmatcherror.php                      29-May-2024 02:08                8563
class.unitenum.php                                 29-May-2024 02:08                2683
class.v8js.php                                     29-May-2024 02:08                9022
class.v8jsexception.php                            29-May-2024 02:08               11319
class.valueerror.php                               29-May-2024 02:08                8440
class.variant.php                                  29-May-2024 02:08                5639
class.varnishadmin.php                             29-May-2024 02:08               11516
class.varnishlog.php                               29-May-2024 02:08               34768
class.varnishstat.php                              29-May-2024 02:08                2993
class.volatile.php                                 29-May-2024 02:08               11692
class.vtiful-kernel-excel.php                      29-May-2024 02:08               12016
class.vtiful-kernel-format.php                     29-May-2024 02:08               16051
class.weakmap.php                                  29-May-2024 02:08                9175
class.weakreference.php                            29-May-2024 02:08                5457
class.win32serviceexception.php                    29-May-2024 02:08                7804
class.wkhtmltox-image-converter.php                29-May-2024 02:08                4143
class.wkhtmltox-pdf-converter.php                  29-May-2024 02:08                4461
class.wkhtmltox-pdf-object.php                     29-May-2024 02:08                2983
class.worker.php                                   29-May-2024 02:08                8616
class.xmldiff-base.php                             29-May-2024 02:08                4099
class.xmldiff-dom.php                              29-May-2024 02:08                5058
class.xmldiff-file.php                             29-May-2024 02:08                5034
class.xmldiff-memory.php                           29-May-2024 02:08                5066
class.xmlparser.php                                29-May-2024 02:08                1794
class.xmlreader.php                                29-May-2024 02:08               40771
class.xmlwriter.php                                29-May-2024 02:08               32361
class.xsltprocessor.php                            29-May-2024 02:08               11513
class.yac.php                                      29-May-2024 02:08                9526
class.yaconf.php                                   29-May-2024 02:08                3465
class.yaf-action-abstract.php                      29-May-2024 02:08               12657
class.yaf-application.php                          29-May-2024 02:08               12586
class.yaf-bootstrap-abstract.php                   29-May-2024 02:08                5507
class.yaf-config-abstract.php                      29-May-2024 02:08                5184
class.yaf-config-ini.php                           29-May-2024 02:08               17475
class.yaf-config-simple.php                        29-May-2024 02:08               13428
class.yaf-controller-abstract.php                  29-May-2024 02:08               19075
class.yaf-dispatcher.php                           29-May-2024 02:08               20237
class.yaf-exception-dispatchfailed.php             29-May-2024 02:08                2636
class.yaf-exception-loadfailed-action.php          29-May-2024 02:08                2707
class.yaf-exception-loadfailed-controller.php      29-May-2024 02:08                2732
class.yaf-exception-loadfailed-module.php          29-May-2024 02:08                2696
class.yaf-exception-loadfailed-view.php            29-May-2024 02:08                2636
class.yaf-exception-loadfailed.php                 29-May-2024 02:08                2610
class.yaf-exception-routerfailed.php               29-May-2024 02:08                2621
class.yaf-exception-startuperror.php               29-May-2024 02:08                2619
class.yaf-exception-typeerror.php                  29-May-2024 02:08                2590
class.yaf-exception.php                            29-May-2024 02:08                8466
class.yaf-loader.php                               29-May-2024 02:08               18457
class.yaf-plugin-abstract.php                      29-May-2024 02:08               15899
class.yaf-registry.php                             29-May-2024 02:08                6340
class.yaf-request-abstract.php                     29-May-2024 02:08               23646
class.yaf-request-http.php                         29-May-2024 02:08               23080
class.yaf-request-simple.php                       29-May-2024 02:08               22659
class.yaf-response-abstract.php                    29-May-2024 02:08               11817
class.yaf-route-interface.php                      29-May-2024 02:08                3782
class.yaf-route-map.php                            29-May-2024 02:08                6400
class.yaf-route-regex.php                          29-May-2024 02:08                8350
class.yaf-route-rewrite.php                        29-May-2024 02:08                7454
class.yaf-route-simple.php                         29-May-2024 02:08                6508
class.yaf-route-static.php                         29-May-2024 02:08                4971
class.yaf-route-supervar.php                       29-May-2024 02:08                4717
class.yaf-router.php                               29-May-2024 02:08               11706
class.yaf-session.php                              29-May-2024 02:08               12619
class.yaf-view-interface.php                       29-May-2024 02:08                6012
class.yaf-view-simple.php                          29-May-2024 02:08               11313
class.yar-client-exception.php                     29-May-2024 02:08                6598
class.yar-client.php                               29-May-2024 02:08                5826
class.yar-concurrent-client.php                    29-May-2024 02:08                6634
class.yar-server-exception.php                     29-May-2024 02:08                7053
class.yar-server.php                               29-May-2024 02:08                3471
class.ziparchive.php                               29-May-2024 02:08               89912
class.zmq.php                                      29-May-2024 02:08               41070
class.zmqcontext.php                               29-May-2024 02:08                5600
class.zmqdevice.php                                29-May-2024 02:08                7049
class.zmqpoll.php                                  29-May-2024 02:08                5185
class.zmqsocket.php                                29-May-2024 02:08               11462
class.zookeeper.php                                29-May-2024 02:08               56089
class.zookeeperauthenticationexception.php         29-May-2024 02:08                7712
class.zookeeperconfig.php                          29-May-2024 02:08                6436
class.zookeeperconnectionexception.php             29-May-2024 02:08                7707
class.zookeeperexception.php                       29-May-2024 02:08                7573
class.zookeepermarshallingexception.php            29-May-2024 02:08                7728
class.zookeepernonodeexception.php                 29-May-2024 02:08                7695
class.zookeeperoperationtimeoutexception.php       29-May-2024 02:08                7738
class.zookeepersessionexception.php                29-May-2024 02:08                7649
classobj.configuration.php                         29-May-2024 02:08                1243
classobj.constants.php                             29-May-2024 02:08                1181
classobj.examples.php                              29-May-2024 02:08               13233
classobj.installation.php                          29-May-2024 02:08                1222
classobj.requirements.php                          29-May-2024 02:08                1180
classobj.resources.php                             29-May-2024 02:08                1200
classobj.setup.php                                 29-May-2024 02:08                1573
closure.bind.php                                   29-May-2024 02:08                7776
closure.bindto.php                                 29-May-2024 02:08                9097
closure.call.php                                   29-May-2024 02:08                6230
closure.construct.php                              29-May-2024 02:08                2383
closure.fromcallable.php                           29-May-2024 02:08                3749
cmark.constants.php                                29-May-2024 02:08                4250
cmark.installation.php                             29-May-2024 02:08                1943
cmark.requirements.php                             29-May-2024 02:08                1287
cmark.setup.php                                    29-May-2024 02:08                1414
collator.asort.php                                 29-May-2024 02:08                9480
collator.compare.php                               29-May-2024 02:08               10432
collator.construct.php                             29-May-2024 02:08                5640
collator.create.php                                29-May-2024 02:08                5561
collator.getattribute.php                          29-May-2024 02:08                6060
collator.geterrorcode.php                          29-May-2024 02:08                5254
collator.geterrormessage.php                       29-May-2024 02:08                5325
collator.getlocale.php                             29-May-2024 02:08                6829
collator.getsortkey.php                            29-May-2024 02:08                6875
collator.getstrength.php                           29-May-2024 02:08                4866
collator.setattribute.php                          29-May-2024 02:08                6661
collator.setstrength.php                           29-May-2024 02:08               13227
collator.sort.php                                  29-May-2024 02:08                8290
collator.sortwithsortkeys.php                      29-May-2024 02:08                6505
collectable.isgarbage.php                          29-May-2024 02:08                3394
com.configuration.php                              29-May-2024 02:08                7284
com.constants.php                                  29-May-2024 02:08               26055
com.construct.php                                  29-May-2024 02:08                9501
com.error-handling.php                             29-May-2024 02:08                1619
com.examples.arrays.php                            29-May-2024 02:08                2111
com.examples.foreach.php                           29-May-2024 02:08                2890
com.examples.php                                   29-May-2024 02:08                1459
com.installation.php                               29-May-2024 02:08                1496
com.requirements.php                               29-May-2024 02:08                1247
com.resources.php                                  29-May-2024 02:08                1165
com.setup.php                                      29-May-2024 02:08                1529
commonmark-cql.construct.php                       29-May-2024 02:08                2227
commonmark-cql.invoke.php                          29-May-2024 02:08                3903
commonmark-interfaces-ivisitable.accept.php        29-May-2024 02:08                3139
commonmark-interfaces-ivisitor.enter.php           29-May-2024 02:08                4164
commonmark-interfaces-ivisitor.leave.php           29-May-2024 02:08                4166
commonmark-node-bulletlist.construct.php           29-May-2024 02:08                3158
commonmark-node-codeblock.construct.php            29-May-2024 02:08                2821
commonmark-node-heading.construct.php              29-May-2024 02:08                2599
commonmark-node-image.construct.php                29-May-2024 02:08                3264
commonmark-node-link.construct.php                 29-May-2024 02:08                3261
commonmark-node-orderedlist.construct.php          29-May-2024 02:08                4149
commonmark-node-text.construct.php                 29-May-2024 02:08                2649
commonmark-node.accept.php                         29-May-2024 02:08                2879
commonmark-node.appendchild.php                    29-May-2024 02:08                2685
commonmark-node.insertafter.php                    29-May-2024 02:08                2710
commonmark-node.insertbefore.php                   29-May-2024 02:08                2708
commonmark-node.prependchild.php                   29-May-2024 02:08                2712
commonmark-node.replace.php                        29-May-2024 02:08                2656
commonmark-node.unlink.php                         29-May-2024 02:08                2345
commonmark-parser.construct.php                    29-May-2024 02:08                3794
commonmark-parser.finish.php                       29-May-2024 02:08                2375
commonmark-parser.parse.php                        29-May-2024 02:08                2615
compersisthelper.construct.php                     29-May-2024 02:08                3634
compersisthelper.getcurfilename.php                29-May-2024 02:08                3134
compersisthelper.getmaxstreamsize.php              29-May-2024 02:08                3140
compersisthelper.initnew.php                       29-May-2024 02:08                3089
compersisthelper.loadfromfile.php                  29-May-2024 02:08                4314
compersisthelper.loadfromstream.php                29-May-2024 02:08                3531
compersisthelper.savetofile.php                    29-May-2024 02:08                6313
compersisthelper.savetostream.php                  29-May-2024 02:08                3558
componere-abstract-definition.addinterface.php     29-May-2024 02:08                3271
componere-abstract-definition.addmethod.php        29-May-2024 02:08                3997
componere-abstract-definition.addtrait.php         29-May-2024 02:08                3223
componere-abstract-definition.getreflector.php     29-May-2024 02:08                2409
componere-definition.addconstant.php               29-May-2024 02:08                4320
componere-definition.addproperty.php               29-May-2024 02:08                3729
componere-definition.construct.php                 29-May-2024 02:08                5966
componere-definition.getclosure.php                29-May-2024 02:08                3435
componere-definition.getclosures.php               29-May-2024 02:08                2691
componere-definition.isregistered.php              29-May-2024 02:08                2291
componere-definition.register.php                  29-May-2024 02:08                2444
componere-method.construct.php                     29-May-2024 02:08                2223
componere-method.getreflector.php                  29-May-2024 02:08                2212
componere-method.setprivate.php                    29-May-2024 02:08                2440
componere-method.setprotected.php                  29-May-2024 02:08                2455
componere-method.setstatic.php                     29-May-2024 02:08                2037
componere-patch.apply.php                          29-May-2024 02:08                1902
componere-patch.construct.php                      29-May-2024 02:08                3635
componere-patch.derive.php                         29-May-2024 02:08                3128
componere-patch.getclosure.php                     29-May-2024 02:08                3065
componere-patch.getclosures.php                    29-May-2024 02:08                2212
componere-patch.isapplied.php                      29-May-2024 02:08                1856
componere-patch.revert.php                         29-May-2024 02:08                1899
componere-value.construct.php                      29-May-2024 02:08                2656
componere-value.hasdefault.php                     29-May-2024 02:08                1900
componere-value.isprivate.php                      29-May-2024 02:08                1921
componere-value.isprotected.php                    29-May-2024 02:08                1931
componere-value.isstatic.php                       29-May-2024 02:08                1915
componere-value.setprivate.php                     29-May-2024 02:08                2463
componere-value.setprotected.php                   29-May-2024 02:08                2477
componere-value.setstatic.php                      29-May-2024 02:08                2054
componere.cast.php                                 29-May-2024 02:08                4883
componere.cast_by_ref.php                          29-May-2024 02:08                5056
componere.installation.php                         29-May-2024 02:08                1341
componere.requirements.php                         29-May-2024 02:08                1177
componere.setup.php                                29-May-2024 02:08                1453
configuration.changes.modes.php                    29-May-2024 02:08                3861
configuration.changes.php                          29-May-2024 02:08                7761
configuration.file.per-user.php                    29-May-2024 02:08                2886
configuration.file.php                             29-May-2024 02:08                9603
configuration.php                                  29-May-2024 02:08                1618
configure.about.php                                29-May-2024 02:08               11710
configure.php                                      29-May-2024 02:08                1400
context.ftp.php                                    29-May-2024 02:08                4101
context.http.php                                   29-May-2024 02:08               15521
context.params.php                                 29-May-2024 02:08                2506
context.phar.php                                   29-May-2024 02:08                2856
context.php                                        29-May-2024 02:08                2870
context.socket.php                                 29-May-2024 02:08                9096
context.ssl.php                                    29-May-2024 02:08               12670
context.zip.php                                    29-May-2024 02:08                4151
context.zlib.php                                   29-May-2024 02:08                2430
control-structures.alternative-syntax.php          29-May-2024 02:08                6606
control-structures.break.php                       29-May-2024 02:08                4535
control-structures.continue.php                    29-May-2024 02:08                7751
control-structures.declare.php                     29-May-2024 02:08                9734
control-structures.do.while.php                    29-May-2024 02:08                4808
control-structures.else.php                        29-May-2024 02:08                4538
control-structures.elseif.php                      29-May-2024 02:08                7420
control-structures.for.php                         29-May-2024 02:08               11343
control-structures.foreach.php                     29-May-2024 02:08               20333
control-structures.goto.php                        29-May-2024 02:08                6885
control-structures.if.php                          29-May-2024 02:08                4554
control-structures.intro.php                       29-May-2024 02:08                2343
control-structures.match.php                       29-May-2024 02:08               17285
control-structures.switch.php                      29-May-2024 02:08               16495
control-structures.while.php                       29-May-2024 02:08                4221
copyright.php                                      29-May-2024 02:08                1895
countable.count.php                                29-May-2024 02:08                5360
ctype.configuration.php                            29-May-2024 02:08                1222
ctype.constants.php                                29-May-2024 02:08                1156
ctype.installation.php                             29-May-2024 02:08                1396
ctype.requirements.php                             29-May-2024 02:08                1193
ctype.resources.php                                29-May-2024 02:08                1179
ctype.setup.php                                    29-May-2024 02:08                1540
cubrid.configuration.php                           29-May-2024 02:08                1176
cubrid.constants.php                               29-May-2024 02:08               13770
cubrid.examples.php                                29-May-2024 02:08               13753
cubrid.installation.php                            29-May-2024 02:08                1959
cubrid.requirements.php                            29-May-2024 02:08                1224
cubrid.resources.php                               29-May-2024 02:08                3039
cubrid.setup.php                                   29-May-2024 02:08                1552
cubridmysql.cubrid.php                             29-May-2024 02:08                4939
curl.configuration.php                             29-May-2024 02:08                2435
curl.constants.php                                 29-May-2024 02:08              201054
curl.examples-basic.php                            29-May-2024 02:08                4483
curl.examples.php                                  29-May-2024 02:08                1380
curl.installation.php                              29-May-2024 02:08                2449
curl.requirements.php                              29-May-2024 02:08                1412
curl.resources.php                                 29-May-2024 02:08                1351
curl.setup.php                                     29-May-2024 02:08                1550
curlfile.construct.php                             29-May-2024 02:08               21082
curlfile.getfilename.php                           29-May-2024 02:08                2138
curlfile.getmimetype.php                           29-May-2024 02:08                2150
curlfile.getpostfilename.php                       29-May-2024 02:08                2212
curlfile.setmimetype.php                           29-May-2024 02:08                2435
curlfile.setpostfilename.php                       29-May-2024 02:08                2487
curlstringfile.construct.php                       29-May-2024 02:08                6924
dateinterval.construct.php                         29-May-2024 02:08               13349
dateinterval.createfromdatestring.php              29-May-2024 02:08               15484
dateinterval.format.php                            29-May-2024 02:08               14501
dateperiod.construct.php                           29-May-2024 02:08               19704
dateperiod.createfromiso8601string.php             29-May-2024 02:08                7848
dateperiod.getdateinterval.php                     29-May-2024 02:08                4728
dateperiod.getenddate.php                          29-May-2024 02:08                7660
dateperiod.getrecurrences.php                      29-May-2024 02:08                8825
dateperiod.getstartdate.php                        29-May-2024 02:08                5193
datetime.add.php                                   29-May-2024 02:08                4798
datetime.configuration.php                         29-May-2024 02:08                5843
datetime.constants.php                             29-May-2024 02:08                2900
datetime.construct.php                             29-May-2024 02:08                6271
datetime.createfromformat.php                      29-May-2024 02:08                7217
datetime.createfromimmutable.php                   29-May-2024 02:08                4838
datetime.createfrominterface.php                   29-May-2024 02:08                4831
datetime.diff.php                                  29-May-2024 02:08               16887
datetime.error.tree.php                            29-May-2024 02:08                3333
datetime.examples-arithmetic.php                   29-May-2024 02:08               14931
datetime.examples.php                              29-May-2024 02:08                1440
datetime.format.php                                29-May-2024 02:08               25759
datetime.formats.php                               29-May-2024 02:08               55184
datetime.getlasterrors.php                         29-May-2024 02:08                1883
datetime.getoffset.php                             29-May-2024 02:08                7820
datetime.gettimestamp.php                          29-May-2024 02:08               10002
datetime.gettimezone.php                           29-May-2024 02:08                7724
datetime.installation.php                          29-May-2024 02:08                1559
datetime.modify.php                                29-May-2024 02:08               14061
datetime.requirements.php                          29-May-2024 02:08                1180
datetime.resources.php                             29-May-2024 02:08                1200
datetime.set-state.php                             29-May-2024 02:08                2854
datetime.setdate.php                               29-May-2024 02:08                5439
datetime.setisodate.php                            29-May-2024 02:08                5645
datetime.settime.php                               29-May-2024 02:08                6958
datetime.settimestamp.php                          29-May-2024 02:08                4915
datetime.settimezone.php                           29-May-2024 02:08                9171
datetime.setup.php                                 29-May-2024 02:08                1607
datetime.sub.php                                   29-May-2024 02:08                6067
datetime.wakeup.php                                29-May-2024 02:08                3020
datetimeimmutable.add.php                          29-May-2024 02:08               10434
datetimeimmutable.construct.php                    29-May-2024 02:08               18291
datetimeimmutable.createfromformat.php             29-May-2024 02:08               46802
datetimeimmutable.createfrominterface.php          29-May-2024 02:08                5095
datetimeimmutable.createfrommutable.php            29-May-2024 02:08                4995
datetimeimmutable.getlasterrors.php                29-May-2024 02:08                5567
datetimeimmutable.modify.php                       29-May-2024 02:08                9216
datetimeimmutable.set-state.php                    29-May-2024 02:08                2773
datetimeimmutable.setdate.php                      29-May-2024 02:08                9079
datetimeimmutable.setisodate.php                   29-May-2024 02:08               12662
datetimeimmutable.settime.php                      29-May-2024 02:08               11878
datetimeimmutable.settimestamp.php                 29-May-2024 02:08                5724
datetimeimmutable.settimezone.php                  29-May-2024 02:08                5920
datetimeimmutable.sub.php                          29-May-2024 02:08               11857
datetimezone.construct.php                         29-May-2024 02:08               10429
datetimezone.getlocation.php                       29-May-2024 02:08                5802
datetimezone.getname.php                           29-May-2024 02:08                3528
datetimezone.getoffset.php                         29-May-2024 02:08                6953
datetimezone.gettransitions.php                    29-May-2024 02:08               12059
datetimezone.listabbreviations.php                 29-May-2024 02:08                5889
datetimezone.listidentifiers.php                   29-May-2024 02:08               14470
dba.configuration.php                              29-May-2024 02:08                2228
dba.constants.php                                  29-May-2024 02:08                2097
dba.example.php                                    29-May-2024 02:08                6218
dba.examples.php                                   29-May-2024 02:08                1343
dba.installation.php                               29-May-2024 02:08                9422
dba.requirements.php                               29-May-2024 02:08                7253
dba.resources.php                                  29-May-2024 02:08                1453
dba.setup.php                                      29-May-2024 02:08                1532
dbase.configuration.php                            29-May-2024 02:08                1222
dbase.constants.php                                29-May-2024 02:08                3587
dbase.installation.php                             29-May-2024 02:08                1517
dbase.requirements.php                             29-May-2024 02:08                1159
dbase.resources.php                                29-May-2024 02:08                1465
dbase.setup.php                                    29-May-2024 02:08                1553
debugger-about.php                                 29-May-2024 02:08                1497
debugger.php                                       29-May-2024 02:08                1393
dio.configuration.php                              29-May-2024 02:08                1208
dio.constants.php                                  29-May-2024 02:08               10948
dio.installation.php                               29-May-2024 02:08                1889
dio.requirements.php                               29-May-2024 02:08                1145
dio.resources.php                                  29-May-2024 02:08                1296
dio.setup.php                                      29-May-2024 02:08                1533
dir.configuration.php                              29-May-2024 02:08                1208
dir.constants.php                                  29-May-2024 02:08                2797
dir.installation.php                               29-May-2024 02:08                1187
dir.requirements.php                               29-May-2024 02:08                1145
dir.resources.php                                  29-May-2024 02:08                1165
dir.setup.php                                      29-May-2024 02:08                1524
directory.close.php                                29-May-2024 02:08                2183
directory.read.php                                 29-May-2024 02:08                2319
directory.rewind.php                               29-May-2024 02:08                2193
directoryiterator.construct.php                    29-May-2024 02:08                5777
directoryiterator.current.php                      29-May-2024 02:08                6028
directoryiterator.getbasename.php                  29-May-2024 02:08                6312
directoryiterator.getextension.php                 29-May-2024 02:08                6061
directoryiterator.getfilename.php                  29-May-2024 02:08                5049
directoryiterator.isdot.php                        29-May-2024 02:08                5262
directoryiterator.key.php                          29-May-2024 02:08                6469
directoryiterator.next.php                         29-May-2024 02:08                5379
directoryiterator.rewind.php                       29-May-2024 02:08                5312
directoryiterator.seek.php                         29-May-2024 02:08                5274
directoryiterator.tostring.php                     29-May-2024 02:08                4581
directoryiterator.valid.php                        29-May-2024 02:08                5718
doc.changelog.php                                  29-May-2024 02:08                1284
dom.configuration.php                              29-May-2024 02:08                1208
dom.constants.php                                  29-May-2024 02:08               19878
dom.examples.php                                   29-May-2024 02:08                2969
dom.installation.php                               29-May-2024 02:08                1248
dom.requirements.php                               29-May-2024 02:08                1429
dom.resources.php                                  29-May-2024 02:08                1165
dom.setup.php                                      29-May-2024 02:08                1522
domattr.construct.php                              29-May-2024 02:08                5556
domattr.isid.php                                   29-May-2024 02:08                4998
domcdatasection.construct.php                      29-May-2024 02:08                5135
domcharacterdata.after.php                         29-May-2024 02:08                7692
domcharacterdata.appenddata.php                    29-May-2024 02:08                4364
domcharacterdata.before.php                        29-May-2024 02:08                7320
domcharacterdata.deletedata.php                    29-May-2024 02:08                5053
domcharacterdata.insertdata.php                    29-May-2024 02:08                4777
domcharacterdata.remove.php                        29-May-2024 02:08                5345
domcharacterdata.replacedata.php                   29-May-2024 02:08                5445
domcharacterdata.replacewith.php                   29-May-2024 02:08                7776
domcharacterdata.substringdata.php                 29-May-2024 02:08                4900
domchildnode.after.php                             29-May-2024 02:08                5629
domchildnode.before.php                            29-May-2024 02:08                5055
domchildnode.remove.php                            29-May-2024 02:08                3071
domchildnode.replacewith.php                       29-May-2024 02:08                5247
domcomment.construct.php                           29-May-2024 02:08                4978
domdocument.adoptnode.php                          29-May-2024 02:08                6670
domdocument.append.php                             29-May-2024 02:08                6743
domdocument.construct.php                          29-May-2024 02:08                4366
domdocument.createattribute.php                    29-May-2024 02:08                5802
domdocument.createattributens.php                  29-May-2024 02:08                8109
domdocument.createcdatasection.php                 29-May-2024 02:08                5415
domdocument.createcomment.php                      29-May-2024 02:08                5786
domdocument.createdocumentfragment.php             29-May-2024 02:08                5606
domdocument.createelement.php                      29-May-2024 02:08               11204
domdocument.createelementns.php                    29-May-2024 02:08               13932
domdocument.createentityreference.php              29-May-2024 02:08                6119
domdocument.createprocessinginstruction.php        29-May-2024 02:08                6439
domdocument.createtextnode.php                     29-May-2024 02:08                5774
domdocument.getelementbyid.php                     29-May-2024 02:08                7626
domdocument.getelementsbytagname.php               29-May-2024 02:08                6005
domdocument.getelementsbytagnamens.php             29-May-2024 02:08                7636
domdocument.importnode.php                         29-May-2024 02:08                8902
domdocument.load.php                               29-May-2024 02:08                6569
domdocument.loadhtml.php                           29-May-2024 02:08                7709
domdocument.loadhtmlfile.php                       29-May-2024 02:08                7828
domdocument.loadxml.php                            29-May-2024 02:08                6284
domdocument.normalizedocument.php                  29-May-2024 02:08                2932
domdocument.prepend.php                            29-May-2024 02:08                6835
domdocument.registernodeclass.php                  29-May-2024 02:08               20697
domdocument.relaxngvalidate.php                    29-May-2024 02:08                4012
domdocument.relaxngvalidatesource.php              29-May-2024 02:08                4067
domdocument.replacechildren.php                    29-May-2024 02:08                7132
domdocument.save.php                               29-May-2024 02:08                7574
domdocument.savehtml.php                           29-May-2024 02:08                7509
domdocument.savehtmlfile.php                       29-May-2024 02:08                7950
domdocument.savexml.php                            29-May-2024 02:08                9675
domdocument.schemavalidate.php                     29-May-2024 02:08                4398
domdocument.schemavalidatesource.php               29-May-2024 02:08                4460
domdocument.validate.php                           29-May-2024 02:08                6020
domdocument.xinclude.php                           29-May-2024 02:08                7125
domdocumentfragment.append.php                     29-May-2024 02:08                7433
domdocumentfragment.appendxml.php                  29-May-2024 02:08                5534
domdocumentfragment.construct.php                  29-May-2024 02:08                2130
domdocumentfragment.prepend.php                    29-May-2024 02:08                7491
domdocumentfragment.replacechildren.php            29-May-2024 02:08                7876
domelement.after.php                               29-May-2024 02:08                7370
domelement.append.php                              29-May-2024 02:08                7055
domelement.before.php                              29-May-2024 02:08                6955
domelement.construct.php                           29-May-2024 02:08                6654
domelement.getattribute.php                        29-May-2024 02:08                3526
domelement.getattributenames.php                   29-May-2024 02:08                3930
domelement.getattributenode.php                    29-May-2024 02:08                4075
domelement.getattributenodens.php                  29-May-2024 02:08                4565
domelement.getattributens.php                      29-May-2024 02:08                4068
domelement.getelementsbytagname.php                29-May-2024 02:08                3633
domelement.getelementsbytagnamens.php              29-May-2024 02:08                4712
domelement.hasattribute.php                        29-May-2024 02:08                3816
domelement.hasattributens.php                      29-May-2024 02:08                4288
domelement.insertadjacentelement.php               29-May-2024 02:08                6615
domelement.insertadjacenttext.php                  29-May-2024 02:08                6422
domelement.prepend.php                             29-May-2024 02:08                7105
domelement.remove.php                              29-May-2024 02:08                4988
domelement.removeattribute.php                     29-May-2024 02:08                4030
domelement.removeattributenode.php                 29-May-2024 02:08                4441
domelement.removeattributens.php                   29-May-2024 02:08                4307
domelement.replacechildren.php                     29-May-2024 02:08                7696
domelement.replacewith.php                         29-May-2024 02:08                7760
domelement.setattribute.php                        29-May-2024 02:08                6181
domelement.setattributenode.php                    29-May-2024 02:08                4737
domelement.setattributenodens.php                  29-May-2024 02:08                4804
domelement.setattributens.php                      29-May-2024 02:08                5236
domelement.setidattribute.php                      29-May-2024 02:08                4825
domelement.setidattributenode.php                  29-May-2024 02:08                4819
domelement.setidattributens.php                    29-May-2024 02:08                5277
domelement.toggleattribute.php                     29-May-2024 02:08                6399
domentityreference.construct.php                   29-May-2024 02:08                4820
domimplementation.construct.php                    29-May-2024 02:08                2140
domimplementation.createdocument.php               29-May-2024 02:08                7333
domimplementation.createdocumenttype.php           29-May-2024 02:08                9830
domimplementation.hasfeature.php                   29-May-2024 02:08                9246
domnamednodemap.count.php                          29-May-2024 02:08                2410
domnamednodemap.getiterator.php                    29-May-2024 02:08                3163
domnamednodemap.getnameditem.php                   29-May-2024 02:08                3454
domnamednodemap.getnameditemns.php                 29-May-2024 02:08                3906
domnamednodemap.item.php                           29-May-2024 02:08                3061
domnode.appendchild.php                            29-May-2024 02:08                8686
domnode.c14n.php                                   29-May-2024 02:08                7927
domnode.c14nfile.php                               29-May-2024 02:08                5695
domnode.clonenode.php                              29-May-2024 02:08                2834
domnode.contains.php                               29-May-2024 02:08                5334
domnode.getlineno.php                              29-May-2024 02:08                4836
domnode.getnodepath.php                            29-May-2024 02:08                5183
domnode.getrootnode.php                            29-May-2024 02:08                4377
domnode.hasattributes.php                          29-May-2024 02:08                2937
domnode.haschildnodes.php                          29-May-2024 02:08                2801
domnode.insertbefore.php                           29-May-2024 02:08                5457
domnode.isdefaultnamespace.php                     29-May-2024 02:08                2922
domnode.isequalnode.php                            29-May-2024 02:08                4673
domnode.issamenode.php                             29-May-2024 02:08                2779
domnode.issupported.php                            29-May-2024 02:08                3800
domnode.lookupnamespaceuri.php                     29-May-2024 02:08                3571
domnode.lookupprefix.php                           29-May-2024 02:08                3209
domnode.normalize.php                              29-May-2024 02:08                2778
domnode.removechild.php                            29-May-2024 02:08                7002
domnode.replacechild.php                           29-May-2024 02:08                5705
domnodelist.count.php                              29-May-2024 02:08                2339
domnodelist.getiterator.php                        29-May-2024 02:08                3066
domnodelist.item.php                               29-May-2024 02:08                6954
domparentnode.append.php                           29-May-2024 02:08                4731
domparentnode.prepend.php                          29-May-2024 02:08                4771
domparentnode.replacechildren.php                  29-May-2024 02:08                6570
domprocessinginstruction.construct.php             29-May-2024 02:08                6659
domtext.construct.php                              29-May-2024 02:08                4776
domtext.iselementcontentwhitespace.php             29-May-2024 02:08                2622
domtext.iswhitespaceinelementcontent.php           29-May-2024 02:08                2825
domtext.splittext.php                              29-May-2024 02:08                3230
domxpath.construct.php                             29-May-2024 02:08                3497
domxpath.evaluate.php                              29-May-2024 02:08                7870
domxpath.query.php                                 29-May-2024 02:08               12335
domxpath.registernamespace.php                     29-May-2024 02:08                3297
domxpath.registerphpfunctions.php                  29-May-2024 02:08               13700
dotnet.construct.php                               29-May-2024 02:08                3118
ds-collection.clear.php                            29-May-2024 02:08                3866
ds-collection.copy.php                             29-May-2024 02:08                4279
ds-collection.isempty.php                          29-May-2024 02:08                4207
ds-collection.toarray.php                          29-May-2024 02:08                4198
ds-deque.allocate.php                              29-May-2024 02:08                4633
ds-deque.apply.php                                 29-May-2024 02:08                4929
ds-deque.capacity.php                              29-May-2024 02:08                3906
ds-deque.clear.php                                 29-May-2024 02:08                3783
ds-deque.construct.php                             29-May-2024 02:08                4292
ds-deque.contains.php                              29-May-2024 02:08                7055
ds-deque.copy.php                                  29-May-2024 02:08                4145
ds-deque.count.php                                 29-May-2024 02:08                1620
ds-deque.filter.php                                29-May-2024 02:08                7562
ds-deque.find.php                                  29-May-2024 02:08                5394
ds-deque.first.php                                 29-May-2024 02:08                3713
ds-deque.get.php                                   29-May-2024 02:08                6535
ds-deque.insert.php                                29-May-2024 02:08                6626
ds-deque.isempty.php                               29-May-2024 02:08                4093
ds-deque.join.php                                  29-May-2024 02:08                5687
ds-deque.jsonserialize.php                         29-May-2024 02:08                1876
ds-deque.last.php                                  29-May-2024 02:08                3701
ds-deque.map.php                                   29-May-2024 02:08                5290
ds-deque.merge.php                                 29-May-2024 02:08                4840
ds-deque.pop.php                                   29-May-2024 02:08                4198
ds-deque.push.php                                  29-May-2024 02:08                4633
ds-deque.reduce.php                                29-May-2024 02:08                7933
ds-deque.remove.php                                29-May-2024 02:08                4834
ds-deque.reverse.php                               29-May-2024 02:08                3619
ds-deque.reversed.php                              29-May-2024 02:08                3972
ds-deque.rotate.php                                29-May-2024 02:08                5019
ds-deque.set.php                                   29-May-2024 02:08                6002
ds-deque.shift.php                                 29-May-2024 02:08                4299
ds-deque.slice.php                                 29-May-2024 02:08                7116
ds-deque.sort.php                                  29-May-2024 02:08                7255
ds-deque.sorted.php                                29-May-2024 02:08                7282
ds-deque.sum.php                                   29-May-2024 02:08                5199
ds-deque.toarray.php                               29-May-2024 02:08                4084
ds-deque.unshift.php                               29-May-2024 02:08                4714
ds-hashable.equals.php                             29-May-2024 02:08                3689
ds-hashable.hash.php                               29-May-2024 02:08                7437
ds-map.allocate.php                                29-May-2024 02:08                4499
ds-map.apply.php                                   29-May-2024 02:08                5625
ds-map.capacity.php                                29-May-2024 02:08                3196
ds-map.clear.php                                   29-May-2024 02:08                4259
ds-map.construct.php                               29-May-2024 02:08                4794
ds-map.copy.php                                    29-May-2024 02:08                4005
ds-map.count.php                                   29-May-2024 02:08                1581
ds-map.diff.php                                    29-May-2024 02:08                5412
ds-map.filter.php                                  29-May-2024 02:08                8346
ds-map.first.php                                   29-May-2024 02:08                4012
ds-map.get.php                                     29-May-2024 02:08                8359
ds-map.haskey.php                                  29-May-2024 02:08                4651
ds-map.hasvalue.php                                29-May-2024 02:08                4695
ds-map.intersect.php                               29-May-2024 02:08                5935
ds-map.isempty.php                                 29-May-2024 02:08                4315
ds-map.jsonserialize.php                           29-May-2024 02:08                1854
ds-map.keys.php                                    29-May-2024 02:08                3906
ds-map.ksort.php                                   29-May-2024 02:08                7942
ds-map.ksorted.php                                 29-May-2024 02:08                8031
ds-map.last.php                                    29-May-2024 02:08                3997
ds-map.map.php                                     29-May-2024 02:08                6271
ds-map.merge.php                                   29-May-2024 02:08                5822
ds-map.pairs.php                                   29-May-2024 02:08                4321
ds-map.put.php                                     29-May-2024 02:08               13881
ds-map.putall.php                                  29-May-2024 02:08                5500
ds-map.reduce.php                                  29-May-2024 02:08                8868
ds-map.remove.php                                  29-May-2024 02:08                6933
ds-map.reverse.php                                 29-May-2024 02:08                4071
ds-map.reversed.php                                29-May-2024 02:08                4182
ds-map.skip.php                                    29-May-2024 02:08                4584
ds-map.slice.php                                   29-May-2024 02:08                7968
ds-map.sort.php                                    29-May-2024 02:08                7865
ds-map.sorted.php                                  29-May-2024 02:08                8010
ds-map.sum.php                                     29-May-2024 02:08                5666
ds-map.toarray.php                                 29-May-2024 02:08                5079
ds-map.union.php                                   29-May-2024 02:08                5919
ds-map.values.php                                  29-May-2024 02:08                3905
ds-map.xor.php                                     29-May-2024 02:08                5478
ds-pair.clear.php                                  29-May-2024 02:08                3688
ds-pair.construct.php                              29-May-2024 02:08                2594
ds-pair.copy.php                                   29-May-2024 02:08                4059
ds-pair.isempty.php                                29-May-2024 02:08                4043
ds-pair.jsonserialize.php                          29-May-2024 02:08                1874
ds-pair.toarray.php                                29-May-2024 02:08                4018
ds-priorityqueue.allocate.php                      29-May-2024 02:08                4799
ds-priorityqueue.capacity.php                      29-May-2024 02:08                3405
ds-priorityqueue.clear.php                         29-May-2024 02:08                4440
ds-priorityqueue.construct.php                     29-May-2024 02:08                2904
ds-priorityqueue.copy.php                          29-May-2024 02:08                4448
ds-priorityqueue.count.php                         29-May-2024 02:08                1729
ds-priorityqueue.isempty.php                       29-May-2024 02:08                5003
ds-priorityqueue.jsonserialize.php                 29-May-2024 02:08                1994
ds-priorityqueue.peek.php                          29-May-2024 02:08                4691
ds-priorityqueue.pop.php                           29-May-2024 02:08                5463
ds-priorityqueue.push.php                          29-May-2024 02:08                5559
ds-priorityqueue.toarray.php                       29-May-2024 02:08                5185
ds-queue.allocate.php                              29-May-2024 02:08                4828
ds-queue.capacity.php                              29-May-2024 02:08                3912
ds-queue.clear.php                                 29-May-2024 02:08                3768
ds-queue.construct.php                             29-May-2024 02:08                4290
ds-queue.copy.php                                  29-May-2024 02:08                4247
ds-queue.count.php                                 29-May-2024 02:08                1617
ds-queue.isempty.php                               29-May-2024 02:08                4109
ds-queue.jsonserialize.php                         29-May-2024 02:08                1882
ds-queue.peek.php                                  29-May-2024 02:08                4295
ds-queue.pop.php                                   29-May-2024 02:08                4829
ds-queue.push.php                                  29-May-2024 02:08                4668
ds-queue.toarray.php                               29-May-2024 02:08                4250
ds-sequence.allocate.php                           29-May-2024 02:08                4535
ds-sequence.apply.php                              29-May-2024 02:08                5044
ds-sequence.capacity.php                           29-May-2024 02:08                4461
ds-sequence.contains.php                           29-May-2024 02:08                7182
ds-sequence.filter.php                             29-May-2024 02:08                7701
ds-sequence.find.php                               29-May-2024 02:08                5506
ds-sequence.first.php                              29-May-2024 02:08                3828
ds-sequence.get.php                                29-May-2024 02:08                6663
ds-sequence.insert.php                             29-May-2024 02:08                6745
ds-sequence.join.php                               29-May-2024 02:08                5783
ds-sequence.last.php                               29-May-2024 02:08                3795
ds-sequence.map.php                                29-May-2024 02:08                5419
ds-sequence.merge.php                              29-May-2024 02:08                4966
ds-sequence.pop.php                                29-May-2024 02:08                4310
ds-sequence.push.php                               29-May-2024 02:08                4755
ds-sequence.reduce.php                             29-May-2024 02:08                8052
ds-sequence.remove.php                             29-May-2024 02:08                4946
ds-sequence.reverse.php                            29-May-2024 02:08                3732
ds-sequence.reversed.php                           29-May-2024 02:08                4095
ds-sequence.rotate.php                             29-May-2024 02:08                5156
ds-sequence.set.php                                29-May-2024 02:08                6126
ds-sequence.shift.php                              29-May-2024 02:08                4411
ds-sequence.slice.php                              29-May-2024 02:08                7281
ds-sequence.sort.php                               29-May-2024 02:08                7382
ds-sequence.sorted.php                             29-May-2024 02:08                7409
ds-sequence.sum.php                                29-May-2024 02:08                5324
ds-sequence.unshift.php                            29-May-2024 02:08                4825
ds-set.add.php                                     29-May-2024 02:08               12112
ds-set.allocate.php                                29-May-2024 02:08                4508
ds-set.capacity.php                                29-May-2024 02:08                3864
ds-set.clear.php                                   29-May-2024 02:08                3714
ds-set.construct.php                               29-May-2024 02:08                4244
ds-set.contains.php                                29-May-2024 02:08                7249
ds-set.copy.php                                    29-May-2024 02:08                4186
ds-set.count.php                                   29-May-2024 02:08                1581
ds-set.diff.php                                    29-May-2024 02:08                4702
ds-set.filter.php                                  29-May-2024 02:08                7510
ds-set.first.php                                   29-May-2024 02:08                3666
ds-set.get.php                                     29-May-2024 02:08                6479
ds-set.intersect.php                               29-May-2024 02:08                4933
ds-set.isempty.php                                 29-May-2024 02:08                4051
ds-set.join.php                                    29-May-2024 02:08                5633
ds-set.jsonserialize.php                           29-May-2024 02:08                1848
ds-set.last.php                                    29-May-2024 02:08                3667
ds-set.merge.php                                   29-May-2024 02:08                4766
ds-set.reduce.php                                  29-May-2024 02:08                7879
ds-set.remove.php                                  29-May-2024 02:08                4939
ds-set.reverse.php                                 29-May-2024 02:08                3567
ds-set.reversed.php                                29-May-2024 02:08                3910
ds-set.slice.php                                   29-May-2024 02:08                7030
ds-set.sort.php                                    29-May-2024 02:08                7191
ds-set.sorted.php                                  29-May-2024 02:08                7218
ds-set.sum.php                                     29-May-2024 02:08                5139
ds-set.toarray.php                                 29-May-2024 02:08                4030
ds-set.union.php                                   29-May-2024 02:08                4896
ds-set.xor.php                                     29-May-2024 02:08                4872
ds-stack.allocate.php                              29-May-2024 02:08                2840
ds-stack.capacity.php                              29-May-2024 02:08                2168
ds-stack.clear.php                                 29-May-2024 02:08                3764
ds-stack.construct.php                             29-May-2024 02:08                4256
ds-stack.copy.php                                  29-May-2024 02:08                4247
ds-stack.count.php                                 29-May-2024 02:08                1617
ds-stack.isempty.php                               29-May-2024 02:08                4109
ds-stack.jsonserialize.php                         29-May-2024 02:08                1882
ds-stack.peek.php                                  29-May-2024 02:08                4289
ds-stack.pop.php                                   29-May-2024 02:08                4823
ds-stack.push.php                                  29-May-2024 02:08                4668
ds-stack.toarray.php                               29-May-2024 02:08                4075
ds-vector.allocate.php                             29-May-2024 02:08                4452
ds-vector.apply.php                                29-May-2024 02:08                4955
ds-vector.capacity.php                             29-May-2024 02:08                4366
ds-vector.clear.php                                29-May-2024 02:08                3795
ds-vector.construct.php                            29-May-2024 02:08                4324
ds-vector.contains.php                             29-May-2024 02:08                7085
ds-vector.copy.php                                 29-May-2024 02:08                4271
ds-vector.count.php                                29-May-2024 02:08                1634
ds-vector.filter.php                               29-May-2024 02:08                7596
ds-vector.find.php                                 29-May-2024 02:08                5419
ds-vector.first.php                                29-May-2024 02:08                3739
ds-vector.get.php                                  29-May-2024 02:08                6566
ds-vector.insert.php                               29-May-2024 02:08                6656
ds-vector.isempty.php                              29-May-2024 02:08                4117
ds-vector.join.php                                 29-May-2024 02:08                5714
ds-vector.jsonserialize.php                        29-May-2024 02:08                1890
ds-vector.last.php                                 29-May-2024 02:08                3726
ds-vector.map.php                                  29-May-2024 02:08                5322
ds-vector.merge.php                                29-May-2024 02:08                4871
ds-vector.pop.php                                  29-May-2024 02:08                4223
ds-vector.push.php                                 29-May-2024 02:08                4662
ds-vector.reduce.php                               29-May-2024 02:08                7961
ds-vector.remove.php                               29-May-2024 02:08                4859
ds-vector.reverse.php                              29-May-2024 02:08                3645
ds-vector.reversed.php                             29-May-2024 02:08                4002
ds-vector.rotate.php                               29-May-2024 02:08                5053
ds-vector.set.php                                  29-May-2024 02:08                6033
ds-vector.shift.php                                29-May-2024 02:08                4324
ds-vector.slice.php                                29-May-2024 02:08                7162
ds-vector.sort.php                                 29-May-2024 02:08                7287
ds-vector.sorted.php                               29-May-2024 02:08                7314
ds-vector.sum.php                                  29-May-2024 02:08                5229
ds-vector.toarray.php                              29-May-2024 02:08                4109
ds-vector.unshift.php                              29-May-2024 02:08                4744
ds.constants.php                                   29-May-2024 02:08                1141
ds.examples.php                                    29-May-2024 02:08                4679
ds.installation.php                                29-May-2024 02:08                2491
ds.requirements.php                                29-May-2024 02:08                1178
ds.setup.php                                       29-May-2024 02:08                1390
eio.configuration.php                              29-May-2024 02:08                1206
eio.constants.php                                  29-May-2024 02:08               21767
eio.examples.php                                   29-May-2024 02:08               26942
eio.installation.php                               29-May-2024 02:08                1651
eio.requirements.php                               29-May-2024 02:08                1298
eio.resources.php                                  29-May-2024 02:08                1219
eio.setup.php                                      29-May-2024 02:08                1534
emptyiterator.current.php                          29-May-2024 02:08                2676
emptyiterator.key.php                              29-May-2024 02:08                2640
emptyiterator.next.php                             29-May-2024 02:08                2340
emptyiterator.rewind.php                           29-May-2024 02:08                2362
emptyiterator.valid.php                            29-May-2024 02:08                2723
enchant.configuration.php                          29-May-2024 02:08                1236
enchant.constants.php                              29-May-2024 02:08                2934
enchant.examples.php                               29-May-2024 02:08                5425
enchant.installation.php                           29-May-2024 02:08                3014
enchant.requirements.php                           29-May-2024 02:08                1781
enchant.resources.php                              29-May-2024 02:08                1326
enchant.setup.php                                  29-May-2024 02:08                1579
error.clone.php                                    29-May-2024 02:08                2776
error.construct.php                                29-May-2024 02:08                3401
error.getcode.php                                  29-May-2024 02:08                3979
error.getfile.php                                  29-May-2024 02:08                3676
error.getline.php                                  29-May-2024 02:08                3885
error.getmessage.php                               29-May-2024 02:08                3777
error.getprevious.php                              29-May-2024 02:08                6535
error.gettrace.php                                 29-May-2024 02:08                4287
error.gettraceasstring.php                         29-May-2024 02:08                4078
error.tostring.php                                 29-May-2024 02:08                3929
errorexception.construct.php                       29-May-2024 02:08                6103
errorexception.getseverity.php                     29-May-2024 02:08                4309
errorfunc.configuration.php                        29-May-2024 02:08               24157
errorfunc.constants.php                            29-May-2024 02:08               11264
errorfunc.examples.php                             29-May-2024 02:08               19027
errorfunc.installation.php                         29-May-2024 02:08                1229
errorfunc.requirements.php                         29-May-2024 02:08                1187
errorfunc.resources.php                            29-May-2024 02:08                1207
errorfunc.setup.php                                29-May-2024 02:08                1594
ev.backend.php                                     29-May-2024 02:08                3371
ev.configuration.php                               29-May-2024 02:08                1201
ev.depth.php                                       29-May-2024 02:08                3241
ev.embeddablebackends.php                          29-May-2024 02:08                6437
ev.examples.php                                    29-May-2024 02:08               41754
ev.feedsignal.php                                  29-May-2024 02:08                3369
ev.feedsignalevent.php                             29-May-2024 02:08                3156
ev.global.constants.php                            29-May-2024 02:08                1299
ev.installation.php                                29-May-2024 02:08                1632
ev.iteration.php                                   29-May-2024 02:08                2617
ev.now.php                                         29-May-2024 02:08                3088
ev.nowupdate.php                                   29-May-2024 02:08                3162
ev.periodic-modes.php                              29-May-2024 02:08                7685
ev.recommendedbackends.php                         29-May-2024 02:08                7129
ev.requirements.php                                29-May-2024 02:08                1233
ev.resources.php                                   29-May-2024 02:08                1165
ev.resume.php                                      29-May-2024 02:08                3684
ev.run.php                                         29-May-2024 02:08                5067
ev.setup.php                                       29-May-2024 02:08                1489
ev.sleep.php                                       29-May-2024 02:08                2434
ev.stop.php                                        29-May-2024 02:08                2868
ev.supportedbackends.php                           29-May-2024 02:08                6419
ev.suspend.php                                     29-May-2024 02:08                3451
ev.time.php                                        29-May-2024 02:08                2662
ev.verify.php                                      29-May-2024 02:08                2248
ev.watcher-callbacks.php                           29-May-2024 02:08                4559
ev.watchers.php                                    29-May-2024 02:08                3477
evcheck.construct.php                              29-May-2024 02:08                3657
evcheck.createstopped.php                          29-May-2024 02:08                3759
evchild.construct.php                              29-May-2024 02:08                6734
evchild.createstopped.php                          29-May-2024 02:08                5130
evchild.set.php                                    29-May-2024 02:08                3205
evembed.construct.php                              29-May-2024 02:08                7947
evembed.createstopped.php                          29-May-2024 02:08                4772
evembed.set.php                                    29-May-2024 02:08                2558
evembed.sweep.php                                  29-May-2024 02:08                3047
event.add.php                                      29-May-2024 02:08               10247
event.addsignal.php                                29-May-2024 02:08                1688
event.addtimer.php                                 29-May-2024 02:08                1697
event.callbacks.php                                29-May-2024 02:08                5714
event.configuration.php                            29-May-2024 02:08                1222
event.construct.php                                29-May-2024 02:08                4585
event.constructing.signal.events.php               29-May-2024 02:08                6074
event.del.php                                      29-May-2024 02:08                2622
event.delsignal.php                                29-May-2024 02:08                1688
event.deltimer.php                                 29-May-2024 02:08                1685
event.examples.php                                 29-May-2024 02:08              164809
event.flags.php                                    29-May-2024 02:08                2638
event.free.php                                     29-May-2024 02:08                3005
event.getsupportedmethods.php                      29-May-2024 02:08                2659
event.installation.php                             29-May-2024 02:08                1653
event.pending.php                                  29-May-2024 02:08                3127
event.persistence.php                              29-May-2024 02:08                2968
event.requirements.php                             29-May-2024 02:08                1418
event.resources.php                                29-May-2024 02:08                1169
event.set.php                                      29-May-2024 02:08                4703
event.setpriority.php                              29-May-2024 02:08                2619
event.settimer.php                                 29-May-2024 02:08                4126
event.setup.php                                    29-May-2024 02:08                1528
event.signal.php                                   29-May-2024 02:08                4312
event.timer.php                                    29-May-2024 02:08                3608
eventbase.construct.php                            29-May-2024 02:08                3031
eventbase.dispatch.php                             29-May-2024 02:08                3315
eventbase.exit.php                                 29-May-2024 02:08                3112
eventbase.free.php                                 29-May-2024 02:08                3356
eventbase.getfeatures.php                          29-May-2024 02:08                5759
eventbase.getmethod.php                            29-May-2024 02:08                4528
eventbase.gettimeofdaycached.php                   29-May-2024 02:08                2736
eventbase.gotexit.php                              29-May-2024 02:08                3350
eventbase.gotstop.php                              29-May-2024 02:08                3322
eventbase.loop.php                                 29-May-2024 02:08                3654
eventbase.priorityinit.php                         29-May-2024 02:08                3089
eventbase.reinit.php                               29-May-2024 02:08                2412
eventbase.stop.php                                 29-May-2024 02:08                2875
eventbuffer.add.php                                29-May-2024 02:08                3090
eventbuffer.addbuffer.php                          29-May-2024 02:08                3442
eventbuffer.appendfrom.php                         29-May-2024 02:08                4932
eventbuffer.construct.php                          29-May-2024 02:08                1979
eventbuffer.copyout.php                            29-May-2024 02:08                3986
eventbuffer.drain.php                              29-May-2024 02:08                3565
eventbuffer.enablelocking.php                      29-May-2024 02:08                2888
eventbuffer.expand.php                             29-May-2024 02:08                2892
eventbuffer.freeze.php                             29-May-2024 02:08                3138
eventbuffer.lock.php                               29-May-2024 02:08                3013
eventbuffer.prepend.php                            29-May-2024 02:08                3565
eventbuffer.prependbuffer.php                      29-May-2024 02:08                3727
eventbuffer.pullup.php                             29-May-2024 02:08                4693
eventbuffer.read.php                               29-May-2024 02:08                4957
eventbuffer.readfrom.php                           29-May-2024 02:08                4399
eventbuffer.readline.php                           29-May-2024 02:08                4320
eventbuffer.search.php                             29-May-2024 02:08                8329
eventbuffer.searcheol.php                          29-May-2024 02:08                4892
eventbuffer.substr.php                             29-May-2024 02:08                3606
eventbuffer.unfreeze.php                           29-May-2024 02:08                3152
eventbuffer.unlock.php                             29-May-2024 02:08                2850
eventbuffer.write.php                              29-May-2024 02:08                3512
eventbufferevent.about.callbacks.php               29-May-2024 02:08                6179
eventbufferevent.close.php                         29-May-2024 02:08                2583
eventbufferevent.connect.php                       29-May-2024 02:08               23895
eventbufferevent.connecthost.php                   29-May-2024 02:08               17810
eventbufferevent.construct.php                     29-May-2024 02:08                6907
eventbufferevent.createpair.php                    29-May-2024 02:08                4354
eventbufferevent.disable.php                       29-May-2024 02:08                3593
eventbufferevent.enable.php                        29-May-2024 02:08                4063
eventbufferevent.free.php                          29-May-2024 02:08                2804
eventbufferevent.getdnserrorstring.php             29-May-2024 02:08                3129
eventbufferevent.getenabled.php                    29-May-2024 02:08                3078
eventbufferevent.getinput.php                      29-May-2024 02:08                5017
eventbufferevent.getoutput.php                     29-May-2024 02:08                7898
eventbufferevent.read.php                          29-May-2024 02:08                3108
eventbufferevent.readbuffer.php                    29-May-2024 02:08                3279
eventbufferevent.setcallbacks.php                  29-May-2024 02:08                4592
eventbufferevent.setpriority.php                   29-May-2024 02:08                3001
eventbufferevent.settimeouts.php                   29-May-2024 02:08                3226
eventbufferevent.setwatermark.php                  29-May-2024 02:08                4130
eventbufferevent.sslerror.php                      29-May-2024 02:08                5901
eventbufferevent.sslfilter.php                     29-May-2024 02:08               34504
eventbufferevent.sslgetcipherinfo.php              29-May-2024 02:08                2948
eventbufferevent.sslgetciphername.php              29-May-2024 02:08                2851
eventbufferevent.sslgetcipherversion.php           29-May-2024 02:08                2880
eventbufferevent.sslgetprotocol.php                29-May-2024 02:08                2757
eventbufferevent.sslrenegotiate.php                29-May-2024 02:08                2839
eventbufferevent.sslsocket.php                     29-May-2024 02:08                5931
eventbufferevent.write.php                         29-May-2024 02:08                3275
eventbufferevent.writebuffer.php                   29-May-2024 02:08                3397
eventconfig.avoidmethod.php                        29-May-2024 02:08                4430
eventconfig.construct.php                          29-May-2024 02:08                4009
eventconfig.requirefeatures.php                    29-May-2024 02:08                5980
eventconfig.setflags.php                           29-May-2024 02:08                3334
eventconfig.setmaxdispatchinterval.php             29-May-2024 02:08                4433
eventdnsbase.addnameserverip.php                   29-May-2024 02:08                3028
eventdnsbase.addsearch.php                         29-May-2024 02:08                2588
eventdnsbase.clearsearch.php                       29-May-2024 02:08                2819
eventdnsbase.construct.php                         29-May-2024 02:08                7549
eventdnsbase.countnameservers.php                  29-May-2024 02:08                2562
eventdnsbase.loadhosts.php                         29-May-2024 02:08                2901
eventdnsbase.parseresolvconf.php                   29-May-2024 02:08                4277
eventdnsbase.setoption.php                         29-May-2024 02:08                3475
eventdnsbase.setsearchndots.php                    29-May-2024 02:08                2964
eventhttp.accept.php                               29-May-2024 02:08               12416
eventhttp.addserveralias.php                       29-May-2024 02:08                6476
eventhttp.bind.php                                 29-May-2024 02:08                7877
eventhttp.construct.php                            29-May-2024 02:08               17404
eventhttp.removeserveralias.php                    29-May-2024 02:08                3285
eventhttp.setallowedmethods.php                    29-May-2024 02:08                3427
eventhttp.setcallback.php                          29-May-2024 02:08               18076
eventhttp.setdefaultcallback.php                   29-May-2024 02:08                7894
eventhttp.setmaxbodysize.php                       29-May-2024 02:08                2936
eventhttp.setmaxheaderssize.php                    29-May-2024 02:08                2848
eventhttp.settimeout.php                           29-May-2024 02:08                2541
eventhttpconnection.construct.php                  29-May-2024 02:08                5148
eventhttpconnection.getbase.php                    29-May-2024 02:08                2637
eventhttpconnection.getpeer.php                    29-May-2024 02:08                3057
eventhttpconnection.makerequest.php                29-May-2024 02:08               11684
eventhttpconnection.setclosecallback.php           29-May-2024 02:08                9459
eventhttpconnection.setlocaladdress.php            29-May-2024 02:08                3235
eventhttpconnection.setlocalport.php               29-May-2024 02:08                3129
eventhttpconnection.setmaxbodysize.php             29-May-2024 02:08                3160
eventhttpconnection.setmaxheaderssize.php          29-May-2024 02:08                3181
eventhttpconnection.setretries.php                 29-May-2024 02:08                2771
eventhttpconnection.settimeout.php                 29-May-2024 02:08                2668
eventhttprequest.addheader.php                     29-May-2024 02:08                4007
eventhttprequest.cancel.php                        29-May-2024 02:08                2858
eventhttprequest.clearheaders.php                  29-May-2024 02:08                2804
eventhttprequest.closeconnection.php               29-May-2024 02:08                2413
eventhttprequest.construct.php                     29-May-2024 02:08               11438
eventhttprequest.findheader.php                    29-May-2024 02:08                3571
eventhttprequest.free.php                          29-May-2024 02:08                2321
eventhttprequest.getbufferevent.php                29-May-2024 02:08                3690
eventhttprequest.getcommand.php                    29-May-2024 02:08                2701
eventhttprequest.getconnection.php                 29-May-2024 02:08                4444
eventhttprequest.gethost.php                       29-May-2024 02:08                2872
eventhttprequest.getinputbuffer.php                29-May-2024 02:08                2774
eventhttprequest.getinputheaders.php               29-May-2024 02:08                2865
eventhttprequest.getoutputbuffer.php               29-May-2024 02:08                2833
eventhttprequest.getoutputheaders.php              29-May-2024 02:08                2816
eventhttprequest.getresponsecode.php               29-May-2024 02:08                3152
eventhttprequest.geturi.php                        29-May-2024 02:08                3065
eventhttprequest.removeheader.php                  29-May-2024 02:08                3531
eventhttprequest.senderror.php                     29-May-2024 02:08                5860
eventhttprequest.sendreply.php                     29-May-2024 02:08                4071
eventhttprequest.sendreplychunk.php                29-May-2024 02:08                3443
eventhttprequest.sendreplyend.php                  29-May-2024 02:08                3037
eventhttprequest.sendreplystart.php                29-May-2024 02:08                4330
eventlistener.construct.php                        29-May-2024 02:08               22435
eventlistener.disable.php                          29-May-2024 02:08                2826
eventlistener.enable.php                           29-May-2024 02:08                2812
eventlistener.getbase.php                          29-May-2024 02:08                2340
eventlistener.getsocketname.php                    29-May-2024 02:08                3396
eventlistener.setcallback.php                      29-May-2024 02:08                6049
eventlistener.seterrorcallback.php                 29-May-2024 02:08                4420
eventsslcontext.construct.php                      29-May-2024 02:08                5321
eventutil.construct.php                            29-May-2024 02:08                2173
eventutil.getlastsocketerrno.php                   29-May-2024 02:08                3320
eventutil.getlastsocketerror.php                   29-May-2024 02:08                3136
eventutil.getsocketfd.php                          29-May-2024 02:08                3244
eventutil.getsocketname.php                        29-May-2024 02:08                3799
eventutil.setsocketoption.php                      29-May-2024 02:08                5721
eventutil.sslrandpoll.php                          29-May-2024 02:08                2386
evfork.construct.php                               29-May-2024 02:08                3683
evfork.createstopped.php                           29-May-2024 02:08                3961
evidle.construct.php                               29-May-2024 02:08                3687
evidle.createstopped.php                           29-May-2024 02:08                4159
evio.construct.php                                 29-May-2024 02:08                4835
evio.createstopped.php                             29-May-2024 02:08                5165
evio.set.php                                       29-May-2024 02:08                2853
evloop.backend.php                                 29-May-2024 02:08                2718
evloop.check.php                                   29-May-2024 02:08                3316
evloop.child.php                                   29-May-2024 02:08                3798
evloop.construct.php                               29-May-2024 02:08                4054
evloop.defaultloop.php                             29-May-2024 02:08                4645
evloop.embed.php                                   29-May-2024 02:08                3841
evloop.fork.php                                    29-May-2024 02:08                3398
evloop.idle.php                                    29-May-2024 02:08                3418
evloop.invokepending.php                           29-May-2024 02:08                2228
evloop.io.php                                      29-May-2024 02:08                3854
evloop.loopfork.php                                29-May-2024 02:08                2566
evloop.now.php                                     29-May-2024 02:08                2832
evloop.nowupdate.php                               29-May-2024 02:08                3141
evloop.periodic.php                                29-May-2024 02:08                3992
evloop.prepare.php                                 29-May-2024 02:08                3416
evloop.resume.php                                  29-May-2024 02:08                2801
evloop.run.php                                     29-May-2024 02:08                5050
evloop.signal.php                                  29-May-2024 02:08                3721
evloop.stat.php                                    29-May-2024 02:08                3902
evloop.stop.php                                    29-May-2024 02:08                2980
evloop.suspend.php                                 29-May-2024 02:08                2793
evloop.timer.php                                   29-May-2024 02:08                3919
evloop.verify.php                                  29-May-2024 02:08                2566
evperiodic.again.php                               29-May-2024 02:08                2556
evperiodic.at.php                                  29-May-2024 02:08                2641
evperiodic.construct.php                           29-May-2024 02:08               10035
evperiodic.createstopped.php                       29-May-2024 02:08                5867
evperiodic.set.php                                 29-May-2024 02:08                3210
evprepare.construct.php                            29-May-2024 02:08                3590
evprepare.createstopped.php                        29-May-2024 02:08                4322
evsignal.construct.php                             29-May-2024 02:08                5509
evsignal.createstopped.php                         29-May-2024 02:08                4847
evsignal.set.php                                   29-May-2024 02:08                2510
evstat.attr.php                                    29-May-2024 02:08                8215
evstat.construct.php                               29-May-2024 02:08                7234
evstat.createstopped.php                           29-May-2024 02:08                5223
evstat.prev.php                                    29-May-2024 02:08                2930
evstat.set.php                                     29-May-2024 02:08                2869
evstat.stat.php                                    29-May-2024 02:08                2987
evtimer.again.php                                  29-May-2024 02:08                3051
evtimer.construct.php                              29-May-2024 02:08               12654
evtimer.createstopped.php                          29-May-2024 02:08                8360
evtimer.set.php                                    29-May-2024 02:08                3026
evwatcher.clear.php                                29-May-2024 02:08                2828
evwatcher.construct.php                            29-May-2024 02:08                2114
evwatcher.feed.php                                 29-May-2024 02:08                2623
evwatcher.getloop.php                              29-May-2024 02:08                2314
evwatcher.invoke.php                               29-May-2024 02:08                2630
evwatcher.keepalive.php                            29-May-2024 02:08                5347
evwatcher.setcallback.php                          29-May-2024 02:08                2585
evwatcher.start.php                                29-May-2024 02:08                2498
evwatcher.stop.php                                 29-May-2024 02:08                2467
example.xml-external-entity.php                    29-May-2024 02:08               21291
example.xml-map-tags.php                           29-May-2024 02:08                8125
example.xml-structure.php                          29-May-2024 02:08                6193
example.xmlwriter-namespace.php                    29-May-2024 02:08                5389
example.xmlwriter-oop.php                          29-May-2024 02:08                3397
example.xmlwriter-simple.php                       29-May-2024 02:08                8642
exception.clone.php                                29-May-2024 02:08                3008
exception.construct.php                            29-May-2024 02:08                3738
exception.getcode.php                              29-May-2024 02:08                4446
exception.getfile.php                              29-May-2024 02:08                3786
exception.getline.php                              29-May-2024 02:08                4036
exception.getmessage.php                           29-May-2024 02:08                3898
exception.getprevious.php                          29-May-2024 02:08                6781
exception.gettrace.php                             29-May-2024 02:08                4402
exception.gettraceasstring.php                     29-May-2024 02:08                4176
exception.tostring.php                             29-May-2024 02:08                4117
exec.configuration.php                             29-May-2024 02:08                1215
exec.constants.php                                 29-May-2024 02:08                1162
exec.installation.php                              29-May-2024 02:08                1194
exec.requirements.php                              29-May-2024 02:08                1152
exec.resources.php                                 29-May-2024 02:08                1336
exec.setup.php                                     29-May-2024 02:08                1543
exif.configuration.php                             29-May-2024 02:08                6926
exif.constants.php                                 29-May-2024 02:08                1943
exif.installation.php                              29-May-2024 02:08                1640
exif.requirements.php                              29-May-2024 02:08                1769
exif.resources.php                                 29-May-2024 02:08                1172
exif.setup.php                                     29-May-2024 02:08                1550
expect.configuration.php                           29-May-2024 02:08                5317
expect.constants.php                               29-May-2024 02:08                3819
expect.examples-usage.php                          29-May-2024 02:08               12208
expect.examples.php                                29-May-2024 02:08                1407
expect.installation.php                            29-May-2024 02:08                2241
expect.requirements.php                            29-May-2024 02:08                1304
expect.resources.php                               29-May-2024 02:08                1403
expect.setup.php                                   29-May-2024 02:08                1572
extensions.alphabetical.php                        29-May-2024 02:08               20800
extensions.membership.php                          29-May-2024 02:08               20472
extensions.php                                     29-May-2024 02:08                1634
extensions.state.php                               29-May-2024 02:08                2683
fann.configuration.php                             29-May-2024 02:08                1215
fann.constants.php                                 29-May-2024 02:08               22832
fann.examples-1.php                                29-May-2024 02:08                8578
fann.examples.php                                  29-May-2024 02:08                1373
fann.installation.php                              29-May-2024 02:08                4735
fann.requirements.php                              29-May-2024 02:08                1159
fann.resources.php                                 29-May-2024 02:08                1140
fann.setup.php                                     29-May-2024 02:08                1519
fannconnection.construct.php                       29-May-2024 02:08                2990
fannconnection.getfromneuron.php                   29-May-2024 02:08                2346
fannconnection.gettoneuron.php                     29-May-2024 02:08                2324
fannconnection.getweight.php                       29-May-2024 02:08                2266
fannconnection.setweight.php                       29-May-2024 02:08                2913
faq.build.php                                      29-May-2024 02:08               20782
faq.com.php                                        29-May-2024 02:08               10576
faq.databases.php                                  29-May-2024 02:08                7028
faq.general.php                                    29-May-2024 02:08                4600
faq.html.php                                       29-May-2024 02:08               18390
faq.installation.php                               29-May-2024 02:08               23971
faq.mailinglist.php                                29-May-2024 02:08                9177
faq.misc.php                                       29-May-2024 02:08                4080
faq.obtaining.php                                  29-May-2024 02:08               10493
faq.passwords.php                                  29-May-2024 02:08                9440
faq.php                                            29-May-2024 02:08                1988
faq.using.php                                      29-May-2024 02:08               22313
fdf.configuration.php                              29-May-2024 02:08                1208
fdf.constants.php                                  29-May-2024 02:08                9156
fdf.examples.php                                   29-May-2024 02:08                6017
fdf.installation.php                               29-May-2024 02:08                3204
fdf.requirements.php                               29-May-2024 02:08                1496
fdf.resources.php                                  29-May-2024 02:08                1700
fdf.setup.php                                      29-May-2024 02:08                1527
features.commandline.differences.php               29-May-2024 02:08               11437
features.commandline.ini.php                       29-May-2024 02:08                2214
features.commandline.interactive.php               29-May-2024 02:08                8213
features.commandline.io-streams.php                29-May-2024 02:08                5798
features.commandline.options.php                   29-May-2024 02:08               24426
features.commandline.php                           29-May-2024 02:08                7115
features.commandline.usage.php                     29-May-2024 02:08               13207
features.commandline.webserver.php                 29-May-2024 02:08               12592
features.connection-handling.php                   29-May-2024 02:08                4631
features.cookies.php                               29-May-2024 02:08                2852
features.dtrace.dtrace.php                         29-May-2024 02:08               13654
features.dtrace.introduction.php                   29-May-2024 02:08                2895
features.dtrace.php                                29-May-2024 02:08                1643
features.dtrace.systemtap.php                      29-May-2024 02:08                8004
features.file-upload.common-pitfalls.php           29-May-2024 02:08                4711
features.file-upload.errors.php                    29-May-2024 02:08                3518
features.file-upload.errors.seealso.php            29-May-2024 02:08                1341
features.file-upload.multiple.php                  29-May-2024 02:08                4426
features.file-upload.php                           29-May-2024 02:08                1838
features.file-upload.post-method.php               29-May-2024 02:08               14772
features.file-upload.put-method.php                29-May-2024 02:08                5550
features.gc.collecting-cycles.php                  29-May-2024 02:08                7091
features.gc.performance-considerations.php         29-May-2024 02:08               12707
features.gc.php                                    29-May-2024 02:08                1697
features.gc.refcounting-basics.php                 29-May-2024 02:08               19922
features.http-auth.php                             29-May-2024 02:08               22157
features.persistent-connections.php                29-May-2024 02:08                7259
features.php                                       29-May-2024 02:08                3811
features.remote-files.php                          29-May-2024 02:08                7472
features.session.security.management.php           29-May-2024 02:08               24844
features.sessions.php                              29-May-2024 02:08                1360
features.xforms.php                                29-May-2024 02:08                5066
ffi-ctype.getalignment.php                         29-May-2024 02:08                2308
ffi-ctype.getarrayelementtype.php                  29-May-2024 02:08                2394
ffi-ctype.getarraylength.php                       29-May-2024 02:08                2351
ffi-ctype.getattributes.php                        29-May-2024 02:08                2327
ffi-ctype.getenumkind.php                          29-May-2024 02:08                2303
ffi-ctype.getfuncabi.php                           29-May-2024 02:08                2311
ffi-ctype.getfuncparametercount.php                29-May-2024 02:08                2417
ffi-ctype.getfuncparametertype.php                 29-May-2024 02:08                2670
ffi-ctype.getfuncreturntype.php                    29-May-2024 02:08                2376
ffi-ctype.getkind.php                              29-May-2024 02:08                2265
ffi-ctype.getname.php                              29-May-2024 02:08                2271
ffi-ctype.getpointertype.php                       29-May-2024 02:08                2320
ffi-ctype.getsize.php                              29-May-2024 02:08                2283
ffi-ctype.getstructfieldnames.php                  29-May-2024 02:08                2393
ffi-ctype.getstructfieldoffset.php                 29-May-2024 02:08                2666
ffi-ctype.getstructfieldtype.php                   29-May-2024 02:08                2628
ffi.addr.php                                       29-May-2024 02:08                2790
ffi.alignof.php                                    29-May-2024 02:08                2920
ffi.arraytype.php                                  29-May-2024 02:08                4620
ffi.cast.php                                       29-May-2024 02:08                4824
ffi.cdef.php                                       29-May-2024 02:08                4446
ffi.configuration.php                              29-May-2024 02:08                4218
ffi.constants.php                                  29-May-2024 02:08                1139
ffi.examples-basic.php                             29-May-2024 02:08               15555
ffi.examples-callback.php                          29-May-2024 02:08                4887
ffi.examples-complete.php                          29-May-2024 02:08                5338
ffi.examples.php                                   29-May-2024 02:08                1514
ffi.free.php                                       29-May-2024 02:08                2424
ffi.installation.php                               29-May-2024 02:08                1407
ffi.isnull.php                                     29-May-2024 02:08                2533
ffi.load.php                                       29-May-2024 02:08                4297
ffi.memcmp.php                                     29-May-2024 02:08                4098
ffi.memcpy.php                                     29-May-2024 02:08                3276
ffi.memset.php                                     29-May-2024 02:08                3116
ffi.new.php                                        29-May-2024 02:08                5156
ffi.requirements.php                               29-May-2024 02:08                1255
ffi.resources.php                                  29-May-2024 02:08                1165
ffi.scope.php                                      29-May-2024 02:08                3136
ffi.setup.php                                      29-May-2024 02:08                1517
ffi.sizeof.php                                     29-May-2024 02:08                2761
ffi.string.php                                     29-May-2024 02:08                4193
ffi.type.php                                       29-May-2024 02:08                3570
ffi.typeof.php                                     29-May-2024 02:08                2854
fiber.construct.php                                29-May-2024 02:08                2332
fiber.getcurrent.php                               29-May-2024 02:08                2495
fiber.getreturn.php                                29-May-2024 02:08                2539
fiber.isrunning.php                                29-May-2024 02:08                2701
fiber.isstarted.php                                29-May-2024 02:08                2307
fiber.issuspended.php                              29-May-2024 02:08                2324
fiber.isterminated.php                             29-May-2024 02:08                2377
fiber.resume.php                                   29-May-2024 02:08                3285
fiber.start.php                                    29-May-2024 02:08                2944
fiber.suspend.php                                  29-May-2024 02:08                3984
fiber.throw.php                                    29-May-2024 02:08                3153
fibererror.construct.php                           29-May-2024 02:08                2151
fileinfo.configuration.php                         29-May-2024 02:08                1243
fileinfo.constants.php                             29-May-2024 02:08                5967
fileinfo.installation.php                          29-May-2024 02:08                1647
fileinfo.requirements.php                          29-May-2024 02:08                1180
fileinfo.resources.php                             29-May-2024 02:08                1377
fileinfo.setup.php                                 29-May-2024 02:08                1594
filesystem.configuration.php                       29-May-2024 02:08                7193
filesystem.constants.php                           29-May-2024 02:08               13207
filesystem.installation.php                        29-May-2024 02:08                1236
filesystem.requirements.php                        29-May-2024 02:08                1194
filesystem.resources.php                           29-May-2024 02:08                1357
filesystem.setup.php                               29-May-2024 02:08                1622
filesystemiterator.construct.php                   29-May-2024 02:08                7518
filesystemiterator.current.php                     29-May-2024 02:08                5359
filesystemiterator.getflags.php                    29-May-2024 02:08                3187
filesystemiterator.key.php                         29-May-2024 02:08                5077
filesystemiterator.next.php                        29-May-2024 02:08                4465
filesystemiterator.rewind.php                      29-May-2024 02:08                5094
filesystemiterator.setflags.php                    29-May-2024 02:08                6641
filter.configuration.php                           29-May-2024 02:08                4843
filter.constants.php                               29-May-2024 02:08               25141
filter.examples.php                                29-May-2024 02:08                1457
filter.examples.sanitization.php                   29-May-2024 02:08                5541
filter.examples.validation.php                     29-May-2024 02:08               10097
filter.filters.flags.php                           29-May-2024 02:08               16855
filter.filters.misc.php                            29-May-2024 02:08                1951
filter.filters.php                                 29-May-2024 02:08                1629
filter.filters.sanitize.php                        29-May-2024 02:08               13624
filter.filters.validate.php                        29-May-2024 02:08               13628
filter.installation.php                            29-May-2024 02:08                1270
filter.requirements.php                            29-May-2024 02:08                1166
filter.resources.php                               29-May-2024 02:08                1184
filter.setup.php                                   29-May-2024 02:08                1561
filteriterator.accept.php                          29-May-2024 02:08                5275
filteriterator.construct.php                       29-May-2024 02:08                3047
filteriterator.current.php                         29-May-2024 02:08                2917
filteriterator.key.php                             29-May-2024 02:08                2857
filteriterator.next.php                            29-May-2024 02:08                2867
filteriterator.rewind.php                          29-May-2024 02:08                3045
filteriterator.valid.php                           29-May-2024 02:08                2806
filters.compression.php                            29-May-2024 02:08               14768
filters.convert.php                                29-May-2024 02:08               11229
filters.encryption.php                             29-May-2024 02:08               40994
filters.php                                        29-May-2024 02:08                3019
filters.string.php                                 29-May-2024 02:08                9795
finfo.buffer.php                                   29-May-2024 02:08                2901
finfo.construct.php                                29-May-2024 02:08                3068
finfo.file.php                                     29-May-2024 02:08                2892
finfo.set-flags.php                                29-May-2024 02:08                2107
fpm.observability.php                              29-May-2024 02:08                1401
fpm.setup.php                                      29-May-2024 02:08                1271
fpm.status.php                                     29-May-2024 02:08                9272
ftp.configuration.php                              29-May-2024 02:08                1208
ftp.constants.php                                  29-May-2024 02:08                5226
ftp.examples-basic.php                             29-May-2024 02:08                4774
ftp.examples.php                                   29-May-2024 02:08                1359
ftp.installation.php                               29-May-2024 02:08                1409
ftp.requirements.php                               29-May-2024 02:08                1145
ftp.resources.php                                  29-May-2024 02:08                1452
ftp.setup.php                                      29-May-2024 02:08                1529
funchand.configuration.php                         29-May-2024 02:08                1243
funchand.constants.php                             29-May-2024 02:08                1191
funchand.installation.php                          29-May-2024 02:08                1222
funchand.requirements.php                          29-May-2024 02:08                1180
funchand.resources.php                             29-May-2024 02:08                1200
funchand.setup.php                                 29-May-2024 02:08                1575
funcref.php                                        29-May-2024 02:08               13658
function.abs.php                                   29-May-2024 02:08                5487
function.acos.php                                  29-May-2024 02:08                3423
function.acosh.php                                 29-May-2024 02:08                3166
function.addcslashes.php                           29-May-2024 02:08                7635
function.addslashes.php                            29-May-2024 02:08                6115
function.apache-child-terminate.php                29-May-2024 02:08                3286
function.apache-get-modules.php                    29-May-2024 02:08                3319
function.apache-get-version.php                    29-May-2024 02:08                3874
function.apache-getenv.php                         29-May-2024 02:08                5049
function.apache-lookup-uri.php                     29-May-2024 02:08                5765
function.apache-note.php                           29-May-2024 02:08                7137
function.apache-request-headers.php                29-May-2024 02:08                5558
function.apache-response-headers.php               29-May-2024 02:08                4324
function.apache-setenv.php                         29-May-2024 02:08                5621
function.apcu-add.php                              29-May-2024 02:08                8306
function.apcu-cache-info.php                       29-May-2024 02:08                6622
function.apcu-cas.php                              29-May-2024 02:08                8757
function.apcu-clear-cache.php                      29-May-2024 02:08                2577
function.apcu-dec.php                              29-May-2024 02:08                8230
function.apcu-delete.php                           29-May-2024 02:08                6077
function.apcu-enabled.php                          29-May-2024 02:08                2387
function.apcu-entry.php                            29-May-2024 02:08                8442
function.apcu-exists.php                           29-May-2024 02:08                6920
function.apcu-fetch.php                            29-May-2024 02:08                5763
function.apcu-inc.php                              29-May-2024 02:08                8214
function.apcu-key-info.php                         29-May-2024 02:08                4962
function.apcu-sma-info.php                         29-May-2024 02:08                4604
function.apcu-store.php                            29-May-2024 02:08                7264
function.array-change-key-case.php                 29-May-2024 02:08                5416
function.array-chunk.php                           29-May-2024 02:08                7879
function.array-column.php                          29-May-2024 02:08               16462
function.array-combine.php                         29-May-2024 02:08                7499
function.array-count-values.php                    29-May-2024 02:08                5949
function.array-diff-assoc.php                      29-May-2024 02:08               10888
function.array-diff-key.php                        29-May-2024 02:08               12244
function.array-diff-uassoc.php                     29-May-2024 02:08               11389
function.array-diff-ukey.php                       29-May-2024 02:08               11727
function.array-diff.php                            29-May-2024 02:08               11877
function.array-fill-keys.php                       29-May-2024 02:08                5226
function.array-fill.php                            29-May-2024 02:08                8872
function.array-filter.php                          29-May-2024 02:08               16728
function.array-flip.php                            29-May-2024 02:08                7080
function.array-intersect-assoc.php                 29-May-2024 02:08                8526
function.array-intersect-key.php                   29-May-2024 02:08                9617
function.array-intersect-uassoc.php                29-May-2024 02:08                8719
function.array-intersect-ukey.php                  29-May-2024 02:08               11420
function.array-intersect.php                       29-May-2024 02:08                6822
function.array-is-list.php                         29-May-2024 02:08                7048
function.array-key-exists.php                      29-May-2024 02:08                9847
function.array-key-first.php                       29-May-2024 02:08                6997
function.array-key-last.php                        29-May-2024 02:08                3394
function.array-keys.php                            29-May-2024 02:08                8392
function.array-map.php                             29-May-2024 02:08               27167
function.array-merge-recursive.php                 29-May-2024 02:08                6826
function.array-merge.php                           29-May-2024 02:08               12292
function.array-multisort.php                       29-May-2024 02:08               23302
function.array-pad.php                             29-May-2024 02:08                7447
function.array-pop.php                             29-May-2024 02:08                5676
function.array-product.php                         29-May-2024 02:08                5719
function.array-push.php                            29-May-2024 02:08                7170
function.array-rand.php                            29-May-2024 02:08                9248
function.array-reduce.php                          29-May-2024 02:08                9815
function.array-replace-recursive.php               29-May-2024 02:08               11101
function.array-replace.php                         29-May-2024 02:08                6777
function.array-reverse.php                         29-May-2024 02:08                6202
function.array-search.php                          29-May-2024 02:08                8272
function.array-shift.php                           29-May-2024 02:08                5742
function.array-slice.php                           29-May-2024 02:08               13721
function.array-splice.php                          29-May-2024 02:08               17548
function.array-sum.php                             29-May-2024 02:08                6375
function.array-udiff-assoc.php                     29-May-2024 02:08               17315
function.array-udiff-uassoc.php                    29-May-2024 02:08               18831
function.array-udiff.php                           29-May-2024 02:08               29478
function.array-uintersect-assoc.php                29-May-2024 02:08               11625
function.array-uintersect-uassoc.php               29-May-2024 02:08               11878
function.array-uintersect.php                      29-May-2024 02:08               11543
function.array-unique.php                          29-May-2024 02:08                9600
function.array-unshift.php                         29-May-2024 02:08               10942
function.array-values.php                          29-May-2024 02:08                4576
function.array-walk-recursive.php                  29-May-2024 02:08                7551
function.array-walk.php                            29-May-2024 02:08               13517
function.array.php                                 29-May-2024 02:08               11263
function.arsort.php                                29-May-2024 02:08                9055
function.asin.php                                  29-May-2024 02:08                3428
function.asinh.php                                 29-May-2024 02:08                3183
function.asort.php                                 29-May-2024 02:08                9044
function.assert-options.php                        29-May-2024 02:08               13706
function.assert.php                                29-May-2024 02:08               21950
function.atan.php                                  29-May-2024 02:08                3428
function.atan2.php                                 29-May-2024 02:08                3400
function.atanh.php                                 29-May-2024 02:08                3190
function.autoload.php                              29-May-2024 02:08                3100
function.base-convert.php                          29-May-2024 02:08                6345
function.base64-decode.php                         29-May-2024 02:08                5076
function.base64-encode.php                         29-May-2024 02:08                4651
function.basename.php                              29-May-2024 02:08                7367
function.bcadd.php                                 29-May-2024 02:08                5783
function.bccomp.php                                29-May-2024 02:08                5701
function.bcdiv.php                                 29-May-2024 02:08                5350
function.bcmod.php                                 29-May-2024 02:08                7408
function.bcmul.php                                 29-May-2024 02:08                7145
function.bcpow.php                                 29-May-2024 02:08                7097
function.bcpowmod.php                              29-May-2024 02:08                7286
function.bcscale.php                               29-May-2024 02:08                5530
function.bcsqrt.php                                29-May-2024 02:08                6146
function.bcsub.php                                 29-May-2024 02:08                5756
function.bin2hex.php                               29-May-2024 02:08                4454
function.bind-textdomain-codeset.php               29-May-2024 02:08                4590
function.bindec.php                                29-May-2024 02:08               14745
function.bindtextdomain.php                        29-May-2024 02:08                5526
function.boolval.php                               29-May-2024 02:08               10099
function.bzclose.php                               29-May-2024 02:08                3049
function.bzcompress.php                            29-May-2024 02:08                5105
function.bzdecompress.php                          29-May-2024 02:08                6523
function.bzerrno.php                               29-May-2024 02:08                3100
function.bzerror.php                               29-May-2024 02:08                4308
function.bzerrstr.php                              29-May-2024 02:08                3117
function.bzflush.php                               29-May-2024 02:08                3347
function.bzopen.php                                29-May-2024 02:08                5227
function.bzread.php                                29-May-2024 02:08                6478
function.bzwrite.php                               29-May-2024 02:08                6342
function.cal-days-in-month.php                     29-May-2024 02:08                4536
function.cal-from-jd.php                           29-May-2024 02:08                6885
function.cal-info.php                              29-May-2024 02:08                6015
function.cal-to-jd.php                             29-May-2024 02:08                5878
function.call-user-func-array.php                  29-May-2024 02:08               17373
function.call-user-func.php                        29-May-2024 02:08               14289
function.ceil.php                                  29-May-2024 02:08                5089
function.chdir.php                                 29-May-2024 02:08                5521
function.checkdate.php                             29-May-2024 02:08                5496
function.checkdnsrr.php                            29-May-2024 02:08                5003
function.chgrp.php                                 29-May-2024 02:08                6655
function.chmod.php                                 29-May-2024 02:08                8532
function.chop.php                                  29-May-2024 02:08                2048
function.chown.php                                 29-May-2024 02:08                6753
function.chr.php                                   29-May-2024 02:08                8606
function.chroot.php                                29-May-2024 02:08                4510
function.chunk-split.php                           29-May-2024 02:08                5188
function.class-alias.php                           29-May-2024 02:08                8818
function.class-exists.php                          29-May-2024 02:08                6942
function.class-implements.php                      29-May-2024 02:08                7151
function.class-parents.php                         29-May-2024 02:08                6860
function.class-uses.php                            29-May-2024 02:08                6275
function.clearstatcache.php                        29-May-2024 02:08               10685
function.cli-get-process-title.php                 29-May-2024 02:08                4476
function.cli-set-process-title.php                 29-May-2024 02:08                5554
function.closedir.php                              29-May-2024 02:08                4819
function.closelog.php                              29-May-2024 02:08                2823
function.com-create-guid.php                       29-May-2024 02:08                2855
function.com-event-sink.php                        29-May-2024 02:08               10406
function.com-get-active-object.php                 29-May-2024 02:08                5688
function.com-load-typelib.php                      29-May-2024 02:08                4964
function.com-message-pump.php                      29-May-2024 02:08                4080
function.com-print-typeinfo.php                    29-May-2024 02:08                5156
function.commonmark-parse.php                      29-May-2024 02:08                4158
function.commonmark-render-html.php                29-May-2024 02:08                4668
function.commonmark-render-latex.php               29-May-2024 02:08                4998
function.commonmark-render-man.php                 29-May-2024 02:08                4980
function.commonmark-render-xml.php                 29-May-2024 02:08                4625
function.commonmark-render.php                     29-May-2024 02:08                4926
function.compact.php                               29-May-2024 02:08                8087
function.connection-aborted.php                    29-May-2024 02:08                2938
function.connection-status.php                     29-May-2024 02:08                3076
function.constant.php                              29-May-2024 02:08                9034
function.convert-cyr-string.php                    29-May-2024 02:08                5099
function.convert-uudecode.php                      29-May-2024 02:08                4523
function.convert-uuencode.php                      29-May-2024 02:08                5424
function.copy.php                                  29-May-2024 02:08                5971
function.cos.php                                   29-May-2024 02:08                3907
function.cosh.php                                  29-May-2024 02:08                3146
function.count-chars.php                           29-May-2024 02:08                7297
function.count.php                                 29-May-2024 02:08               15848
function.crc32.php                                 29-May-2024 02:08                6560
function.create-function.php                       29-May-2024 02:08               30786
function.crypt.php                                 29-May-2024 02:08               12419
function.ctype-alnum.php                           29-May-2024 02:08                6505
function.ctype-alpha.php                           29-May-2024 02:08                6874
function.ctype-cntrl.php                           29-May-2024 02:08                6527
function.ctype-digit.php                           29-May-2024 02:08                8606
function.ctype-graph.php                           29-May-2024 02:08                7167
function.ctype-lower.php                           29-May-2024 02:08                6675
function.ctype-print.php                           29-May-2024 02:08                7240
function.ctype-punct.php                           29-May-2024 02:08                6575
function.ctype-space.php                           29-May-2024 02:08                7259
function.ctype-upper.php                           29-May-2024 02:08                6724
function.ctype-xdigit.php                          29-May-2024 02:08                6462
function.cubrid-affected-rows.php                  29-May-2024 02:08                9387
function.cubrid-bind.php                           29-May-2024 02:08               20685
function.cubrid-client-encoding.php                29-May-2024 02:08                5275
function.cubrid-close-prepare.php                  29-May-2024 02:08                6263
function.cubrid-close-request.php                  29-May-2024 02:08                6274
function.cubrid-close.php                          29-May-2024 02:08                6401
function.cubrid-col-get.php                        29-May-2024 02:08                8563
function.cubrid-col-size.php                       29-May-2024 02:08                8662
function.cubrid-column-names.php                   29-May-2024 02:08                8507
function.cubrid-column-types.php                   29-May-2024 02:08                8487
function.cubrid-commit.php                         29-May-2024 02:08               15325
function.cubrid-connect-with-url.php               29-May-2024 02:08               15116
function.cubrid-connect.php                        29-May-2024 02:08               12321
function.cubrid-current-oid.php                    29-May-2024 02:08                5988
function.cubrid-data-seek.php                      29-May-2024 02:08                7465
function.cubrid-db-name.php                        29-May-2024 02:08                6547
function.cubrid-disconnect.php                     29-May-2024 02:08                7137
function.cubrid-drop.php                           29-May-2024 02:08               11420
function.cubrid-errno.php                          29-May-2024 02:08                6804
function.cubrid-error-code-facility.php            29-May-2024 02:08                5807
function.cubrid-error-code.php                     29-May-2024 02:08                5717
function.cubrid-error-msg.php                      29-May-2024 02:08                5167
function.cubrid-error.php                          29-May-2024 02:08                6364
function.cubrid-execute.php                        29-May-2024 02:08               14361
function.cubrid-fetch-array.php                    29-May-2024 02:08                9805
function.cubrid-fetch-assoc.php                    29-May-2024 02:08                9039
function.cubrid-fetch-field.php                    29-May-2024 02:08               14077
function.cubrid-fetch-lengths.php                  29-May-2024 02:08                6129
function.cubrid-fetch-object.php                   29-May-2024 02:08               11984
function.cubrid-fetch-row.php                      29-May-2024 02:08                8963
function.cubrid-fetch.php                          29-May-2024 02:08                9942
function.cubrid-field-flags.php                    29-May-2024 02:08                7785
function.cubrid-field-len.php                      29-May-2024 02:08                8325
function.cubrid-field-name.php                     29-May-2024 02:08                7200
function.cubrid-field-seek.php                     29-May-2024 02:08               10952
function.cubrid-field-table.php                    29-May-2024 02:08                7405
function.cubrid-field-type.php                     29-May-2024 02:08                7467
function.cubrid-free-result.php                    29-May-2024 02:08                5939
function.cubrid-get-autocommit.php                 29-May-2024 02:08                3812
function.cubrid-get-charset.php                    29-May-2024 02:08                5000
function.cubrid-get-class-name.php                 29-May-2024 02:08                6330
function.cubrid-get-client-info.php                29-May-2024 02:08                8140
function.cubrid-get-db-parameter.php               29-May-2024 02:08               14278
function.cubrid-get-query-timeout.php              29-May-2024 02:08                6716
function.cubrid-get-server-info.php                29-May-2024 02:08                8431
function.cubrid-get.php                            29-May-2024 02:08                9852
function.cubrid-insert-id.php                      29-May-2024 02:08                7134
function.cubrid-is-instance.php                    29-May-2024 02:08                7176
function.cubrid-list-dbs.php                       29-May-2024 02:08                4547
function.cubrid-load-from-glo.php                  29-May-2024 02:08                6861
function.cubrid-lob-close.php                      29-May-2024 02:08                7256
function.cubrid-lob-export.php                     29-May-2024 02:08                7835
function.cubrid-lob-get.php                        29-May-2024 02:08                7638
function.cubrid-lob-send.php                       29-May-2024 02:08                7010
function.cubrid-lob-size.php                       29-May-2024 02:08                5827
function.cubrid-lob2-bind.php                      29-May-2024 02:08                9720
function.cubrid-lob2-close.php                     29-May-2024 02:08                3414
function.cubrid-lob2-export.php                    29-May-2024 02:08                8713
function.cubrid-lob2-import.php                    29-May-2024 02:08                8582
function.cubrid-lob2-new.php                       29-May-2024 02:08                3938
function.cubrid-lob2-read.php                      29-May-2024 02:08               13692
function.cubrid-lob2-seek.php                      29-May-2024 02:08               11244
function.cubrid-lob2-seek64.php                    29-May-2024 02:08               12680
function.cubrid-lob2-size.php                      29-May-2024 02:08                4319
function.cubrid-lob2-size64.php                    29-May-2024 02:08                4499
function.cubrid-lob2-tell.php                      29-May-2024 02:08                4338
function.cubrid-lob2-tell64.php                    29-May-2024 02:08                4536
function.cubrid-lob2-write.php                     29-May-2024 02:08               14005
function.cubrid-lock-read.php                      29-May-2024 02:08                9141
function.cubrid-lock-write.php                     29-May-2024 02:08                9529
function.cubrid-move-cursor.php                    29-May-2024 02:08                9513
function.cubrid-new-glo.php                        29-May-2024 02:08                6918
function.cubrid-next-result.php                    29-May-2024 02:08               16300
function.cubrid-num-cols.php                       29-May-2024 02:08                5973
function.cubrid-num-fields.php                     29-May-2024 02:08                5694
function.cubrid-num-rows.php                       29-May-2024 02:08                7157
function.cubrid-pconnect-with-url.php              29-May-2024 02:08               14443
function.cubrid-pconnect.php                       29-May-2024 02:08               12102
function.cubrid-ping.php                           29-May-2024 02:08                6089
function.cubrid-prepare.php                        29-May-2024 02:08               10257
function.cubrid-put.php                            29-May-2024 02:08               11362
function.cubrid-query.php                          29-May-2024 02:08               14720
function.cubrid-real-escape-string.php             29-May-2024 02:08                8215
function.cubrid-result.php                         29-May-2024 02:08                7425
function.cubrid-rollback.php                       29-May-2024 02:08               14620
function.cubrid-save-to-glo.php                    29-May-2024 02:08                6780
function.cubrid-schema.php                         29-May-2024 02:08               20453
function.cubrid-send-glo.php                       29-May-2024 02:08                6247
function.cubrid-seq-drop.php                       29-May-2024 02:08                9790
function.cubrid-seq-insert.php                     29-May-2024 02:08               10296
function.cubrid-seq-put.php                        29-May-2024 02:08               10223
function.cubrid-set-add.php                        29-May-2024 02:08                9562
function.cubrid-set-autocommit.php                 29-May-2024 02:08                4177
function.cubrid-set-db-parameter.php               29-May-2024 02:08                8179
function.cubrid-set-drop.php                       29-May-2024 02:08                9539
function.cubrid-set-query-timeout.php              29-May-2024 02:08                3565
function.cubrid-unbuffered-query.php               29-May-2024 02:08                7014
function.cubrid-version.php                        29-May-2024 02:08                8661
function.curl-close.php                            29-May-2024 02:08                5838
function.curl-copy-handle.php                      29-May-2024 02:08                6244
function.curl-errno.php                            29-May-2024 02:08                5923
function.curl-error.php                            29-May-2024 02:08                5860
function.curl-escape.php                           29-May-2024 02:08                7415
function.curl-exec.php                             29-May-2024 02:08                7149
function.curl-getinfo.php                          29-May-2024 02:08               41941
function.curl-init.php                             29-May-2024 02:08                7070
function.curl-multi-add-handle.php                 29-May-2024 02:08               10020
function.curl-multi-close.php                      29-May-2024 02:08                9397
function.curl-multi-errno.php                      29-May-2024 02:08                3839
function.curl-multi-exec.php                       29-May-2024 02:08               10031
function.curl-multi-getcontent.php                 29-May-2024 02:08                4325
function.curl-multi-info-read.php                  29-May-2024 02:08               11826
function.curl-multi-init.php                       29-May-2024 02:08                8525
function.curl-multi-remove-handle.php              29-May-2024 02:08                5283
function.curl-multi-select.php                     29-May-2024 02:08                4216
function.curl-multi-setopt.php                     29-May-2024 02:08               12335
function.curl-multi-strerror.php                   29-May-2024 02:08                7018
function.curl-pause.php                            29-May-2024 02:08                3839
function.curl-reset.php                            29-May-2024 02:08                6240
function.curl-setopt-array.php                     29-May-2024 02:08                7461
function.curl-setopt.php                           29-May-2024 02:08              150976
function.curl-share-close.php                      29-May-2024 02:08                7807
function.curl-share-errno.php                      29-May-2024 02:08                3859
function.curl-share-init.php                       29-May-2024 02:08                7364
function.curl-share-setopt.php                     29-May-2024 02:08                9968
function.curl-share-strerror.php                   29-May-2024 02:08                3370
function.curl-strerror.php                         29-May-2024 02:08                6115
function.curl-unescape.php                         29-May-2024 02:08                7861
function.curl-version.php                          29-May-2024 02:08                6572
function.curl_upkeep.php                           29-May-2024 02:08                6859
function.current.php                               29-May-2024 02:08               10967
function.date-add.php                              29-May-2024 02:08                1740
function.date-create-from-format.php               29-May-2024 02:08                1915
function.date-create-immutable-from-format.php     29-May-2024 02:08                2027
function.date-create-immutable.php                 29-May-2024 02:08                4256
function.date-create.php                           29-May-2024 02:08                4411
function.date-date-set.php                         29-May-2024 02:08                1799
function.date-default-timezone-get.php             29-May-2024 02:08                6808
function.date-default-timezone-set.php             29-May-2024 02:08                5463
function.date-diff.php                             29-May-2024 02:08                1759
function.date-format.php                           29-May-2024 02:08                1767
function.date-get-last-errors.php                  29-May-2024 02:08                1932
function.date-interval-create-from-date-string.php 29-May-2024 02:08                2043
function.date-interval-format.php                  29-May-2024 02:08                1894
function.date-isodate-set.php                      29-May-2024 02:08                1822
function.date-modify.php                           29-May-2024 02:08                1771
function.date-offset-get.php                       29-May-2024 02:08                1815
function.date-parse-from-format.php                29-May-2024 02:08               13733
function.date-parse.php                            29-May-2024 02:08               18844
function.date-sub.php                              29-May-2024 02:08                2323
function.date-sun-info.php                         29-May-2024 02:08               15706
function.date-sunrise.php                          29-May-2024 02:08               14072
function.date-sunset.php                           29-May-2024 02:08               14071
function.date-time-set.php                         29-May-2024 02:08                1785
function.date-timestamp-get.php                    29-May-2024 02:08                1844
function.date-timestamp-set.php                    29-May-2024 02:08                1852
function.date-timezone-get.php                     29-May-2024 02:08                1841
function.date-timezone-set.php                     29-May-2024 02:08                1813
function.date.php                                  29-May-2024 02:08               21123
function.db2-autocommit.php                        29-May-2024 02:08               11049
function.db2-bind-param.php                        29-May-2024 02:08               22822
function.db2-client-info.php                       29-May-2024 02:08               11626
function.db2-close.php                             29-May-2024 02:08                5640
function.db2-column-privileges.php                 29-May-2024 02:08                9148
function.db2-columns.php                           29-May-2024 02:08               11197
function.db2-commit.php                            29-May-2024 02:08                3721
function.db2-conn-error.php                        29-May-2024 02:08                6922
function.db2-conn-errormsg.php                     29-May-2024 02:08                6732
function.db2-connect.php                           29-May-2024 02:08               39169
function.db2-cursor-type.php                       29-May-2024 02:08                3318
function.db2-escape-string.php                     29-May-2024 02:08                7559
function.db2-exec.php                              29-May-2024 02:08               26285
function.db2-execute.php                           29-May-2024 02:08               25596
function.db2-fetch-array.php                       29-May-2024 02:08               11261
function.db2-fetch-assoc.php                       29-May-2024 02:08               11277
function.db2-fetch-both.php                        29-May-2024 02:08               11810
function.db2-fetch-object.php                      29-May-2024 02:08                8997
function.db2-fetch-row.php                         29-May-2024 02:08               16274
function.db2-field-display-size.php                29-May-2024 02:08                5112
function.db2-field-name.php                        29-May-2024 02:08                5000
function.db2-field-num.php                         29-May-2024 02:08                5008
function.db2-field-precision.php                   29-May-2024 02:08                5040
function.db2-field-scale.php                       29-May-2024 02:08                5002
function.db2-field-type.php                        29-May-2024 02:08                5005
function.db2-field-width.php                       29-May-2024 02:08                5210
function.db2-foreign-keys.php                      29-May-2024 02:08                9053
function.db2-free-result.php                       29-May-2024 02:08                3379
function.db2-free-stmt.php                         29-May-2024 02:08                3367
function.db2-get-option.php                        29-May-2024 02:08               24079
function.db2-last-insert-id.php                    29-May-2024 02:08                8164
function.db2-lob-read.php                          29-May-2024 02:08               16366
function.db2-next-result.php                       29-May-2024 02:08                8814
function.db2-num-fields.php                        29-May-2024 02:08                7153
function.db2-num-rows.php                          29-May-2024 02:08                4742
function.db2-pclose.php                            29-May-2024 02:08                5835
function.db2-pconnect.php                          29-May-2024 02:08               32220
function.db2-prepare.php                           29-May-2024 02:08               10565
function.db2-primary-keys.php                      29-May-2024 02:08                7687
function.db2-procedure-columns.php                 29-May-2024 02:08               12155
function.db2-procedures.php                        29-May-2024 02:08                8016
function.db2-result.php                            29-May-2024 02:08                7956
function.db2-rollback.php                          29-May-2024 02:08                9292
function.db2-server-info.php                       29-May-2024 02:08               22472
function.db2-set-option.php                        29-May-2024 02:08               67252
function.db2-special-columns.php                   29-May-2024 02:08               10268
function.db2-statistics.php                        29-May-2024 02:08               12539
function.db2-stmt-error.php                        29-May-2024 02:08                4617
function.db2-stmt-errormsg.php                     29-May-2024 02:08                4248
function.db2-table-privileges.php                  29-May-2024 02:08                8577
function.db2-tables.php                            29-May-2024 02:08                8907
function.dba-close.php                             29-May-2024 02:08                3173
function.dba-delete.php                            29-May-2024 02:08                4125
function.dba-exists.php                            29-May-2024 02:08                4157
function.dba-fetch.php                             29-May-2024 02:08                7097
function.dba-firstkey.php                          29-May-2024 02:08                3647
function.dba-handlers.php                          29-May-2024 02:08                5506
function.dba-insert.php                            29-May-2024 02:08                4763
function.dba-key-split.php                         29-May-2024 02:08                3946
function.dba-list.php                              29-May-2024 02:08                2221
function.dba-nextkey.php                           29-May-2024 02:08                3569
function.dba-open.php                              29-May-2024 02:08               13815
function.dba-optimize.php                          29-May-2024 02:08                3209
function.dba-popen.php                             29-May-2024 02:08                9143
function.dba-replace.php                           29-May-2024 02:08                4591
function.dba-sync.php                              29-May-2024 02:08                3229
function.dbase-add-record.php                      29-May-2024 02:08                6900
function.dbase-close.php                           29-May-2024 02:08                5240
function.dbase-create.php                          29-May-2024 02:08                8216
function.dbase-delete-record.php                   29-May-2024 02:08                4984
function.dbase-get-header-info.php                 29-May-2024 02:08                6993
function.dbase-get-record-with-names.php           29-May-2024 02:08                8801
function.dbase-get-record.php                      29-May-2024 02:08                5753
function.dbase-numfields.php                       29-May-2024 02:08                5956
function.dbase-numrecords.php                      29-May-2024 02:08                6904
function.dbase-open.php                            29-May-2024 02:08                6556
function.dbase-pack.php                            29-May-2024 02:08                6332
function.dbase-replace-record.php                  29-May-2024 02:08                9464
function.dcgettext.php                             29-May-2024 02:08                3515
function.dcngettext.php                            29-May-2024 02:08                4167
function.debug-backtrace.php                       29-May-2024 02:08               11742
function.debug-print-backtrace.php                 29-May-2024 02:08                6413
function.debug-zval-dump.php                       29-May-2024 02:08                9148
function.decbin.php                                29-May-2024 02:08                8663
function.dechex.php                                29-May-2024 02:08                7015
function.decoct.php                                29-May-2024 02:08                4749
function.define.php                                29-May-2024 02:08               11685
function.defined.php                               29-May-2024 02:08                7733
function.deflate-add.php                           29-May-2024 02:08                5944
function.deflate-init.php                          29-May-2024 02:08                7890
function.deg2rad.php                               29-May-2024 02:08                3911
function.delete.php                                29-May-2024 02:08                2402
function.dgettext.php                              29-May-2024 02:08                3267
function.die.php                                   29-May-2024 02:08                1614
function.dio-close.php                             29-May-2024 02:08                3904
function.dio-fcntl.php                             29-May-2024 02:08                9335
function.dio-open.php                              29-May-2024 02:08                8110
function.dio-read.php                              29-May-2024 02:08                3489
function.dio-seek.php                              29-May-2024 02:08                7126
function.dio-stat.php                              29-May-2024 02:08                4244
function.dio-tcsetattr.php                         29-May-2024 02:08                6842
function.dio-truncate.php                          29-May-2024 02:08                3687
function.dio-write.php                             29-May-2024 02:08                3791
function.dir.php                                   29-May-2024 02:08                7087
function.dirname.php                               29-May-2024 02:08                9237
function.disk-free-space.php                       29-May-2024 02:08                5320
function.disk-total-space.php                      29-May-2024 02:08                5410
function.diskfreespace.php                         29-May-2024 02:08                1785
function.dl.php                                    29-May-2024 02:08                9382
function.dngettext.php                             29-May-2024 02:08                3931
function.dns-check-record.php                      29-May-2024 02:08                1757
function.dns-get-mx.php                            29-May-2024 02:08                1727
function.dns-get-record.php                        29-May-2024 02:08               23021
function.dom-import-simplexml.php                  29-May-2024 02:08                6997
function.doubleval.php                             29-May-2024 02:08                1703
function.each.php                                  29-May-2024 02:08               11160
function.easter-date.php                           29-May-2024 02:08               13565
function.easter-days.php                           29-May-2024 02:08                6816
function.echo.php                                  29-May-2024 02:08               16663
function.eio-busy.php                              29-May-2024 02:08                4904
function.eio-cancel.php                            29-May-2024 02:08                7402
function.eio-chmod.php                             29-May-2024 02:08                6101
function.eio-chown.php                             29-May-2024 02:08                6303
function.eio-close.php                             29-May-2024 02:08                5533
function.eio-custom.php                            29-May-2024 02:08               10173
function.eio-dup2.php                              29-May-2024 02:08                5589
function.eio-event-loop.php                        29-May-2024 02:08                5733
function.eio-fallocate.php                         29-May-2024 02:08                7446
function.eio-fchmod.php                            29-May-2024 02:08                6060
function.eio-fchown.php                            29-May-2024 02:08                6362
function.eio-fdatasync.php                         29-May-2024 02:08                5453
function.eio-fstat.php                             29-May-2024 02:08               11408
function.eio-fstatvfs.php                          29-May-2024 02:08                5575
function.eio-fsync.php                             29-May-2024 02:08                5549
function.eio-ftruncate.php                         29-May-2024 02:08                6078
function.eio-futime.php                            29-May-2024 02:08                6384
function.eio-get-event-stream.php                  29-May-2024 02:08                8011
function.eio-get-last-error.php                    29-May-2024 02:08                3088
function.eio-grp-add.php                           29-May-2024 02:08               11403
function.eio-grp-cancel.php                        29-May-2024 02:08                3113
function.eio-grp-limit.php                         29-May-2024 02:08                3027
function.eio-grp.php                               29-May-2024 02:08               11610
function.eio-init.php                              29-May-2024 02:08                2569
function.eio-link.php                              29-May-2024 02:08               12417
function.eio-lstat.php                             29-May-2024 02:08                9790
function.eio-mkdir.php                             29-May-2024 02:08                9094
function.eio-mknod.php                             29-May-2024 02:08               11349
function.eio-nop.php                               29-May-2024 02:08                5206
function.eio-npending.php                          29-May-2024 02:08                2983
function.eio-nready.php                            29-May-2024 02:08                2731
function.eio-nreqs.php                             29-May-2024 02:08                5492
function.eio-nthreads.php                          29-May-2024 02:08                3405
function.eio-open.php                              29-May-2024 02:08               11372
function.eio-poll.php                              29-May-2024 02:08                5622
function.eio-read.php                              29-May-2024 02:08               12387
function.eio-readahead.php                         29-May-2024 02:08                6122
function.eio-readdir.php                           29-May-2024 02:08               18124
function.eio-readlink.php                          29-May-2024 02:08               12105
function.eio-realpath.php                          29-May-2024 02:08                5315
function.eio-rename.php                            29-May-2024 02:08                9185
function.eio-rmdir.php                             29-May-2024 02:08                8125
function.eio-seek.php                              29-May-2024 02:08                6932
function.eio-sendfile.php                          29-May-2024 02:08                6447
function.eio-set-max-idle.php                      29-May-2024 02:08                3116
function.eio-set-max-parallel.php                  29-May-2024 02:08                3165
function.eio-set-max-poll-reqs.php                 29-May-2024 02:08                2489
function.eio-set-max-poll-time.php                 29-May-2024 02:08                2559
function.eio-set-min-parallel.php                  29-May-2024 02:08                3156
function.eio-stat.php                              29-May-2024 02:08                9767
function.eio-statvfs.php                           29-May-2024 02:08                8259
function.eio-symlink.php                           29-May-2024 02:08               10739
function.eio-sync-file-range.php                   29-May-2024 02:08                7227
function.eio-sync.php                              29-May-2024 02:08                2878
function.eio-syncfs.php                            29-May-2024 02:08                5136
function.eio-truncate.php                          29-May-2024 02:08                6055
function.eio-unlink.php                            29-May-2024 02:08                5242
function.eio-utime.php                             29-May-2024 02:08                6093
function.eio-write.php                             29-May-2024 02:08                6811
function.empty.php                                 29-May-2024 02:08                9211
function.enchant-broker-describe.php               29-May-2024 02:08                6030
function.enchant-broker-dict-exists.php            29-May-2024 02:08                5723
function.enchant-broker-free-dict.php              29-May-2024 02:08                4772
function.enchant-broker-free.php                   29-May-2024 02:08                4324
function.enchant-broker-get-dict-path.php          29-May-2024 02:08                5290
function.enchant-broker-get-error.php              29-May-2024 02:08                3682
function.enchant-broker-init.php                   29-May-2024 02:08                3489
function.enchant-broker-list-dicts.php             29-May-2024 02:08                6905
function.enchant-broker-request-dict.php           29-May-2024 02:08                7045
function.enchant-broker-request-pwl-dict.php       29-May-2024 02:08                5371
function.enchant-broker-set-dict-path.php          29-May-2024 02:08                5573
function.enchant-broker-set-ordering.php           29-May-2024 02:08                4812
function.enchant-dict-add-to-personal.php          29-May-2024 02:08                2192
function.enchant-dict-add-to-session.php           29-May-2024 02:08                4433
function.enchant-dict-add.php                      29-May-2024 02:08                6378
function.enchant-dict-check.php                    29-May-2024 02:08                4263
function.enchant-dict-describe.php                 29-May-2024 02:08                6519
function.enchant-dict-get-error.php                29-May-2024 02:08                3885
function.enchant-dict-is-added.php                 29-May-2024 02:08                4488
function.enchant-dict-is-in-session.php            29-May-2024 02:08                2178
function.enchant-dict-quick-check.php              29-May-2024 02:08                8277
function.enchant-dict-store-replacement.php        29-May-2024 02:08                4723
function.enchant-dict-suggest.php                  29-May-2024 02:08                7445
function.end.php                                   29-May-2024 02:08                6565
function.enum-exists.php                           29-May-2024 02:08                5254
function.error-clear-last.php                      29-May-2024 02:08                4556
function.error-get-last.php                        29-May-2024 02:08                4804
function.error-log.php                             29-May-2024 02:08               10516
function.error-reporting.php                       29-May-2024 02:08                8869
function.escapeshellarg.php                        29-May-2024 02:08                5126
function.escapeshellcmd.php                        29-May-2024 02:08                7380
function.eval.php                                  29-May-2024 02:08                8693
function.exec.php                                  29-May-2024 02:08               10397
function.exif-imagetype.php                        29-May-2024 02:08                9685
function.exif-read-data.php                        29-May-2024 02:08               20604
function.exif-tagname.php                          29-May-2024 02:08                4715
function.exif-thumbnail.php                        29-May-2024 02:08                8674
function.exit.php                                  29-May-2024 02:08                9096
function.exp.php                                   29-May-2024 02:08                4226
function.expect-expectl.php                        29-May-2024 02:08               11060
function.expect-popen.php                          29-May-2024 02:08                4609
function.explode.php                               29-May-2024 02:08               15193
function.expm1.php                                 29-May-2024 02:08                3340
function.extension-loaded.php                      29-May-2024 02:08                5418
function.extract.php                               29-May-2024 02:08               13540
function.ezmlm-hash.php                            29-May-2024 02:08                4427
function.fann-cascadetrain-on-data.php             29-May-2024 02:08                6454
function.fann-cascadetrain-on-file.php             29-May-2024 02:08                5545
function.fann-clear-scaling-params.php             29-May-2024 02:08                2725
function.fann-copy.php                             29-May-2024 02:08                3253
function.fann-create-from-file.php                 29-May-2024 02:08                3225
function.fann-create-shortcut-array.php            29-May-2024 02:08                4036
function.fann-create-shortcut.php                  29-May-2024 02:08                4974
function.fann-create-sparse-array.php              29-May-2024 02:08                4736
function.fann-create-sparse.php                    29-May-2024 02:08                5433
function.fann-create-standard-array.php            29-May-2024 02:08                4369
function.fann-create-standard.php                  29-May-2024 02:08                5130
function.fann-create-train-from-callback.php       29-May-2024 02:08                8925
function.fann-create-train.php                     29-May-2024 02:08                4564
function.fann-descale-input.php                    29-May-2024 02:08                3737
function.fann-descale-output.php                   29-May-2024 02:08                3750
function.fann-descale-train.php                    29-May-2024 02:08                3709
function.fann-destroy-train.php                    29-May-2024 02:08                2679
function.fann-destroy.php                          29-May-2024 02:08                2704
function.fann-duplicate-train-data.php             29-May-2024 02:08                2864
function.fann-get-activation-function.php          29-May-2024 02:08                5084
function.fann-get-activation-steepness.php         29-May-2024 02:08                5323
function.fann-get-bias-array.php                   29-May-2024 02:08                2568
function.fann-get-bit-fail-limit.php               29-May-2024 02:08                3702
function.fann-get-bit-fail.php                     29-May-2024 02:08                4816
function.fann-get-cascade-activation-functions-..> 29-May-2024 02:08                3786
function.fann-get-cascade-activation-functions.php 29-May-2024 02:08                4560
function.fann-get-cascade-activation-steepnesse..> 29-May-2024 02:08                3829
function.fann-get-cascade-activation-steepnesse..> 29-May-2024 02:08                3937
function.fann-get-cascade-candidate-change-frac..> 29-May-2024 02:08                4960
function.fann-get-cascade-candidate-limit.php      29-May-2024 02:08                3528
function.fann-get-cascade-candidate-stagnation-..> 29-May-2024 02:08                4154
function.fann-get-cascade-max-cand-epochs.php      29-May-2024 02:08                3384
function.fann-get-cascade-max-out-epochs.php       29-May-2024 02:08                3350
function.fann-get-cascade-min-cand-epochs.php      29-May-2024 02:08                3698
function.fann-get-cascade-min-out-epochs.php       29-May-2024 02:08                3673
function.fann-get-cascade-num-candidate-groups.php 29-May-2024 02:08                3724
function.fann-get-cascade-num-candidates.php       29-May-2024 02:08                5737
function.fann-get-cascade-output-change-fractio..> 29-May-2024 02:08                4875
function.fann-get-cascade-output-stagnation-epo..> 29-May-2024 02:08                4099
function.fann-get-cascade-weight-multiplier.php    29-May-2024 02:08                3430
function.fann-get-connection-array.php             29-May-2024 02:08                2622
function.fann-get-connection-rate.php              29-May-2024 02:08                2732
function.fann-get-errno.php                        29-May-2024 02:08                3325
function.fann-get-errstr.php                       29-May-2024 02:08                3349
function.fann-get-layer-array.php                  29-May-2024 02:08                2685
function.fann-get-learning-momentum.php            29-May-2024 02:08                3799
function.fann-get-learning-rate.php                29-May-2024 02:08                3800
function.fann-get-mse.php                          29-May-2024 02:08                3139
function.fann-get-network-type.php                 29-May-2024 02:08                2726
function.fann-get-num-input.php                    29-May-2024 02:08                2635
function.fann-get-num-layers.php                   29-May-2024 02:08                2632
function.fann-get-num-output.php                   29-May-2024 02:08                2652
function.fann-get-quickprop-decay.php              29-May-2024 02:08                3255
function.fann-get-quickprop-mu.php                 29-May-2024 02:08                3220
function.fann-get-rprop-decrease-factor.php        29-May-2024 02:08                3287
function.fann-get-rprop-delta-max.php              29-May-2024 02:08                3330
function.fann-get-rprop-delta-min.php              29-May-2024 02:08                3157
function.fann-get-rprop-delta-zero.php             29-May-2024 02:08                3508
function.fann-get-rprop-increase-factor.php        29-May-2024 02:08                3303
function.fann-get-sarprop-step-error-shift.php     29-May-2024 02:08                3691
function.fann-get-sarprop-step-error-threshold-..> 29-May-2024 02:08                3841
function.fann-get-sarprop-temperature.php          29-May-2024 02:08                3574
function.fann-get-sarprop-weight-decay-shift.php   29-May-2024 02:08                3688
function.fann-get-total-connections.php            29-May-2024 02:08                2777
function.fann-get-total-neurons.php                29-May-2024 02:08                2844
function.fann-get-train-error-function.php         29-May-2024 02:08                3608
function.fann-get-train-stop-function.php          29-May-2024 02:08                3577
function.fann-get-training-algorithm.php           29-May-2024 02:08                3814
function.fann-init-weights.php                     29-May-2024 02:08                4274
function.fann-length-train-data.php                29-May-2024 02:08                2911
function.fann-merge-train-data.php                 29-May-2024 02:08                3247
function.fann-num-input-train-data.php             29-May-2024 02:08                3485
function.fann-num-output-train-data.php            29-May-2024 02:08                3480
function.fann-print-error.php                      29-May-2024 02:08                3042
function.fann-randomize-weights.php                29-May-2024 02:08                3965
function.fann-read-train-from-file.php             29-May-2024 02:08                4971
function.fann-reset-errno.php                      29-May-2024 02:08                3222
function.fann-reset-errstr.php                     29-May-2024 02:08                3212
function.fann-reset-mse.php                        29-May-2024 02:08                3412
function.fann-run.php                              29-May-2024 02:08                2878
function.fann-save-train.php                       29-May-2024 02:08                3512
function.fann-save.php                             29-May-2024 02:08                4272
function.fann-scale-input-train-data.php           29-May-2024 02:08                4092
function.fann-scale-input.php                      29-May-2024 02:08                3768
function.fann-scale-output-train-data.php          29-May-2024 02:08                4117
function.fann-scale-output.php                     29-May-2024 02:08                3766
function.fann-scale-train-data.php                 29-May-2024 02:08                4090
function.fann-scale-train.php                      29-May-2024 02:08                3735
function.fann-set-activation-function-hidden.php   29-May-2024 02:08                4388
function.fann-set-activation-function-layer.php    29-May-2024 02:08                4865
function.fann-set-activation-function-output.php   29-May-2024 02:08                4405
function.fann-set-activation-function.php          29-May-2024 02:08                6277
function.fann-set-activation-steepness-hidden.php  29-May-2024 02:08                4618
function.fann-set-activation-steepness-layer.php   29-May-2024 02:08                5045
function.fann-set-activation-steepness-output.php  29-May-2024 02:08                4596
function.fann-set-activation-steepness.php         29-May-2024 02:08                5838
function.fann-set-bit-fail-limit.php               29-May-2024 02:08                3456
function.fann-set-callback.php                     29-May-2024 02:08                5569
function.fann-set-cascade-activation-functions.php 29-May-2024 02:08                4062
function.fann-set-cascade-activation-steepnesse..> 29-May-2024 02:08                4258
function.fann-set-cascade-candidate-change-frac..> 29-May-2024 02:08                3795
function.fann-set-cascade-candidate-limit.php      29-May-2024 02:08                3627
function.fann-set-cascade-candidate-stagnation-..> 29-May-2024 02:08                3827
function.fann-set-cascade-max-cand-epochs.php      29-May-2024 02:08                3648
function.fann-set-cascade-max-out-epochs.php       29-May-2024 02:08                3596
function.fann-set-cascade-min-cand-epochs.php      29-May-2024 02:08                3945
function.fann-set-cascade-min-out-epochs.php       29-May-2024 02:08                3934
function.fann-set-cascade-num-candidate-groups.php 29-May-2024 02:08                3683
function.fann-set-cascade-output-change-fractio..> 29-May-2024 02:08                3764
function.fann-set-cascade-output-stagnation-epo..> 29-May-2024 02:08                3806
function.fann-set-cascade-weight-multiplier.php    29-May-2024 02:08                3603
function.fann-set-error-log.php                    29-May-2024 02:08                3068
function.fann-set-input-scaling-params.php         29-May-2024 02:08                4447
function.fann-set-learning-momentum.php            29-May-2024 02:08                3840
function.fann-set-learning-rate.php                29-May-2024 02:08                3782
function.fann-set-output-scaling-params.php        29-May-2024 02:08                4459
function.fann-set-quickprop-decay.php              29-May-2024 02:08                3529
function.fann-set-quickprop-mu.php                 29-May-2024 02:08                3432
function.fann-set-rprop-decrease-factor.php        29-May-2024 02:08                3599
function.fann-set-rprop-delta-max.php              29-May-2024 02:08                3667
function.fann-set-rprop-delta-min.php              29-May-2024 02:08                3484
function.fann-set-rprop-delta-zero.php             29-May-2024 02:08                3840
function.fann-set-rprop-increase-factor.php        29-May-2024 02:08                3619
function.fann-set-sarprop-step-error-shift.php     29-May-2024 02:08                4041
function.fann-set-sarprop-step-error-threshold-..> 29-May-2024 02:08                4214
function.fann-set-sarprop-temperature.php          29-May-2024 02:08                3928
function.fann-set-sarprop-weight-decay-shift.php   29-May-2024 02:08                4044
function.fann-set-scaling-params.php               29-May-2024 02:08                5427
function.fann-set-train-error-function.php         29-May-2024 02:08                3804
function.fann-set-train-stop-function.php          29-May-2024 02:08                3794
function.fann-set-training-algorithm.php           29-May-2024 02:08                3740
function.fann-set-weight-array.php                 29-May-2024 02:08                3279
function.fann-set-weight.php                       29-May-2024 02:08                3716
function.fann-shuffle-train-data.php               29-May-2024 02:08                2861
function.fann-subset-train-data.php                29-May-2024 02:08                4218
function.fann-test-data.php                        29-May-2024 02:08                4083
function.fann-test.php                             29-May-2024 02:08                4478
function.fann-train-epoch.php                      29-May-2024 02:08                4414
function.fann-train-on-data.php                    29-May-2024 02:08                6348
function.fann-train-on-file.php                    29-May-2024 02:08                6346
function.fann-train.php                            29-May-2024 02:08                4606
function.fastcgi-finish-request.php                29-May-2024 02:08                2559
function.fbird-add-user.php                        29-May-2024 02:08                2322
function.fbird-affected-rows.php                   29-May-2024 02:08                2340
function.fbird-backup.php                          29-May-2024 02:08                1777
function.fbird-blob-add.php                        29-May-2024 02:08                2651
function.fbird-blob-cancel.php                     29-May-2024 02:08                3682
function.fbird-blob-close.php                      29-May-2024 02:08                2682
function.fbird-blob-create.php                     29-May-2024 02:08                2682
function.fbird-blob-echo.php                       29-May-2024 02:08                2485
function.fbird-blob-get.php                        29-May-2024 02:08                2478
function.fbird-blob-import.php                     29-May-2024 02:08                2678
function.fbird-blob-info.php                       29-May-2024 02:08                1809
function.fbird-blob-open.php                       29-May-2024 02:08                2475
function.fbird-close.php                           29-May-2024 02:08                2263
function.fbird-commit-ret.php                      29-May-2024 02:08                1802
function.fbird-commit.php                          29-May-2024 02:08                1770
function.fbird-connect.php                         29-May-2024 02:08                2269
function.fbird-db-info.php                         29-May-2024 02:08                1783
function.fbird-delete-user.php                     29-May-2024 02:08                2337
function.fbird-drop-db.php                         29-May-2024 02:08                2285
function.fbird-errcode.php                         29-May-2024 02:08                2110
function.fbird-errmsg.php                          29-May-2024 02:08                2103
function.fbird-execute.php                         29-May-2024 02:08                2115
function.fbird-fetch-assoc.php                     29-May-2024 02:08                2353
function.fbird-fetch-object.php                    29-May-2024 02:08                2364
function.fbird-fetch-row.php                       29-May-2024 02:08                2341
function.fbird-field-info.php                      29-May-2024 02:08                2185
function.fbird-free-event-handler.php              29-May-2024 02:08                2289
function.fbird-free-query.php                      29-May-2024 02:08                1838
function.fbird-free-result.php                     29-May-2024 02:08                1823
function.fbird-gen-id.php                          29-May-2024 02:08                1780
function.fbird-maintain-db.php                     29-May-2024 02:08                1825
function.fbird-modify-user.php                     29-May-2024 02:08                2353
function.fbird-name-result.php                     29-May-2024 02:08                2336
function.fbird-num-fields.php                      29-May-2024 02:08                2174
function.fbird-num-params.php                      29-May-2024 02:08                2331
function.fbird-param-info.php                      29-May-2024 02:08                2336
function.fbird-pconnect.php                        29-May-2024 02:08                2286
function.fbird-prepare.php                         29-May-2024 02:08                1773
function.fbird-query.php                           29-May-2024 02:08                2598
function.fbird-restore.php                         29-May-2024 02:08                1780
function.fbird-rollback-ret.php                    29-May-2024 02:08                1832
function.fbird-rollback.php                        29-May-2024 02:08                1804
function.fbird-server-info.php                     29-May-2024 02:08                1835
function.fbird-service-attach.php                  29-May-2024 02:08                1874
function.fbird-service-detach.php                  29-May-2024 02:08                1886
function.fbird-set-event-handler.php               29-May-2024 02:08                2446
function.fbird-trans.php                           29-May-2024 02:08                1779
function.fbird-wait-event.php                      29-May-2024 02:08                2371
function.fclose.php                                29-May-2024 02:08                4361
function.fdatasync.php                             29-May-2024 02:08                5898
function.fdf-add-doc-javascript.php                29-May-2024 02:08                5525
function.fdf-add-template.php                      29-May-2024 02:08                2885
function.fdf-close.php                             29-May-2024 02:08                3068
function.fdf-create.php                            29-May-2024 02:08                5562
function.fdf-enum-values.php                       29-May-2024 02:08                2458
function.fdf-errno.php                             29-May-2024 02:08                2743
function.fdf-error.php                             29-May-2024 02:08                3197
function.fdf-get-ap.php                            29-May-2024 02:08                4420
function.fdf-get-attachment.php                    29-May-2024 02:08                6080
function.fdf-get-encoding.php                      29-May-2024 02:08                3379
function.fdf-get-file.php                          29-May-2024 02:08                3199
function.fdf-get-flags.php                         29-May-2024 02:08                2378
function.fdf-get-opt.php                           29-May-2024 02:08                2417
function.fdf-get-status.php                        29-May-2024 02:08                3218
function.fdf-get-value.php                         29-May-2024 02:08                4512
function.fdf-get-version.php                       29-May-2024 02:08                3578
function.fdf-header.php                            29-May-2024 02:08                2312
function.fdf-next-field-name.php                   29-May-2024 02:08                5369
function.fdf-open-string.php                       29-May-2024 02:08                4825
function.fdf-open.php                              29-May-2024 02:08                5836
function.fdf-remove-item.php                       29-May-2024 02:08                2391
function.fdf-save-string.php                       29-May-2024 02:08                5591
function.fdf-save.php                              29-May-2024 02:08                4086
function.fdf-set-ap.php                            29-May-2024 02:08                4647
function.fdf-set-encoding.php                      29-May-2024 02:08                3775
function.fdf-set-file.php                          29-May-2024 02:08                6702
function.fdf-set-flags.php                         29-May-2024 02:08                4392
function.fdf-set-javascript-action.php             29-May-2024 02:08                4589
function.fdf-set-on-import-javascript.php          29-May-2024 02:08                3162
function.fdf-set-opt.php                           29-May-2024 02:08                4675
function.fdf-set-status.php                        29-May-2024 02:08                3805
function.fdf-set-submit-form-action.php            29-May-2024 02:08                4888
function.fdf-set-target-frame.php                  29-May-2024 02:08                3805
function.fdf-set-value.php                         29-May-2024 02:08                5244
function.fdf-set-version.php                       29-May-2024 02:08                4029
function.fdiv.php                                  29-May-2024 02:08                6305
function.feof.php                                  29-May-2024 02:08                7623
function.fflush.php                                29-May-2024 02:08                6188
function.fgetc.php                                 29-May-2024 02:08                6378
function.fgetcsv.php                               29-May-2024 02:08               12441
function.fgets.php                                 29-May-2024 02:08                8339
function.fgetss.php                                29-May-2024 02:08                9107
function.file-exists.php                           29-May-2024 02:08                6427
function.file-get-contents.php                     29-May-2024 02:08               17837
function.file-put-contents.php                     29-May-2024 02:08               12568
function.file.php                                  29-May-2024 02:08               11562
function.fileatime.php                             29-May-2024 02:08                6614
function.filectime.php                             29-May-2024 02:08                6757
function.filegroup.php                             29-May-2024 02:08                5600
function.fileinode.php                             29-May-2024 02:08                5211
function.filemtime.php                             29-May-2024 02:08                6445
function.fileowner.php                             29-May-2024 02:08                5455
function.fileperms.php                             29-May-2024 02:08               15918
function.filesize.php                              29-May-2024 02:08                5631
function.filetype.php                              29-May-2024 02:08                6533
function.filter-has-var.php                        29-May-2024 02:08                3406
function.filter-id.php                             29-May-2024 02:08                2996
function.filter-input-array.php                    29-May-2024 02:08               13110
function.filter-input.php                          29-May-2024 02:08                8486
function.filter-list.php                           29-May-2024 02:08                3657
function.filter-var-array.php                      29-May-2024 02:08               12062
function.filter-var.php                            29-May-2024 02:08               14172
function.finfo-buffer.php                          29-May-2024 02:08                8424
function.finfo-close.php                           29-May-2024 02:08                3524
function.finfo-file.php                            29-May-2024 02:08                8928
function.finfo-open.php                            29-May-2024 02:08                9986
function.finfo-set-flags.php                       29-May-2024 02:08                4639
function.floatval.php                              29-May-2024 02:08                6528
function.flock.php                                 29-May-2024 02:08               12601
function.floor.php                                 29-May-2024 02:08                4846
function.flush.php                                 29-May-2024 02:08                4429
function.fmod.php                                  29-May-2024 02:08                4893
function.fnmatch.php                               29-May-2024 02:08               10626
function.fopen.php                                 29-May-2024 02:08               21879
function.forward-static-call-array.php             29-May-2024 02:08                9367
function.forward-static-call.php                   29-May-2024 02:08                8828
function.fpassthru.php                             29-May-2024 02:08                6971
function.fpm-get-status.php                        29-May-2024 02:08                2710
function.fprintf.php                               29-May-2024 02:08               21621
function.fputcsv.php                               29-May-2024 02:08               10131
function.fputs.php                                 29-May-2024 02:08                1672
function.fread.php                                 29-May-2024 02:08               14382
function.frenchtojd.php                            29-May-2024 02:08                3942
function.fscanf.php                                29-May-2024 02:08                9025
function.fseek.php                                 29-May-2024 02:08                7681
function.fsockopen.php                             29-May-2024 02:08               16417
function.fstat.php                                 29-May-2024 02:08                5958
function.fsync.php                                 29-May-2024 02:08                5643
function.ftell.php                                 29-May-2024 02:08                5989
function.ftok.php                                  29-May-2024 02:08                3640
function.ftp-alloc.php                             29-May-2024 02:08                8272
function.ftp-append.php                            29-May-2024 02:08                4517
function.ftp-cdup.php                              29-May-2024 02:08                6593
function.ftp-chdir.php                             29-May-2024 02:08                7384
function.ftp-chmod.php                             29-May-2024 02:08                7026
function.ftp-close.php                             29-May-2024 02:08                5964
function.ftp-connect.php                           29-May-2024 02:08                6428
function.ftp-delete.php                            29-May-2024 02:08                6232
function.ftp-exec.php                              29-May-2024 02:08                6664
function.ftp-fget.php                              29-May-2024 02:08                9977
function.ftp-fput.php                              29-May-2024 02:08                9378
function.ftp-get-option.php                        29-May-2024 02:08                6134
function.ftp-get.php                               29-May-2024 02:08                9301
function.ftp-login.php                             29-May-2024 02:08                6805
function.ftp-mdtm.php                              29-May-2024 02:08                6961
function.ftp-mkdir.php                             29-May-2024 02:08                6847
function.ftp-mlsd.php                              29-May-2024 02:08                9050
function.ftp-nb-continue.php                       29-May-2024 02:08                5515
function.ftp-nb-fget.php                           29-May-2024 02:08               10497
function.ftp-nb-fput.php                           29-May-2024 02:08               10290
function.ftp-nb-get.php                            29-May-2024 02:08               14061
function.ftp-nb-put.php                            29-May-2024 02:08               11696
function.ftp-nlist.php                             29-May-2024 02:08                7070
function.ftp-pasv.php                              29-May-2024 02:08                7162
function.ftp-put.php                               29-May-2024 02:08                9040
function.ftp-pwd.php                               29-May-2024 02:08                5967
function.ftp-quit.php                              29-May-2024 02:08                1707
function.ftp-raw.php                               29-May-2024 02:08                5510
function.ftp-rawlist.php                           29-May-2024 02:08                8115
function.ftp-rename.php                            29-May-2024 02:08                7170
function.ftp-rmdir.php                             29-May-2024 02:08                6462
function.ftp-set-option.php                        29-May-2024 02:08                7137
function.ftp-site.php                              29-May-2024 02:08                6550
function.ftp-size.php                              29-May-2024 02:08                6708
function.ftp-ssl-connect.php                       29-May-2024 02:08                8653
function.ftp-systype.php                           29-May-2024 02:08                5508
function.ftruncate.php                             29-May-2024 02:08                6458
function.func-get-arg.php                          29-May-2024 02:08               10986
function.func-get-args.php                         29-May-2024 02:08               11568
function.func-num-args.php                         29-May-2024 02:08                5777
function.function-exists.php                       29-May-2024 02:08                5980
function.fwrite.php                                29-May-2024 02:08               14444
function.gc-collect-cycles.php                     29-May-2024 02:08                2514
function.gc-disable.php                            29-May-2024 02:08                2519
function.gc-enable.php                             29-May-2024 02:08                2497
function.gc-enabled.php                            29-May-2024 02:08                3351
function.gc-mem-caches.php                         29-May-2024 02:08                2463
function.gc-status.php                             29-May-2024 02:08                8626
function.gd-info.php                               29-May-2024 02:08                9003
function.geoip-asnum-by-name.php                   29-May-2024 02:08                4188
function.geoip-continent-code-by-name.php          29-May-2024 02:08                5683
function.geoip-country-code-by-name.php            29-May-2024 02:08                5362
function.geoip-country-code3-by-name.php           29-May-2024 02:08                4986
function.geoip-country-name-by-name.php            29-May-2024 02:08                4929
function.geoip-database-info.php                   29-May-2024 02:08                4213
function.geoip-db-avail.php                        29-May-2024 02:08                4486
function.geoip-db-filename.php                     29-May-2024 02:08                4124
function.geoip-db-get-all-info.php                 29-May-2024 02:08                6648
function.geoip-domain-by-name.php                  29-May-2024 02:08                4395
function.geoip-id-by-name.php                      29-May-2024 02:08                5455
function.geoip-isp-by-name.php                     29-May-2024 02:08                4371
function.geoip-netspeedcell-by-name.php            29-May-2024 02:08                5046
function.geoip-org-by-name.php                     29-May-2024 02:08                4371
function.geoip-record-by-name.php                  29-May-2024 02:08                7700
function.geoip-region-by-name.php                  29-May-2024 02:08                4985
function.geoip-region-name-by-code.php             29-May-2024 02:08                7145
function.geoip-setup-custom-directory.php          29-May-2024 02:08                4227
function.geoip-time-zone-by-country-and-region.php 29-May-2024 02:08                7291
function.get-browser.php                           29-May-2024 02:08                8249
function.get-called-class.php                      29-May-2024 02:08                5977
function.get-cfg-var.php                           29-May-2024 02:08                3716
function.get-class-methods.php                     29-May-2024 02:08                6757
function.get-class-vars.php                        29-May-2024 02:08                9559
function.get-class.php                             29-May-2024 02:08               12292
function.get-current-user.php                      29-May-2024 02:08                4226
function.get-debug-type.php                        29-May-2024 02:08                9350
function.get-declared-classes.php                  29-May-2024 02:08                5103
function.get-declared-interfaces.php               29-May-2024 02:08                4235
function.get-declared-traits.php                   29-May-2024 02:08                2833
function.get-defined-constants.php                 29-May-2024 02:08                7285
function.get-defined-functions.php                 29-May-2024 02:08                6934
function.get-defined-vars.php                      29-May-2024 02:08                6039
function.get-extension-funcs.php                   29-May-2024 02:08                5506
function.get-headers.php                           29-May-2024 02:08                9182
function.get-html-translation-table.php            29-May-2024 02:08               13430
function.get-include-path.php                      29-May-2024 02:08                4336
function.get-included-files.php                    29-May-2024 02:08                5835
function.get-loaded-extensions.php                 29-May-2024 02:08                5408
function.get-magic-quotes-gpc.php                  29-May-2024 02:08                4089
function.get-magic-quotes-runtime.php              29-May-2024 02:08                3608
function.get-mangled-object-vars.php               29-May-2024 02:08                8030
function.get-meta-tags.php                         29-May-2024 02:08                7816
function.get-object-vars.php                       29-May-2024 02:08                6019
function.get-parent-class.php                      29-May-2024 02:08                7454
function.get-required-files.php                    29-May-2024 02:08                1847
function.get-resource-id.php                       29-May-2024 02:08                4764
function.get-resource-type.php                     29-May-2024 02:08                5247
function.get-resources.php                         29-May-2024 02:08                7843
function.getallheaders.php                         29-May-2024 02:08                4570
function.getcwd.php                                29-May-2024 02:08                5155
function.getdate.php                               29-May-2024 02:08                9307
function.getenv.php                                29-May-2024 02:08                8538
function.gethostbyaddr.php                         29-May-2024 02:08                4295
function.gethostbyname.php                         29-May-2024 02:08                4428
function.gethostbynamel.php                        29-May-2024 02:08                4953
function.gethostname.php                           29-May-2024 02:08                3868
function.getimagesize.php                          29-May-2024 02:08               16157
function.getimagesizefromstring.php                29-May-2024 02:08                5636
function.getlastmod.php                            29-May-2024 02:08                5039
function.getmxrr.php                               29-May-2024 02:08                5688
function.getmygid.php                              29-May-2024 02:08                3400
function.getmyinode.php                            29-May-2024 02:08                3411
function.getmypid.php                              29-May-2024 02:08                3703
function.getmyuid.php                              29-May-2024 02:08                3342
function.getopt.php                                29-May-2024 02:08               14953
function.getprotobyname.php                        29-May-2024 02:08                4680
function.getprotobynumber.php                      29-May-2024 02:08                3321
function.getrandmax.php                            29-May-2024 02:08                2942
function.getrusage.php                             29-May-2024 02:08               11072
function.getservbyname.php                         29-May-2024 02:08                6418
function.getservbyport.php                         29-May-2024 02:08                3809
function.gettext.php                               29-May-2024 02:08                5820
function.gettimeofday.php                          29-May-2024 02:08                4859
function.gettype.php                               29-May-2024 02:08                8591
function.glob.php                                  29-May-2024 02:08               10430
function.gmdate.php                                29-May-2024 02:08                7576
function.gmmktime.php                              29-May-2024 02:08               10755
function.gmp-abs.php                               29-May-2024 02:08                4538
function.gmp-add.php                               29-May-2024 02:08                4953
function.gmp-and.php                               29-May-2024 02:08                5404
function.gmp-binomial.php                          29-May-2024 02:08                4111
function.gmp-clrbit.php                            29-May-2024 02:08                5466
function.gmp-cmp.php                               29-May-2024 02:08                5816
function.gmp-com.php                               29-May-2024 02:08                4034
function.gmp-div-q.php                             29-May-2024 02:08               10382
function.gmp-div-qr.php                            29-May-2024 02:08                6952
function.gmp-div-r.php                             29-May-2024 02:08                6332
function.gmp-div.php                               29-May-2024 02:08                1699
function.gmp-divexact.php                          29-May-2024 02:08                6043
function.gmp-export.php                            29-May-2024 02:08                5674
function.gmp-fact.php                              29-May-2024 02:08                4903
function.gmp-gcd.php                               29-May-2024 02:08                5330
function.gmp-gcdext.php                            29-May-2024 02:08                9516
function.gmp-hamdist.php                           29-May-2024 02:08                6681
function.gmp-import.php                            29-May-2024 02:08                5993
function.gmp-init.php                              29-May-2024 02:08                5630
function.gmp-intval.php                            29-May-2024 02:08                5397
function.gmp-invert.php                            29-May-2024 02:08                5538
function.gmp-jacobi.php                            29-May-2024 02:08                5841
function.gmp-kronecker.php                         29-May-2024 02:08                4188
function.gmp-lcm.php                               29-May-2024 02:08                3956
function.gmp-legendre.php                          29-May-2024 02:08                5860
function.gmp-mod.php                               29-May-2024 02:08                5075
function.gmp-mul.php                               29-May-2024 02:08                5157
function.gmp-neg.php                               29-May-2024 02:08                4490
function.gmp-nextprime.php                         29-May-2024 02:08                5143
function.gmp-or.php                                29-May-2024 02:08                5616
function.gmp-perfect-power.php                     29-May-2024 02:08                3463
function.gmp-perfect-square.php                    29-May-2024 02:08                5691
function.gmp-popcount.php                          29-May-2024 02:08                4985
function.gmp-pow.php                               29-May-2024 02:08                5843
function.gmp-powm.php                              29-May-2024 02:08                6107
function.gmp-prob-prime.php                        29-May-2024 02:08                5955
function.gmp-random-bits.php                       29-May-2024 02:08                5916
function.gmp-random-range.php                      29-May-2024 02:08                7281
function.gmp-random-seed.php                       29-May-2024 02:08                7602
function.gmp-random.php                            29-May-2024 02:08                6329
function.gmp-root.php                              29-May-2024 02:08                3308
function.gmp-rootrem.php                           29-May-2024 02:08                3474
function.gmp-scan0.php                             29-May-2024 02:08                5650
function.gmp-scan1.php                             29-May-2024 02:08                5662
function.gmp-setbit.php                            29-May-2024 02:08               11566
function.gmp-sign.php                              29-May-2024 02:08                5134
function.gmp-sqrt.php                              29-May-2024 02:08                5062
function.gmp-sqrtrem.php                           29-May-2024 02:08                6442
function.gmp-strval.php                            29-May-2024 02:08                4834
function.gmp-sub.php                               29-May-2024 02:08                5229
function.gmp-testbit.php                           29-May-2024 02:08                6095
function.gmp-xor.php                               29-May-2024 02:08                5622
function.gmstrftime.php                            29-May-2024 02:08                8833
function.gnupg-adddecryptkey.php                   29-May-2024 02:08                5352
function.gnupg-addencryptkey.php                   29-May-2024 02:08                4901
function.gnupg-addsignkey.php                      29-May-2024 02:08                5374
function.gnupg-cleardecryptkeys.php                29-May-2024 02:08                4450
function.gnupg-clearencryptkeys.php                29-May-2024 02:08                4455
function.gnupg-clearsignkeys.php                   29-May-2024 02:08                4397
function.gnupg-decrypt.php                         29-May-2024 02:08                6117
function.gnupg-decryptverify.php                   29-May-2024 02:08                7269
function.gnupg-deletekey.php                       29-May-2024 02:08                5193
function.gnupg-encrypt.php                         29-May-2024 02:08                6020
function.gnupg-encryptsign.php                     29-May-2024 02:08                6920
function.gnupg-export.php                          29-May-2024 02:08                5213
function.gnupg-getengineinfo.php                   29-May-2024 02:08                5569
function.gnupg-geterror.php                        29-May-2024 02:08                4371
function.gnupg-geterrorinfo.php                    29-May-2024 02:08                5672
function.gnupg-getprotocol.php                     29-May-2024 02:08                4459
function.gnupg-gettrustlist.php                    29-May-2024 02:08                5281
function.gnupg-import.php                          29-May-2024 02:08                5478
function.gnupg-init.php                            29-May-2024 02:08                7263
function.gnupg-keyinfo.php                         29-May-2024 02:08                5405
function.gnupg-listsignatures.php                  29-May-2024 02:08                5505
function.gnupg-setarmor.php                        29-May-2024 02:08                5666
function.gnupg-seterrormode.php                    29-May-2024 02:08                5716
function.gnupg-setsignmode.php                     29-May-2024 02:08                5801
function.gnupg-sign.php                            29-May-2024 02:08                6262
function.gnupg-verify.php                          29-May-2024 02:08                8510
function.grapheme-extract.php                      29-May-2024 02:08                8941
function.grapheme-stripos.php                      29-May-2024 02:08                8218
function.grapheme-stristr.php                      29-May-2024 02:08                7842
function.grapheme-strlen.php                       29-May-2024 02:08                5558
function.grapheme-strpos.php                       29-May-2024 02:08                7890
function.grapheme-strripos.php                     29-May-2024 02:08                7676
function.grapheme-strrpos.php                      29-May-2024 02:08                7340
function.grapheme-strstr.php                       29-May-2024 02:08                7491
function.grapheme-substr.php                       29-May-2024 02:08                8078
function.gregoriantojd.php                         29-May-2024 02:08                7544
function.gzclose.php                               29-May-2024 02:08                4291
function.gzcompress.php                            29-May-2024 02:08                6054
function.gzdecode.php                              29-May-2024 02:08                3788
function.gzdeflate.php                             29-May-2024 02:08                5699
function.gzencode.php                              29-May-2024 02:08                7006
function.gzeof.php                                 29-May-2024 02:08                4169
function.gzfile.php                                29-May-2024 02:08                4812
function.gzgetc.php                                29-May-2024 02:08                4718
function.gzgets.php                                29-May-2024 02:08                6157
function.gzgetss.php                               29-May-2024 02:08                6103
function.gzinflate.php                             29-May-2024 02:08                5424
function.gzopen.php                                29-May-2024 02:08                5742
function.gzpassthru.php                            29-May-2024 02:08                4775
function.gzputs.php                                29-May-2024 02:08                1666
function.gzread.php                                29-May-2024 02:08                6656
function.gzrewind.php                              29-May-2024 02:08                3315
function.gzseek.php                                29-May-2024 02:08                6376
function.gztell.php                                29-May-2024 02:08                3475
function.gzuncompress.php                          29-May-2024 02:08                5384
function.gzwrite.php                               29-May-2024 02:08                6661
function.halt-compiler.php                         29-May-2024 02:08                5014
function.hash-algos.php                            29-May-2024 02:08                5699
function.hash-copy.php                             29-May-2024 02:08                5567
function.hash-equals.php                           29-May-2024 02:08                7247
function.hash-file.php                             29-May-2024 02:08                7482
function.hash-final.php                            29-May-2024 02:08                4957
function.hash-hkdf.php                             29-May-2024 02:08                9895
function.hash-hmac-algos.php                       29-May-2024 02:08                5197
function.hash-hmac-file.php                        29-May-2024 02:08                8350
function.hash-hmac.php                             29-May-2024 02:08                7936
function.hash-init.php                             29-May-2024 02:08               10448
function.hash-pbkdf2.php                           29-May-2024 02:08               12549
function.hash-update-file.php                      29-May-2024 02:08                5831
function.hash-update-stream.php                    29-May-2024 02:08                7383
function.hash-update.php                           29-May-2024 02:08                4443
function.hash.php                                  29-May-2024 02:08                7282
function.header-register-callback.php              29-May-2024 02:08                6621
function.header-remove.php                         29-May-2024 02:08                6647
function.header.php                                29-May-2024 02:08               18575
function.headers-list.php                          29-May-2024 02:08                5821
function.headers-sent.php                          29-May-2024 02:08                7887
function.hebrev.php                                29-May-2024 02:08                3473
function.hebrevc.php                               29-May-2024 02:08                3812
function.hex2bin.php                               29-May-2024 02:08                4958
function.hexdec.php                                29-May-2024 02:08                6377
function.highlight-file.php                        29-May-2024 02:08                5859
function.highlight-string.php                      29-May-2024 02:08                6808
function.hrtime.php                                29-May-2024 02:08                5135
function.html-entity-decode.php                    29-May-2024 02:08               14410
function.htmlentities.php                          29-May-2024 02:08               17209
function.htmlspecialchars-decode.php               29-May-2024 02:08                9254
function.htmlspecialchars.php                      29-May-2024 02:08               22242
function.http-build-query.php                      29-May-2024 02:08               19622
function.http-response-code.php                    29-May-2024 02:08                6876
function.hypot.php                                 29-May-2024 02:08                3027
function.ibase-add-user.php                        29-May-2024 02:08                5173
function.ibase-affected-rows.php                   29-May-2024 02:08                3444
function.ibase-backup.php                          29-May-2024 02:08               10478
function.ibase-blob-add.php                        29-May-2024 02:08                3979
function.ibase-blob-cancel.php                     29-May-2024 02:08                3696
function.ibase-blob-close.php                      29-May-2024 02:08                3966
function.ibase-blob-create.php                     29-May-2024 02:08                4044
function.ibase-blob-echo.php                       29-May-2024 02:08                4223
function.ibase-blob-get.php                        29-May-2024 02:08                6564
function.ibase-blob-import.php                     29-May-2024 02:08                7979
function.ibase-blob-info.php                       29-May-2024 02:08                3515
function.ibase-blob-open.php                       29-May-2024 02:08                4439
function.ibase-close.php                           29-May-2024 02:08                3798
function.ibase-commit-ret.php                      29-May-2024 02:08                3323
function.ibase-commit.php                          29-May-2024 02:08                3124
function.ibase-connect.php                         29-May-2024 02:08               10507
function.ibase-db-info.php                         29-May-2024 02:08                2709
function.ibase-delete-user.php                     29-May-2024 02:08                3589
function.ibase-drop-db.php                         29-May-2024 02:08                3696
function.ibase-errcode.php                         29-May-2024 02:08                2670
function.ibase-errmsg.php                          29-May-2024 02:08                2663
function.ibase-execute.php                         29-May-2024 02:08                6948
function.ibase-fetch-assoc.php                     29-May-2024 02:08                4719
function.ibase-fetch-object.php                    29-May-2024 02:08                6644
function.ibase-fetch-row.php                       29-May-2024 02:08                4536
function.ibase-field-info.php                      29-May-2024 02:08                6940
function.ibase-free-event-handler.php              29-May-2024 02:08                3534
function.ibase-free-query.php                      29-May-2024 02:08                2839
function.ibase-free-result.php                     29-May-2024 02:08                2931
function.ibase-gen-id.php                          29-May-2024 02:08                2820
function.ibase-maintain-db.php                     29-May-2024 02:08                3138
function.ibase-modify-user.php                     29-May-2024 02:08                5178
function.ibase-name-result.php                     29-May-2024 02:08                5785
function.ibase-num-fields.php                      29-May-2024 02:08                6401
function.ibase-num-params.php                      29-May-2024 02:08                3434
function.ibase-param-info.php                      29-May-2024 02:08                3686
function.ibase-pconnect.php                        29-May-2024 02:08                7913
function.ibase-prepare.php                         29-May-2024 02:08                4664
function.ibase-query.php                           29-May-2024 02:08                7215
function.ibase-restore.php                         29-May-2024 02:08               10745
function.ibase-rollback-ret.php                    29-May-2024 02:08                3364
function.ibase-rollback.php                        29-May-2024 02:08                3169
function.ibase-server-info.php                     29-May-2024 02:08                9827
function.ibase-service-attach.php                  29-May-2024 02:08               11046
function.ibase-service-detach.php                  29-May-2024 02:08                6147
function.ibase-set-event-handler.php               29-May-2024 02:08                7880
function.ibase-trans.php                           29-May-2024 02:08                5890
function.ibase-wait-event.php                      29-May-2024 02:08                4335
function.iconv-get-encoding.php                    29-May-2024 02:08                5584
function.iconv-mime-decode-headers.php             29-May-2024 02:08               10040
function.iconv-mime-decode.php                     29-May-2024 02:08                8250
function.iconv-mime-encode.php                     29-May-2024 02:08               11980
function.iconv-set-encoding.php                    29-May-2024 02:08                4927
function.iconv-strlen.php                          29-May-2024 02:08                4988
function.iconv-strpos.php                          29-May-2024 02:08                7439
function.iconv-strrpos.php                         29-May-2024 02:08                6681
function.iconv-substr.php                          29-May-2024 02:08                8004
function.iconv.php                                 29-May-2024 02:08                8792
function.idate.php                                 29-May-2024 02:08               11074
function.idn-to-ascii.php                          29-May-2024 02:08                7786
function.idn-to-utf8.php                           29-May-2024 02:08                7794
function.igbinary-serialize.php                    29-May-2024 02:08                9827
function.igbinary-unserialize.php                  29-May-2024 02:08                9888
function.ignore-user-abort.php                     29-May-2024 02:08                7174
function.image-type-to-extension.php               29-May-2024 02:08                5385
function.image-type-to-mime-type.php               29-May-2024 02:08                8983
function.image2wbmp.php                            29-May-2024 02:08                6377
function.imageaffine.php                           29-May-2024 02:08                4806
function.imageaffinematrixconcat.php               29-May-2024 02:08                6605
function.imageaffinematrixget.php                  29-May-2024 02:08                6676
function.imagealphablending.php                    29-May-2024 02:08                7953
function.imageantialias.php                        29-May-2024 02:08               10612
function.imagearc.php                              29-May-2024 02:08               13617
function.imageavif.php                             29-May-2024 02:08                6027
function.imagebmp.php                              29-May-2024 02:08                8202
function.imagechar.php                             29-May-2024 02:08               10067
function.imagecharup.php                           29-May-2024 02:08                9912
function.imagecolorallocate.php                    29-May-2024 02:08                9895
function.imagecolorallocatealpha.php               29-May-2024 02:08               17984
function.imagecolorat.php                          29-May-2024 02:08               10096
function.imagecolorclosest.php                     29-May-2024 02:08               11910
function.imagecolorclosestalpha.php                29-May-2024 02:08               12464
function.imagecolorclosesthwb.php                  29-May-2024 02:08                6534
function.imagecolordeallocate.php                  29-May-2024 02:08                5906
function.imagecolorexact.php                       29-May-2024 02:08                8429
function.imagecolorexactalpha.php                  29-May-2024 02:08                9363
function.imagecolormatch.php                       29-May-2024 02:08                8412
function.imagecolorresolve.php                     29-May-2024 02:08                7622
function.imagecolorresolvealpha.php                29-May-2024 02:08                8296
function.imagecolorset.php                         29-May-2024 02:08                8850
function.imagecolorsforindex.php                   29-May-2024 02:08                7303
function.imagecolorstotal.php                      29-May-2024 02:08                5735
function.imagecolortransparent.php                 29-May-2024 02:08                9023
function.imageconvolution.php                      29-May-2024 02:08               11841
function.imagecopy.php                             29-May-2024 02:08                9346
function.imagecopymerge.php                        29-May-2024 02:08                9595
function.imagecopymergegray.php                    29-May-2024 02:08               10027
function.imagecopyresampled.php                    29-May-2024 02:08               18911
function.imagecopyresized.php                      29-May-2024 02:08               13750
function.imagecreate.php                           29-May-2024 02:08                8202
function.imagecreatefromavif.php                   29-May-2024 02:08                2915
function.imagecreatefrombmp.php                    29-May-2024 02:08                5494
function.imagecreatefromgd.php                     29-May-2024 02:08                6037
function.imagecreatefromgd2.php                    29-May-2024 02:08                6314
function.imagecreatefromgd2part.php                29-May-2024 02:08                8862
function.imagecreatefromgif.php                    29-May-2024 02:08                9529
function.imagecreatefromjpeg.php                   29-May-2024 02:08                9217
function.imagecreatefrompng.php                    29-May-2024 02:08                9177
function.imagecreatefromstring.php                 29-May-2024 02:08                7930
function.imagecreatefromtga.php                    29-May-2024 02:08                3553
function.imagecreatefromwbmp.php                   29-May-2024 02:08                9272
function.imagecreatefromwebp.php                   29-May-2024 02:08                5585
function.imagecreatefromxbm.php                    29-May-2024 02:08                5433
function.imagecreatefromxpm.php                    29-May-2024 02:08                6077
function.imagecreatetruecolor.php                  29-May-2024 02:08                7112
function.imagecrop.php                             29-May-2024 02:08                7856
function.imagecropauto.php                         29-May-2024 02:08               10747
function.imagedashedline.php                       29-May-2024 02:08               12644
function.imagedestroy.php                          29-May-2024 02:08                5117
function.imageellipse.php                          29-May-2024 02:08                9615
function.imagefill.php                             29-May-2024 02:08                7629
function.imagefilledarc.php                        29-May-2024 02:08               18864
function.imagefilledellipse.php                    29-May-2024 02:08                9836
function.imagefilledpolygon.php                    29-May-2024 02:08               12041
function.imagefilledrectangle.php                  29-May-2024 02:08                8425
function.imagefilltoborder.php                     29-May-2024 02:08               11341
function.imagefilter.php                           29-May-2024 02:08               33635
function.imageflip.php                             29-May-2024 02:08                9826
function.imagefontheight.php                       29-May-2024 02:08                6434
function.imagefontwidth.php                        29-May-2024 02:08                6397
function.imageftbbox.php                           29-May-2024 02:08               13903
function.imagefttext.php                           29-May-2024 02:08               15418
function.imagegammacorrect.php                     29-May-2024 02:08                6020
function.imagegd.php                               29-May-2024 02:08               10631
function.imagegd2.php                              29-May-2024 02:08               11616
function.imagegetclip.php                          29-May-2024 02:08                6100
function.imagegetinterpolation.php                 29-May-2024 02:08                3759
function.imagegif.php                              29-May-2024 02:08               16430
function.imagegrabscreen.php                       29-May-2024 02:08                4806
function.imagegrabwindow.php                       29-May-2024 02:08                9934
function.imageinterlace.php                        29-May-2024 02:08                7188
function.imageistruecolor.php                      29-May-2024 02:08                7379
function.imagejpeg.php                             29-May-2024 02:08               14904
function.imagelayereffect.php                      29-May-2024 02:08               11961
function.imageline.php                             29-May-2024 02:08               15567
function.imageloadfont.php                         29-May-2024 02:08                9294
function.imageopenpolygon.php                      29-May-2024 02:08               10529
function.imagepalettecopy.php                      29-May-2024 02:08                7425
function.imagepalettetotruecolor.php               29-May-2024 02:08                9801
function.imagepng.php                              29-May-2024 02:08                8875
function.imagepolygon.php                          29-May-2024 02:08               10688
function.imagerectangle.php                        29-May-2024 02:08               10588
function.imageresolution.php                       29-May-2024 02:08                7930
function.imagerotate.php                           29-May-2024 02:08                8969
function.imagesavealpha.php                        29-May-2024 02:08                7626
function.imagescale.php                            29-May-2024 02:08                6858
function.imagesetbrush.php                         29-May-2024 02:08                9306
function.imagesetclip.php                          29-May-2024 02:08                5320
function.imagesetinterpolation.php                 29-May-2024 02:08               11636
function.imagesetpixel.php                         29-May-2024 02:08               11480
function.imagesetstyle.php                         29-May-2024 02:08               12300
function.imagesetthickness.php                     29-May-2024 02:08                8451
function.imagesettile.php                          29-May-2024 02:08                8354
function.imagestring.php                           29-May-2024 02:08               10244
function.imagestringup.php                         29-May-2024 02:08                9423
function.imagesx.php                               29-May-2024 02:08                5046
function.imagesy.php                               29-May-2024 02:08                5066
function.imagetruecolortopalette.php               29-May-2024 02:08                6770
function.imagettfbbox.php                          29-May-2024 02:08               18999
function.imagettftext.php                          29-May-2024 02:08               17504
function.imagetypes.php                            29-May-2024 02:08                4980
function.imagewbmp.php                             29-May-2024 02:08               15044
function.imagewebp.php                             29-May-2024 02:08                7575
function.imagexbm.php                              29-May-2024 02:08               11770
function.imap-8bit.php                             29-May-2024 02:08                3167
function.imap-alerts.php                           29-May-2024 02:08                3249
function.imap-append.php                           29-May-2024 02:08                9612
function.imap-base64.php                           29-May-2024 02:08                3544
function.imap-binary.php                           29-May-2024 02:08                3133
function.imap-body.php                             29-May-2024 02:08                5617
function.imap-bodystruct.php                       29-May-2024 02:08                4712
function.imap-check.php                            29-May-2024 02:08                6016
function.imap-clearflag-full.php                   29-May-2024 02:08                6458
function.imap-close.php                            29-May-2024 02:08                4971
function.imap-create.php                           29-May-2024 02:08                1770
function.imap-createmailbox.php                    29-May-2024 02:08               13819
function.imap-delete.php                           29-May-2024 02:08               10486
function.imap-deletemailbox.php                    29-May-2024 02:08                4934
function.imap-errors.php                           29-May-2024 02:08                3436
function.imap-expunge.php                          29-May-2024 02:08                3609
function.imap-fetch-overview.php                   29-May-2024 02:08               11289
function.imap-fetchbody.php                        29-May-2024 02:08                6211
function.imap-fetchheader.php                      29-May-2024 02:08                5862
function.imap-fetchmime.php                        29-May-2024 02:08                6400
function.imap-fetchstructure.php                   29-May-2024 02:08                9714
function.imap-fetchtext.php                        29-May-2024 02:08                1751
function.imap-gc.php                               29-May-2024 02:08                5839
function.imap-get-quota.php                        29-May-2024 02:08               12184
function.imap-get-quotaroot.php                    29-May-2024 02:08                9144
function.imap-getacl.php                           29-May-2024 02:08                5864
function.imap-getmailboxes.php                     29-May-2024 02:08               12086
function.imap-getsubscribed.php                    29-May-2024 02:08                7830
function.imap-header.php                           29-May-2024 02:08                1962
function.imap-headerinfo.php                       29-May-2024 02:08               11766
function.imap-headers.php                          29-May-2024 02:08                3492
function.imap-is-open.php                          29-May-2024 02:08                4206
function.imap-last-error.php                       29-May-2024 02:08                3165
function.imap-list.php                             29-May-2024 02:08                8599
function.imap-listmailbox.php                      29-May-2024 02:08                1756
function.imap-listscan.php                         29-May-2024 02:08                6886
function.imap-listsubscribed.php                   29-May-2024 02:08                1777
function.imap-lsub.php                             29-May-2024 02:08                5933
function.imap-mail-compose.php                     29-May-2024 02:08               16573
function.imap-mail-copy.php                        29-May-2024 02:08                6262
function.imap-mail-move.php                        29-May-2024 02:08                6645
function.imap-mail.php                             29-May-2024 02:08                7399
function.imap-mailboxmsginfo.php                   29-May-2024 02:08                9259
function.imap-mime-header-decode.php               29-May-2024 02:08                6475
function.imap-msgno.php                            29-May-2024 02:08                4175
function.imap-mutf7-to-utf8.php                    29-May-2024 02:08                3357
function.imap-num-msg.php                          29-May-2024 02:08                4032
function.imap-num-recent.php                       29-May-2024 02:08                3839
function.imap-open.php                             29-May-2024 02:08               21740
function.imap-ping.php                             29-May-2024 02:08                4904
function.imap-qprint.php                           29-May-2024 02:08                3179
function.imap-rename.php                           29-May-2024 02:08                1773
function.imap-renamemailbox.php                    29-May-2024 02:08                5574
function.imap-reopen.php                           29-May-2024 02:08                8761
function.imap-rfc822-parse-adrlist.php             29-May-2024 02:08                7865
function.imap-rfc822-parse-headers.php             29-May-2024 02:08                3726
function.imap-rfc822-write-address.php             29-May-2024 02:08                5390
function.imap-savebody.php                         29-May-2024 02:08                6599
function.imap-scan.php                             29-May-2024 02:08                1738
function.imap-scanmailbox.php                      29-May-2024 02:08                1768
function.imap-search.php                           29-May-2024 02:08               13527
function.imap-set-quota.php                        29-May-2024 02:08                6741
function.imap-setacl.php                           29-May-2024 02:08                5491
function.imap-setflag-full.php                     29-May-2024 02:08                8618
function.imap-sort.php                             29-May-2024 02:08                8553
function.imap-status.php                           29-May-2024 02:08               10730
function.imap-subscribe.php                        29-May-2024 02:08                4442
function.imap-thread.php                           29-May-2024 02:08                7882
function.imap-timeout.php                          29-May-2024 02:08                4777
function.imap-uid.php                              29-May-2024 02:08                4588
function.imap-undelete.php                         29-May-2024 02:08                4978
function.imap-unsubscribe.php                      29-May-2024 02:08                4519
function.imap-utf7-decode.php                      29-May-2024 02:08                3756
function.imap-utf7-encode.php                      29-May-2024 02:08                3273
function.imap-utf8-to-mutf7.php                    29-May-2024 02:08                3360
function.imap-utf8.php                             29-May-2024 02:08                4225
function.implode.php                               29-May-2024 02:08                7702
function.in-array.php                              29-May-2024 02:08               11625
function.include-once.php                          29-May-2024 02:08                2136
function.include.php                               29-May-2024 02:08               19416
function.inet-ntop.php                             29-May-2024 02:08                6271
function.inet-pton.php                             29-May-2024 02:08                4828
function.inflate-add.php                           29-May-2024 02:08                6266
function.inflate-get-read-len.php                  29-May-2024 02:08                3427
function.inflate-get-status.php                    29-May-2024 02:08                3253
function.inflate-init.php                          29-May-2024 02:08                7085
function.ini-alter.php                             29-May-2024 02:08                1706
function.ini-get-all.php                           29-May-2024 02:08                9956
function.ini-get.php                               29-May-2024 02:08               10283
function.ini-parse-quantity.php                    29-May-2024 02:08                7570
function.ini-restore.php                           29-May-2024 02:08                6297
function.ini-set.php                               29-May-2024 02:08                6559
function.inotify-add-watch.php                     29-May-2024 02:08                4420
function.inotify-init.php                          29-May-2024 02:08                8875
function.inotify-queue-len.php                     29-May-2024 02:08                3793
function.inotify-read.php                          29-May-2024 02:08                4392
function.inotify-rm-watch.php                      29-May-2024 02:08                3652
function.intdiv.php                                29-May-2024 02:08                7439
function.interface-exists.php                      29-May-2024 02:08                5325
function.intl-error-name.php                       29-May-2024 02:08                5019
function.intl-get-error-code.php                   29-May-2024 02:08                4515
function.intl-get-error-message.php                29-May-2024 02:08                4526
function.intl-is-failure.php                       29-May-2024 02:08                5485
function.intval.php                                29-May-2024 02:08               13482
function.ip2long.php                               29-May-2024 02:08                9059
function.iptcembed.php                             29-May-2024 02:08               11726
function.iptcparse.php                             29-May-2024 02:08                4618
function.is-a.php                                  29-May-2024 02:08                6909
function.is-array.php                              29-May-2024 02:08                5602
function.is-bool.php                               29-May-2024 02:08                5385
function.is-callable.php                           29-May-2024 02:08               10624
function.is-countable.php                          29-May-2024 02:08                6156
function.is-dir.php                                29-May-2024 02:08                6469
function.is-double.php                             29-May-2024 02:08                1703
function.is-executable.php                         29-May-2024 02:08                6367
function.is-file.php                               29-May-2024 02:08                5961
function.is-finite.php                             29-May-2024 02:08                6240
function.is-float.php                              29-May-2024 02:08                6457
function.is-infinite.php                           29-May-2024 02:08                5411
function.is-int.php                                29-May-2024 02:08                6510
function.is-integer.php                            29-May-2024 02:08                1696
function.is-iterable.php                           29-May-2024 02:08                5753
function.is-link.php                               29-May-2024 02:08                5631
function.is-long.php                               29-May-2024 02:08                1677
function.is-nan.php                                29-May-2024 02:08                6420
function.is-null.php                               29-May-2024 02:08                5945
function.is-numeric.php                            29-May-2024 02:08               11864
function.is-object.php                             29-May-2024 02:08                7020
function.is-readable.php                           29-May-2024 02:08                6184
function.is-real.php                               29-May-2024 02:08                1876
function.is-resource.php                           29-May-2024 02:08                5110
function.is-scalar.php                             29-May-2024 02:08                8062
function.is-soap-fault.php                         29-May-2024 02:08                8138
function.is-string.php                             29-May-2024 02:08                6609
function.is-subclass-of.php                        29-May-2024 02:08               12129
function.is-tainted.php                            29-May-2024 02:08                2377
function.is-uploaded-file.php                      29-May-2024 02:08                6637
function.is-writable.php                           29-May-2024 02:08                5773
function.is-writeable.php                          29-May-2024 02:08                1751
function.isset.php                                 29-May-2024 02:08               16011
function.iterator-apply.php                        29-May-2024 02:08                6673
function.iterator-count.php                        29-May-2024 02:08                8635
function.iterator-to-array.php                     29-May-2024 02:08                7689
function.jddayofweek.php                           29-May-2024 02:08                3757
function.jdmonthname.php                           29-May-2024 02:08                4963
function.jdtofrench.php                            29-May-2024 02:08                3036
function.jdtogregorian.php                         29-May-2024 02:08                3086
function.jdtojewish.php                            29-May-2024 02:08                7313
function.jdtojulian.php                            29-May-2024 02:08                3047
function.jdtounix.php                              29-May-2024 02:08                4362
function.jewishtojd.php                            29-May-2024 02:08                4500
function.join.php                                  29-May-2024 02:08                1663
function.jpeg2wbmp.php                             29-May-2024 02:08                6677
function.json-decode.php                           29-May-2024 02:08               20125
function.json-encode.php                           29-May-2024 02:08               30804
function.json-last-error-msg.php                   29-May-2024 02:08                3085
function.json-last-error.php                       29-May-2024 02:08               13881
function.json-validate.php                         29-May-2024 02:08                8529
function.juliantojd.php                            29-May-2024 02:08                4391
function.key-exists.php                            29-May-2024 02:08                1737
function.key.php                                   29-May-2024 02:08                7879
function.krsort.php                                29-May-2024 02:08                8738
function.ksort.php                                 29-May-2024 02:08               10706
function.lcfirst.php                               29-May-2024 02:08                5820
function.lcg-value.php                             29-May-2024 02:08                4943
function.lchgrp.php                                29-May-2024 02:08                5862
function.lchown.php                                29-May-2024 02:08                5760
function.ldap-8859-to-t61.php                      29-May-2024 02:08                3389
function.ldap-add-ext.php                          29-May-2024 02:08                5780
function.ldap-add.php                              29-May-2024 02:08               10421
function.ldap-bind-ext.php                         29-May-2024 02:08                6058
function.ldap-bind.php                             29-May-2024 02:08                9573
function.ldap-close.php                            29-May-2024 02:08                1721
function.ldap-compare.php                          29-May-2024 02:08               10328
function.ldap-connect-wallet.php                   29-May-2024 02:08                4472
function.ldap-connect.php                          29-May-2024 02:08                9794
function.ldap-control-paged-result-response.php    29-May-2024 02:08                5908
function.ldap-control-paged-result.php             29-May-2024 02:08               14504
function.ldap-count-entries.php                    29-May-2024 02:08                5725
function.ldap-count-references.php                 29-May-2024 02:08                4762
function.ldap-delete-ext.php                       29-May-2024 02:08                5310
function.ldap-delete.php                           29-May-2024 02:08                5332
function.ldap-dn2ufn.php                           29-May-2024 02:08                2779
function.ldap-err2str.php                          29-May-2024 02:08                4650
function.ldap-errno.php                            29-May-2024 02:08                7531
function.ldap-error.php                            29-May-2024 02:08                4523
function.ldap-escape.php                           29-May-2024 02:08                6366
function.ldap-exop-passwd.php                      29-May-2024 02:08               10539
function.ldap-exop-refresh.php                     29-May-2024 02:08                5169
function.ldap-exop-sync.php                        29-May-2024 02:08                5609
function.ldap-exop-whoami.php                      29-May-2024 02:08                3943
function.ldap-exop.php                             29-May-2024 02:08               12494
function.ldap-explode-dn.php                       29-May-2024 02:08                3685
function.ldap-first-attribute.php                  29-May-2024 02:08                5462
function.ldap-first-entry.php                      29-May-2024 02:08                5822
function.ldap-first-reference.php                  29-May-2024 02:08                2355
function.ldap-free-result.php                      29-May-2024 02:08                4147
function.ldap-get-attributes.php                   29-May-2024 02:08                8226
function.ldap-get-dn.php                           29-May-2024 02:08                4324
function.ldap-get-entries.php                      29-May-2024 02:08                6149
function.ldap-get-option.php                       29-May-2024 02:08               16716
function.ldap-get-values-len.php                   29-May-2024 02:08                5521
function.ldap-get-values.php                       29-May-2024 02:08                8630
function.ldap-list.php                             29-May-2024 02:08               15449
function.ldap-mod-add.php                          29-May-2024 02:08                6831
function.ldap-mod-del.php                          29-May-2024 02:08                6380
function.ldap-mod-replace.php                      29-May-2024 02:08                6776
function.ldap-mod_add-ext.php                      29-May-2024 02:08                5779
function.ldap-mod_del-ext.php                      29-May-2024 02:08                5795
function.ldap-mod_replace-ext.php                  29-May-2024 02:08                5857
function.ldap-modify-batch.php                     29-May-2024 02:08               18981
function.ldap-modify.php                           29-May-2024 02:08                2121
function.ldap-next-attribute.php                   29-May-2024 02:08                5241
function.ldap-next-entry.php                       29-May-2024 02:08                5822
function.ldap-next-reference.php                   29-May-2024 02:08                2282
function.ldap-parse-exop.php                       29-May-2024 02:08                6003
function.ldap-parse-reference.php                  29-May-2024 02:08                2424
function.ldap-parse-result.php                     29-May-2024 02:08                9946
function.ldap-read.php                             29-May-2024 02:08               12776
function.ldap-rename-ext.php                       29-May-2024 02:08                6129
function.ldap-rename.php                           29-May-2024 02:08                7225
function.ldap-sasl-bind.php                        29-May-2024 02:08                7165
function.ldap-search.php                           29-May-2024 02:08               15657
function.ldap-set-option.php                       29-May-2024 02:08               19299
function.ldap-set-rebind-proc.php                  29-May-2024 02:08                3222
function.ldap-sort.php                             29-May-2024 02:08                7195
function.ldap-start-tls.php                        29-May-2024 02:08                2038
function.ldap-t61-to-8859.php                      29-May-2024 02:08                2190
function.ldap-unbind.php                           29-May-2024 02:08                3858
function.levenshtein.php                           29-May-2024 02:08               12203
function.libxml-clear-errors.php                   29-May-2024 02:08                2845
function.libxml-disable-entity-loader.php          29-May-2024 02:08                4945
function.libxml-get-errors.php                     29-May-2024 02:08               10688
function.libxml-get-external-entity-loader.php     29-May-2024 02:08                3487
function.libxml-get-last-error.php                 29-May-2024 02:08                3221
function.libxml-set-external-entity-loader.php     29-May-2024 02:08               10540
function.libxml-set-streams-context.php            29-May-2024 02:08                5069
function.libxml-use-internal-errors.php            29-May-2024 02:08                6676
function.link.php                                  29-May-2024 02:08                5842
function.linkinfo.php                              29-May-2024 02:08                4493
function.list.php                                  29-May-2024 02:08               16522
function.localeconv.php                            29-May-2024 02:08                9505
function.localtime.php                             29-May-2024 02:08                9134
function.log.php                                   29-May-2024 02:08                3994
function.log10.php                                 29-May-2024 02:08                2704
function.log1p.php                                 29-May-2024 02:08                3390
function.long2ip.php                               29-May-2024 02:08                4380
function.lstat.php                                 29-May-2024 02:08                6365
function.ltrim.php                                 29-May-2024 02:08                9476
function.lzf-compress.php                          29-May-2024 02:08                2979
function.lzf-decompress.php                        29-May-2024 02:08                3071
function.lzf-optimized-for.php                     29-May-2024 02:08                2252
function.mail.php                                  29-May-2024 02:08               25494
function.mailparse-determine-best-xfer-encoding..> 29-May-2024 02:08                4283
function.mailparse-msg-create.php                  29-May-2024 02:08                3389
function.mailparse-msg-extract-part-file.php       29-May-2024 02:08                5368
function.mailparse-msg-extract-part.php            29-May-2024 02:08                4096
function.mailparse-msg-extract-whole-part-file.php 29-May-2024 02:08                4126
function.mailparse-msg-free.php                    29-May-2024 02:08                3663
function.mailparse-msg-get-part-data.php           29-May-2024 02:08                2576
function.mailparse-msg-get-part.php                29-May-2024 02:08                2859
function.mailparse-msg-get-structure.php           29-May-2024 02:08                2596
function.mailparse-msg-parse-file.php              29-May-2024 02:08                4273
function.mailparse-msg-parse.php                   29-May-2024 02:08                3586
function.mailparse-rfc822-parse-addresses.php      29-May-2024 02:08                5690
function.mailparse-stream-encode.php               29-May-2024 02:08                5941
function.mailparse-uudecode-all.php                29-May-2024 02:08                6924
function.max.php                                   29-May-2024 02:08               12097
function.mb-check-encoding.php                     29-May-2024 02:08                5478
function.mb-chr.php                                29-May-2024 02:08                6984
function.mb-convert-case.php                       29-May-2024 02:08               11761
function.mb-convert-encoding.php                   29-May-2024 02:08               11949
function.mb-convert-kana.php                       29-May-2024 02:08               10201
function.mb-convert-variables.php                  29-May-2024 02:08                6647
function.mb-decode-mimeheader.php                  29-May-2024 02:08                3312
function.mb-decode-numericentity.php               29-May-2024 02:08               33986
function.mb-detect-encoding.php                    29-May-2024 02:08               16133
function.mb-detect-order.php                       29-May-2024 02:08                8893
function.mb-encode-mimeheader.php                  29-May-2024 02:08                9690
function.mb-encode-numericentity.php               29-May-2024 02:08               12746
function.mb-encoding-aliases.php                   29-May-2024 02:08                6386
function.mb-ereg-match.php                         29-May-2024 02:08                5613
function.mb-ereg-replace-callback.php              29-May-2024 02:08               12484
function.mb-ereg-replace.php                       29-May-2024 02:08                7179
function.mb-ereg-search-getpos.php                 29-May-2024 02:08                3862
function.mb-ereg-search-getregs.php                29-May-2024 02:08                4341
function.mb-ereg-search-init.php                   29-May-2024 02:08                6147
function.mb-ereg-search-pos.php                    29-May-2024 02:08                6008
function.mb-ereg-search-regs.php                   29-May-2024 02:08                5760
function.mb-ereg-search-setpos.php                 29-May-2024 02:08                4547
function.mb-ereg-search.php                        29-May-2024 02:08                5701
function.mb-ereg.php                               29-May-2024 02:08                6485
function.mb-eregi-replace.php                      29-May-2024 02:08                7063
function.mb-eregi.php                              29-May-2024 02:08                6529
function.mb-get-info.php                           29-May-2024 02:08                6237
function.mb-http-input.php                         29-May-2024 02:08                5060
function.mb-http-output.php                        29-May-2024 02:08                4900
function.mb-internal-encoding.php                  29-May-2024 02:08                6839
function.mb-language.php                           29-May-2024 02:08                6596
function.mb-list-encodings.php                     29-May-2024 02:08                5036
function.mb-ord.php                                29-May-2024 02:08                6820
function.mb-output-handler.php                     29-May-2024 02:08                5199
function.mb-parse-str.php                          29-May-2024 02:08                4679
function.mb-preferred-mime-name.php                29-May-2024 02:08                4555
function.mb-regex-encoding.php                     29-May-2024 02:08                4609
function.mb-regex-set-options.php                  29-May-2024 02:08                8663
function.mb-scrub.php                              29-May-2024 02:08                4169
function.mb-send-mail.php                          29-May-2024 02:08                9630
function.mb-split.php                              29-May-2024 02:08                4788
function.mb-str-pad.php                            29-May-2024 02:08                8610
function.mb-str-split.php                          29-May-2024 02:08                5214
function.mb-strcut.php                             29-May-2024 02:08                7328
function.mb-strimwidth.php                         29-May-2024 02:08                7986
function.mb-stripos.php                            29-May-2024 02:08                6426
function.mb-stristr.php                            29-May-2024 02:08                6843
function.mb-strlen.php                             29-May-2024 02:08                5148
function.mb-strpos.php                             29-May-2024 02:08                6499
function.mb-strrchr.php                            29-May-2024 02:08                6651
function.mb-strrichr.php                           29-May-2024 02:08                6739
function.mb-strripos.php                           29-May-2024 02:08                6353
function.mb-strrpos.php                            29-May-2024 02:08                6823
function.mb-strstr.php                             29-May-2024 02:08                6598
function.mb-strtolower.php                         29-May-2024 02:08                7075
function.mb-strtoupper.php                         29-May-2024 02:08                7083
function.mb-strwidth.php                           29-May-2024 02:08                9129
function.mb-substitute-character.php               29-May-2024 02:08                7331
function.mb-substr-count.php                       29-May-2024 02:08                5920
function.mb-substr.php                             29-May-2024 02:08                6505
function.mcrypt-create-iv.php                      29-May-2024 02:08                6959
function.mcrypt-decrypt.php                        29-May-2024 02:08                5863
function.mcrypt-enc-get-algorithms-name.php        29-May-2024 02:08                5294
function.mcrypt-enc-get-block-size.php             29-May-2024 02:08                2996
function.mcrypt-enc-get-iv-size.php                29-May-2024 02:08                3132
function.mcrypt-enc-get-key-size.php               29-May-2024 02:08                3024
function.mcrypt-enc-get-modes-name.php             29-May-2024 02:08                5208
function.mcrypt-enc-get-supported-key-sizes.php    29-May-2024 02:08                4950
function.mcrypt-enc-is-block-algorithm-mode.php    29-May-2024 02:08                3577
function.mcrypt-enc-is-block-algorithm.php         29-May-2024 02:08                3256
function.mcrypt-enc-is-block-mode.php              29-May-2024 02:08                3499
function.mcrypt-enc-self-test.php                  29-May-2024 02:08                3070
function.mcrypt-encrypt.php                        29-May-2024 02:08               13585
function.mcrypt-generic-deinit.php                 29-May-2024 02:08                4006
function.mcrypt-generic-init.php                   29-May-2024 02:08                5195
function.mcrypt-generic.php                        29-May-2024 02:08                5767
function.mcrypt-get-block-size.php                 29-May-2024 02:08                6591
function.mcrypt-get-cipher-name.php                29-May-2024 02:08                5041
function.mcrypt-get-iv-size.php                    29-May-2024 02:08                6338
function.mcrypt-get-key-size.php                   29-May-2024 02:08                6726
function.mcrypt-list-algorithms.php                29-May-2024 02:08                4732
function.mcrypt-list-modes.php                     29-May-2024 02:08                4569
function.mcrypt-module-close.php                   29-May-2024 02:08                3426
function.mcrypt-module-get-algo-block-size.php     29-May-2024 02:08                3526
function.mcrypt-module-get-algo-key-size.php       29-May-2024 02:08                3556
function.mcrypt-module-get-supported-key-sizes.php 29-May-2024 02:08                4493
function.mcrypt-module-is-block-algorithm-mode.php 29-May-2024 02:08                4434
function.mcrypt-module-is-block-algorithm.php      29-May-2024 02:08                3959
function.mcrypt-module-is-block-mode.php           29-May-2024 02:08                4680
function.mcrypt-module-open.php                    29-May-2024 02:08               13818
function.mcrypt-module-self-test.php               29-May-2024 02:08                4963
function.md5-file.php                              29-May-2024 02:08                5196
function.md5.php                                   29-May-2024 02:08                5890
function.mdecrypt-generic.php                      29-May-2024 02:08               10772
function.memcache-debug.php                        29-May-2024 02:08                3742
function.memory-get-peak-usage.php                 29-May-2024 02:08                3688
function.memory-get-usage.php                      29-May-2024 02:08                5514
function.memory-reset-peak-usage.php               29-May-2024 02:08                4957
function.metaphone.php                             29-May-2024 02:08                8195
function.method-exists.php                         29-May-2024 02:08                6551
function.mhash-count.php                           29-May-2024 02:08                4604
function.mhash-get-block-size.php                  29-May-2024 02:08                4561
function.mhash-get-hash-name.php                   29-May-2024 02:08                4516
function.mhash-keygen-s2k.php                      29-May-2024 02:08                5691
function.mhash.php                                 29-May-2024 02:08                4841
function.microtime.php                             29-May-2024 02:08                7779
function.mime-content-type.php                     29-May-2024 02:08                5076
function.min.php                                   29-May-2024 02:08               12624
function.mkdir.php                                 29-May-2024 02:08                9403
function.mktime.php                                29-May-2024 02:08               18262
function.money-format.php                          29-May-2024 02:08               17295
function.mongodb.bson-fromjson.php                 29-May-2024 02:08                5875
function.mongodb.bson-fromphp.php                  29-May-2024 02:08                6217
function.mongodb.bson-tocanonicalextendedjson.php  29-May-2024 02:08               13916
function.mongodb.bson-tojson.php                   29-May-2024 02:08               14991
function.mongodb.bson-tophp.php                    29-May-2024 02:08                9094
function.mongodb.bson-torelaxedextendedjson.php    29-May-2024 02:08               13613
function.mongodb.driver.monitoring.addsubscribe..> 29-May-2024 02:08                5076
function.mongodb.driver.monitoring.removesubscr..> 29-May-2024 02:08                4936
function.move-uploaded-file.php                    29-May-2024 02:08                8316
function.mqseries-back.php                         29-May-2024 02:08                6473
function.mqseries-begin.php                        29-May-2024 02:08                7438
function.mqseries-close.php                        29-May-2024 02:08                6656
function.mqseries-cmit.php                         29-May-2024 02:08                6403
function.mqseries-conn.php                         29-May-2024 02:08                5981
function.mqseries-connx.php                        29-May-2024 02:08               12682
function.mqseries-disc.php                         29-May-2024 02:08                5683
function.mqseries-get.php                          29-May-2024 02:08               12301
function.mqseries-inq.php                          29-May-2024 02:08                9359
function.mqseries-open.php                         29-May-2024 02:08                7292
function.mqseries-put.php                          29-May-2024 02:08               12580
function.mqseries-put1.php                         29-May-2024 02:08                6328
function.mqseries-set.php                          29-May-2024 02:08                6254
function.mqseries-strerror.php                     29-May-2024 02:08                4269
function.msg-get-queue.php                         29-May-2024 02:08                5667
function.msg-queue-exists.php                      29-May-2024 02:08                3439
function.msg-receive.php                           29-May-2024 02:08               11463
function.msg-remove-queue.php                      29-May-2024 02:08                4628
function.msg-send.php                              29-May-2024 02:08                9589
function.msg-set-queue.php                         29-May-2024 02:08                5286
function.msg-stat-queue.php                        29-May-2024 02:08                6659
function.mt-getrandmax.php                         29-May-2024 02:08                3202
function.mt-rand.php                               29-May-2024 02:08               10159
function.mt-srand.php                              29-May-2024 02:08                8165
function.mysql-affected-rows.php                   29-May-2024 02:08               11768
function.mysql-client-encoding.php                 29-May-2024 02:08                5887
function.mysql-close.php                           29-May-2024 02:08                7164
function.mysql-connect.php                         29-May-2024 02:08               16539
function.mysql-create-db.php                       29-May-2024 02:08                8259
function.mysql-data-seek.php                       29-May-2024 02:08               11668
function.mysql-db-name.php                         29-May-2024 02:08                7656
function.mysql-db-query.php                        29-May-2024 02:08                9649
function.mysql-drop-db.php                         29-May-2024 02:08                8719
function.mysql-errno.php                           29-May-2024 02:08                7947
function.mysql-error.php                           29-May-2024 02:08                7922
function.mysql-escape-string.php                   29-May-2024 02:08                6383
function.mysql-fetch-array.php                     29-May-2024 02:08                8129
function.mysql-fetch-assoc.php                     29-May-2024 02:08               11175
function.mysql-fetch-field.php                     29-May-2024 02:08               20529
function.mysql-fetch-lengths.php                   29-May-2024 02:08                7546
function.mysql-fetch-object.php                    29-May-2024 02:08               11664
function.mysql-fetch-row.php                       29-May-2024 02:08                9013
function.mysql-field-flags.php                     29-May-2024 02:08                8431
function.mysql-field-len.php                       29-May-2024 02:08                6930
function.mysql-field-name.php                      29-May-2024 02:08               12736
function.mysql-field-seek.php                      29-May-2024 02:08                5037
function.mysql-field-table.php                     29-May-2024 02:08                7546
function.mysql-field-type.php                      29-May-2024 02:08               17810
function.mysql-free-result.php                     29-May-2024 02:08                8068
function.mysql-get-client-info.php                 29-May-2024 02:08                5060
function.mysql-get-host-info.php                   29-May-2024 02:08                6871
function.mysql-get-proto-info.php                  29-May-2024 02:08                6461
function.mysql-get-server-info.php                 29-May-2024 02:08                6943
function.mysql-info.php                            29-May-2024 02:08                6093
function.mysql-insert-id.php                       29-May-2024 02:08                8115
function.mysql-list-dbs.php                        29-May-2024 02:08                8553
function.mysql-list-fields.php                     29-May-2024 02:08                8660
function.mysql-list-processes.php                  29-May-2024 02:08                7477
function.mysql-list-tables.php                     29-May-2024 02:08                9370
function.mysql-num-fields.php                      29-May-2024 02:08                6504
function.mysql-num-rows.php                        29-May-2024 02:08                7902
function.mysql-pconnect.php                        29-May-2024 02:08                8127
function.mysql-ping.php                            29-May-2024 02:08                7673
function.mysql-query.php                           29-May-2024 02:08               13645
function.mysql-real-escape-string.php              29-May-2024 02:08               15032
function.mysql-result.php                          29-May-2024 02:08                9514
function.mysql-select-db.php                       29-May-2024 02:08               10312
function.mysql-set-charset.php                     29-May-2024 02:08                5736
function.mysql-stat.php                            29-May-2024 02:08                9128
function.mysql-tablename.php                       29-May-2024 02:08                7930
function.mysql-thread-id.php                       29-May-2024 02:08                6454
function.mysql-unbuffered-query.php                29-May-2024 02:08                6841
function.mysql-xdevapi-expression.php              29-May-2024 02:08                4784
function.mysql-xdevapi-getsession.php              29-May-2024 02:08               13078
function.mysqli-connect.php                        29-May-2024 02:08                2320
function.mysqli-escape-string.php                  29-May-2024 02:08                1960
function.mysqli-execute.php                        29-May-2024 02:08                2551
function.mysqli-get-client-stats.php               29-May-2024 02:08                8380
function.mysqli-get-links-stats.php                29-May-2024 02:08                3276
function.mysqli-report.php                         29-May-2024 02:08                1762
function.mysqli-set-opt.php                        29-May-2024 02:08                1886
function.natcasesort.php                           29-May-2024 02:08                7636
function.natsort.php                               29-May-2024 02:08               10800
function.net-get-interfaces.php                    29-May-2024 02:08                4623
function.next.php                                  29-May-2024 02:08                9500
function.ngettext.php                              29-May-2024 02:08                5783
function.nl-langinfo.php                           29-May-2024 02:08               15419
function.nl2br.php                                 29-May-2024 02:08                6634
function.number-format.php                         29-May-2024 02:08                8560
function.oauth-get-sbs.php                         29-May-2024 02:08                3159
function.oauth-urlencode.php                       29-May-2024 02:08                2653
function.ob-clean.php                              29-May-2024 02:08                4462
function.ob-end-clean.php                          29-May-2024 02:08                5635
function.ob-end-flush.php                          29-May-2024 02:08                5549
function.ob-flush.php                              29-May-2024 02:08                4586
function.ob-get-clean.php                          29-May-2024 02:08                6497
function.ob-get-contents.php                       29-May-2024 02:08                4754
function.ob-get-flush.php                          29-May-2024 02:08                6505
function.ob-get-length.php                         29-May-2024 02:08                4693
function.ob-get-level.php                          29-May-2024 02:08                3564
function.ob-get-status.php                         29-May-2024 02:08                9995
function.ob-gzhandler.php                          29-May-2024 02:08                5748
function.ob-iconv-handler.php                      29-May-2024 02:08                5057
function.ob-implicit-flush.php                     29-May-2024 02:08                5137
function.ob-list-handlers.php                      29-May-2024 02:08               13760
function.ob-start.php                              29-May-2024 02:08               15045
function.ob-tidyhandler.php                        29-May-2024 02:08                4392
function.oci-bind-array-by-name.php                29-May-2024 02:08               13930
function.oci-bind-by-name.php                      29-May-2024 02:08               78446
function.oci-cancel.php                            29-May-2024 02:08                2777
function.oci-client-version.php                    29-May-2024 02:08                4024
function.oci-close.php                             29-May-2024 02:08               18219
function.oci-commit.php                            29-May-2024 02:08               10736
function.oci-connect.php                           29-May-2024 02:08               34935
function.oci-define-by-name.php                    29-May-2024 02:08               23777
function.oci-error.php                             29-May-2024 02:08               11703
function.oci-execute.php                           29-May-2024 02:08               21048
function.oci-fetch-all.php                         29-May-2024 02:08               24231
function.oci-fetch-array.php                       29-May-2024 02:08               64427
function.oci-fetch-assoc.php                       29-May-2024 02:08                8859
function.oci-fetch-object.php                      29-May-2024 02:08               18235
function.oci-fetch-row.php                         29-May-2024 02:08                8800
function.oci-fetch.php                             29-May-2024 02:08               13441
function.oci-field-is-null.php                     29-May-2024 02:08                7893
function.oci-field-name.php                        29-May-2024 02:08                9786
function.oci-field-precision.php                   29-May-2024 02:08                8648
function.oci-field-scale.php                       29-May-2024 02:08                8633
function.oci-field-size.php                        29-May-2024 02:08               10263
function.oci-field-type-raw.php                    29-May-2024 02:08                7962
function.oci-field-type.php                        29-May-2024 02:08               10664
function.oci-free-descriptor.php                   29-May-2024 02:08                3553
function.oci-free-statement.php                    29-May-2024 02:08                3031
function.oci-get-implicit-resultset.php            29-May-2024 02:08               28202
function.oci-internal-debug.php                    29-May-2024 02:08                3106
function.oci-lob-copy.php                          29-May-2024 02:08                4616
function.oci-lob-is-equal.php                      29-May-2024 02:08                3310
function.oci-new-collection.php                    29-May-2024 02:08                5090
function.oci-new-connect.php                       29-May-2024 02:08               16319
function.oci-new-cursor.php                        29-May-2024 02:08                7748
function.oci-new-descriptor.php                    29-May-2024 02:08               18227
function.oci-num-fields.php                        29-May-2024 02:08                6912
function.oci-num-rows.php                          29-May-2024 02:08                7885
function.oci-parse.php                             29-May-2024 02:08               12467
function.oci-password-change.php                   29-May-2024 02:08               13317
function.oci-pconnect.php                          29-May-2024 02:08               14698
function.oci-register-taf-callback.php             29-May-2024 02:08                5811
function.oci-result.php                            29-May-2024 02:08                8525
function.oci-rollback.php                          29-May-2024 02:08               14090
function.oci-server-version.php                    29-May-2024 02:08                4761
function.oci-set-action.php                        29-May-2024 02:08                8383
function.oci-set-call-timout.php                   29-May-2024 02:08                5989
function.oci-set-client-identifier.php             29-May-2024 02:08                8135
function.oci-set-client-info.php                   29-May-2024 02:08                8305
function.oci-set-db-operation.php                  29-May-2024 02:08                7806
function.oci-set-edition.php                       29-May-2024 02:08                9773
function.oci-set-module-name.php                   29-May-2024 02:08                8499
function.oci-set-prefetch-lob.php                  29-May-2024 02:08                8875
function.oci-set-prefetch.php                      29-May-2024 02:08               20178
function.oci-statement-type.php                    29-May-2024 02:08                7048
function.oci-unregister-taf-callback.php           29-May-2024 02:08                3662
function.ocibindbyname.php                         29-May-2024 02:08                1976
function.ocicancel.php                             29-May-2024 02:08                1918
function.ocicloselob.php                           29-May-2024 02:08                1917
function.ocicollappend.php                         29-May-2024 02:08                1982
function.ocicollassign.php                         29-May-2024 02:08                1987
function.ocicollassignelem.php                     29-May-2024 02:08                2032
function.ocicollgetelem.php                        29-May-2024 02:08                1999
function.ocicollmax.php                            29-May-2024 02:08                1951
function.ocicollsize.php                           29-May-2024 02:08                1954
function.ocicolltrim.php                           29-May-2024 02:08                1964
function.ocicolumnisnull.php                       29-May-2024 02:08                1988
function.ocicolumnname.php                         29-May-2024 02:08                1980
function.ocicolumnprecision.php                    29-May-2024 02:08                2023
function.ocicolumnscale.php                        29-May-2024 02:08                1987
function.ocicolumnsize.php                         29-May-2024 02:08                1968
function.ocicolumntype.php                         29-May-2024 02:08                1972
function.ocicolumntyperaw.php                      29-May-2024 02:08                1995
function.ocicommit.php                             29-May-2024 02:08                1932
function.ocidefinebyname.php                       29-May-2024 02:08                1978
function.ocierror.php                              29-May-2024 02:08                1909
function.ociexecute.php                            29-May-2024 02:08                1913
function.ocifetch.php                              29-May-2024 02:08                1903
function.ocifetchinto.php                          29-May-2024 02:08                2654
function.ocifetchstatement.php                     29-May-2024 02:08                1996
function.ocifreecollection.php                     29-May-2024 02:08                2014
function.ocifreecursor.php                         29-May-2024 02:08                1986
function.ocifreedesc.php                           29-May-2024 02:08                1930
function.ocifreestatement.php                      29-May-2024 02:08                2005
function.ociinternaldebug.php                      29-May-2024 02:08                2019
function.ociloadlob.php                            29-May-2024 02:08                1915
function.ocilogoff.php                             29-May-2024 02:08                1902
function.ocilogon.php                              29-May-2024 02:08                1917
function.ocinewcollection.php                      29-May-2024 02:08                2003
function.ocinewcursor.php                          29-May-2024 02:08                1971
function.ocinewdescriptor.php                      29-May-2024 02:08                1993
function.ocinlogon.php                             29-May-2024 02:08                1942
function.ocinumcols.php                            29-May-2024 02:08                1927
function.ociparse.php                              29-May-2024 02:08                1897
function.ociplogon.php                             29-May-2024 02:08                1912
function.ociresult.php                             29-May-2024 02:08                1910
function.ocirollback.php                           29-May-2024 02:08                1932
function.ocirowcount.php                           29-May-2024 02:08                1934
function.ocisavelob.php                            29-May-2024 02:08                1915
function.ocisavelobfile.php                        29-May-2024 02:08                1953
function.ociserverversion.php                      29-May-2024 02:08                2007
function.ocisetprefetch.php                        29-May-2024 02:08                1993
function.ocistatementtype.php                      29-May-2024 02:08                2013
function.ociwritelobtofile.php                     29-May-2024 02:08                1994
function.ociwritetemporarylob.php                  29-May-2024 02:08                2017
function.octdec.php                                29-May-2024 02:08                5799
function.odbc-autocommit.php                       29-May-2024 02:08                5457
function.odbc-binmode.php                          29-May-2024 02:08                7313
function.odbc-close-all.php                        29-May-2024 02:08                2590
function.odbc-close.php                            29-May-2024 02:08                2904
function.odbc-columnprivileges.php                 29-May-2024 02:08                8690
function.odbc-columns.php                          29-May-2024 02:08               11663
function.odbc-commit.php                           29-May-2024 02:08                2743
function.odbc-connect.php                          29-May-2024 02:08                8877
function.odbc-connection-string-is-quoted.php      29-May-2024 02:08                3716
function.odbc-connection-string-quote.php          29-May-2024 02:08                5749
function.odbc-connection-string-should-quote.php   29-May-2024 02:08                3980
function.odbc-cursor.php                           29-May-2024 02:08                2742
function.odbc-data-source.php                      29-May-2024 02:08                6228
function.odbc-do.php                               29-May-2024 02:08                1700
function.odbc-error.php                            29-May-2024 02:08                4178
function.odbc-errormsg.php                         29-May-2024 02:08                4231
function.odbc-exec.php                             29-May-2024 02:08                4073
function.odbc-execute.php                          29-May-2024 02:08                7115
function.odbc-fetch-array.php                      29-May-2024 02:08                4362
function.odbc-fetch-into.php                       29-May-2024 02:08                5279
function.odbc-fetch-object.php                     29-May-2024 02:08                4368
function.odbc-fetch-row.php                        29-May-2024 02:08                4904
function.odbc-field-len.php                        29-May-2024 02:08                3488
function.odbc-field-name.php                       29-May-2024 02:08                3105
function.odbc-field-num.php                        29-May-2024 02:08                3125
function.odbc-field-precision.php                  29-May-2024 02:08                2224
function.odbc-field-scale.php                      29-May-2024 02:08                3120
function.odbc-field-type.php                       29-May-2024 02:08                3105
function.odbc-foreignkeys.php                      29-May-2024 02:08                9145
function.odbc-free-result.php                      29-May-2024 02:08                3407
function.odbc-gettypeinfo.php                      29-May-2024 02:08                4605
function.odbc-longreadlen.php                      29-May-2024 02:08                3916
function.odbc-next-result.php                      29-May-2024 02:08                9001
function.odbc-num-fields.php                       29-May-2024 02:08                2643
function.odbc-num-rows.php                         29-May-2024 02:08                3283
function.odbc-pconnect.php                         29-May-2024 02:08                4853
function.odbc-prepare.php                          29-May-2024 02:08                6442
function.odbc-primarykeys.php                      29-May-2024 02:08                7945
function.odbc-procedurecolumns.php                 29-May-2024 02:08               11881
function.odbc-procedures.php                       29-May-2024 02:08                9669
function.odbc-result-all.php                       29-May-2024 02:08                4189
function.odbc-result.php                           29-May-2024 02:08                5930
function.odbc-rollback.php                         29-May-2024 02:08                2762
function.odbc-setoption.php                        29-May-2024 02:08                7215
function.odbc-specialcolumns.php                   29-May-2024 02:08                8009
function.odbc-statistics.php                       29-May-2024 02:08               10068
function.odbc-tableprivileges.php                  29-May-2024 02:08                8287
function.odbc-tables.php                           29-May-2024 02:08               12596
function.opcache-compile-file.php                  29-May-2024 02:08                3867
function.opcache-get-configuration.php             29-May-2024 02:08                3254
function.opcache-get-status.php                    29-May-2024 02:08                3748
function.opcache-invalidate.php                    29-May-2024 02:08                4388
function.opcache-is-script-cached.php              29-May-2024 02:08                3451
function.opcache-reset.php                         29-May-2024 02:08                3373
function.openal-buffer-create.php                  29-May-2024 02:08                2875
function.openal-buffer-data.php                    29-May-2024 02:08                5023
function.openal-buffer-destroy.php                 29-May-2024 02:08                3215
function.openal-buffer-get.php                     29-May-2024 02:08                4017
function.openal-buffer-loadwav.php                 29-May-2024 02:08                3756
function.openal-context-create.php                 29-May-2024 02:08                3409
function.openal-context-current.php                29-May-2024 02:08                3270
function.openal-context-destroy.php                29-May-2024 02:08                3256
function.openal-context-process.php                29-May-2024 02:08                3644
function.openal-context-suspend.php                29-May-2024 02:08                3638
function.openal-device-close.php                   29-May-2024 02:08                3222
function.openal-device-open.php                    29-May-2024 02:08                3402
function.openal-listener-get.php                   29-May-2024 02:08                3453
function.openal-listener-set.php                   29-May-2024 02:08                3854
function.openal-source-create.php                  29-May-2024 02:08                3071
function.openal-source-destroy.php                 29-May-2024 02:08                3223
function.openal-source-get.php                     29-May-2024 02:08                5641
function.openal-source-pause.php                   29-May-2024 02:08                3524
function.openal-source-play.php                    29-May-2024 02:08                3523
function.openal-source-rewind.php                  29-May-2024 02:08                3533
function.openal-source-set.php                     29-May-2024 02:08                6382
function.openal-source-stop.php                    29-May-2024 02:08                3505
function.openal-stream.php                         29-May-2024 02:08                4465
function.opendir.php                               29-May-2024 02:08                7884
function.openlog.php                               29-May-2024 02:08               10360
function.openssl-cipher-iv-length.php              29-May-2024 02:08                4474
function.openssl-cipher-key-length.php             29-May-2024 02:08                4442
function.openssl-cms-decrypt.php                   29-May-2024 02:08                5749
function.openssl-cms-encrypt.php                   29-May-2024 02:08                6725
function.openssl-cms-read.php                      29-May-2024 02:08                3275
function.openssl-cms-sign.php                      29-May-2024 02:08                8395
function.openssl-cms-verify.php                    29-May-2024 02:08                7490
function.openssl-csr-export-to-file.php            29-May-2024 02:08                8498
function.openssl-csr-export.php                    29-May-2024 02:08                8408
function.openssl-csr-get-public-key.php            29-May-2024 02:08                8722
function.openssl-csr-get-subject.php               29-May-2024 02:08                9472
function.openssl-csr-new.php                       29-May-2024 02:08               21599
function.openssl-csr-sign.php                      29-May-2024 02:08               13281
function.openssl-decrypt.php                       29-May-2024 02:08                7886
function.openssl-dh-compute-key.php                29-May-2024 02:08               16067
function.openssl-digest.php                        29-May-2024 02:08                4652
function.openssl-encrypt.php                       29-May-2024 02:08               18027
function.openssl-error-string.php                  29-May-2024 02:08                3781
function.openssl-free-key.php                      29-May-2024 02:08                3713
function.openssl-get-cert-locations.php            29-May-2024 02:08                4005
function.openssl-get-cipher-methods.php            29-May-2024 02:08               14068
function.openssl-get-curve-names.php               29-May-2024 02:08                7118
function.openssl-get-md-methods.php                29-May-2024 02:08                6960
function.openssl-get-privatekey.php                29-May-2024 02:08                1925
function.openssl-get-publickey.php                 29-May-2024 02:08                1896
function.openssl-open.php                          29-May-2024 02:08               10101
function.openssl-pbkdf2.php                        29-May-2024 02:08                7525
function.openssl-pkcs12-export-to-file.php         29-May-2024 02:08                7407
function.openssl-pkcs12-export.php                 29-May-2024 02:08                7424
function.openssl-pkcs12-read.php                   29-May-2024 02:08                5639
function.openssl-pkcs7-decrypt.php                 29-May-2024 02:08                7648
function.openssl-pkcs7-encrypt.php                 29-May-2024 02:08               10722
function.openssl-pkcs7-read.php                    29-May-2024 02:08                6950
function.openssl-pkcs7-sign.php                    29-May-2024 02:08               11910
function.openssl-pkcs7-verify.php                  29-May-2024 02:08                8285
function.openssl-pkey-derive.php                   29-May-2024 02:08                8252
function.openssl-pkey-export-to-file.php           29-May-2024 02:08                6500
function.openssl-pkey-export.php                   29-May-2024 02:08                6397
function.openssl-pkey-free.php                     29-May-2024 02:08                3908
function.openssl-pkey-get-details.php              29-May-2024 02:08                9694
function.openssl-pkey-get-private.php              29-May-2024 02:08                6052
function.openssl-pkey-get-public.php               29-May-2024 02:08                5429
function.openssl-pkey-new.php                      29-May-2024 02:08                6953
function.openssl-private-decrypt.php               29-May-2024 02:08                6381
function.openssl-private-encrypt.php               29-May-2024 02:08                6570
function.openssl-public-decrypt.php                29-May-2024 02:08                6544
function.openssl-public-encrypt.php                29-May-2024 02:08                6906
function.openssl-random-pseudo-bytes.php           29-May-2024 02:08                9136
function.openssl-seal.php                          29-May-2024 02:08               11254
function.openssl-sign.php                          29-May-2024 02:08               12905
function.openssl-spki-export-challenge.php         29-May-2024 02:08                7569
function.openssl-spki-export.php                   29-May-2024 02:08                8288
function.openssl-spki-new.php                      29-May-2024 02:08                9046
function.openssl-spki-verify.php                   29-May-2024 02:08                7717
function.openssl-verify.php                        29-May-2024 02:08               13371
function.openssl-x509-check-private-key.php        29-May-2024 02:08                5781
function.openssl-x509-checkpurpose.php             29-May-2024 02:08                7360
function.openssl-x509-export-to-file.php           29-May-2024 02:08                5110
function.openssl-x509-export.php                   29-May-2024 02:08                5083
function.openssl-x509-fingerprint.php              29-May-2024 02:08                5442
function.openssl-x509-free.php                     29-May-2024 02:08                3913
function.openssl-x509-parse.php                    29-May-2024 02:08                4695
function.openssl-x509-read.php                     29-May-2024 02:08                4483
function.openssl-x509-verify.php                   29-May-2024 02:08               12492
function.ord.php                                   29-May-2024 02:08                7077
function.output-add-rewrite-var.php                29-May-2024 02:08                9245
function.output-reset-rewrite-vars.php             29-May-2024 02:08                6360
function.pack.php                                  29-May-2024 02:08               12503
function.parse-ini-file.php                        29-May-2024 02:08               20026
function.parse-ini-string.php                      29-May-2024 02:08                7312
function.parse-str.php                             29-May-2024 02:08               10075
function.parse-url.php                             29-May-2024 02:08               16505
function.passthru.php                              29-May-2024 02:08                7257
function.password-algos.php                        29-May-2024 02:08                3371
function.password-get-info.php                     29-May-2024 02:08                3479
function.password-hash.php                         29-May-2024 02:08               21776
function.password-needs-rehash.php                 29-May-2024 02:08                8004
function.password-verify.php                       29-May-2024 02:08                6739
function.pathinfo.php                              29-May-2024 02:08               14068
function.pclose.php                                29-May-2024 02:08                4746
function.pcntl-alarm.php                           29-May-2024 02:08                2949
function.pcntl-async-signals.php                   29-May-2024 02:08                4240
function.pcntl-errno.php                           29-May-2024 02:08                1788
function.pcntl-exec.php                            29-May-2024 02:08                3769
function.pcntl-fork.php                            29-May-2024 02:08                4902
function.pcntl-get-last-error.php                  29-May-2024 02:08                2739
function.pcntl-getpriority.php                     29-May-2024 02:08                5863
function.pcntl-rfork.php                           29-May-2024 02:08                7682
function.pcntl-setpriority.php                     29-May-2024 02:08                5678
function.pcntl-signal-dispatch.php                 29-May-2024 02:08                5601
function.pcntl-signal-get-handler.php              29-May-2024 02:08                6800
function.pcntl-signal.php                          29-May-2024 02:08               11258
function.pcntl-sigprocmask.php                     29-May-2024 02:08                6015
function.pcntl-sigtimedwait.php                    29-May-2024 02:08                5090
function.pcntl-sigwaitinfo.php                     29-May-2024 02:08                7447
function.pcntl-strerror.php                        29-May-2024 02:08                2955
function.pcntl-unshare.php                         29-May-2024 02:08                4649
function.pcntl-wait.php                            29-May-2024 02:08                7914
function.pcntl-waitpid.php                         29-May-2024 02:08                9114
function.pcntl-wexitstatus.php                     29-May-2024 02:08                3760
function.pcntl-wifexited.php                       29-May-2024 02:08                3485
function.pcntl-wifsignaled.php                     29-May-2024 02:08                3507
function.pcntl-wifstopped.php                      29-May-2024 02:08                3552
function.pcntl-wstopsig.php                        29-May-2024 02:08                3693
function.pcntl-wtermsig.php                        29-May-2024 02:08                3856
function.pfsockopen.php                            29-May-2024 02:08                5695
function.pg-affected-rows.php                      29-May-2024 02:08                6717
function.pg-cancel-query.php                       29-May-2024 02:08                7418
function.pg-client-encoding.php                    29-May-2024 02:08                6766
function.pg-close.php                              29-May-2024 02:08                6838
function.pg-connect-poll.php                       29-May-2024 02:08                4108
function.pg-connect.php                            29-May-2024 02:08               10663
function.pg-connection-busy.php                    29-May-2024 02:08                5699
function.pg-connection-reset.php                   29-May-2024 02:08                5726
function.pg-connection-status.php                  29-May-2024 02:08                5545
function.pg-consume-input.php                      29-May-2024 02:08                3677
function.pg-convert.php                            29-May-2024 02:08                9668
function.pg-copy-from.php                          29-May-2024 02:08                8017
function.pg-copy-to.php                            29-May-2024 02:08                7417
function.pg-dbname.php                             29-May-2024 02:08                5338
function.pg-delete.php                             29-May-2024 02:08                9649
function.pg-end-copy.php                           29-May-2024 02:08                7364
function.pg-escape-bytea.php                       29-May-2024 02:08                7783
function.pg-escape-identifier.php                  29-May-2024 02:08                7822
function.pg-escape-literal.php                     29-May-2024 02:08                8187
function.pg-escape-string.php                      29-May-2024 02:08                7609
function.pg-execute.php                            29-May-2024 02:08               10357
function.pg-fetch-all-columns.php                  29-May-2024 02:08                7079
function.pg-fetch-all.php                          29-May-2024 02:08                9142
function.pg-fetch-array.php                        29-May-2024 02:08               12721
function.pg-fetch-assoc.php                        29-May-2024 02:08                9492
function.pg-fetch-object.php                       29-May-2024 02:08               11635
function.pg-fetch-result.php                       29-May-2024 02:08                9239
function.pg-fetch-row.php                          29-May-2024 02:08                9960
function.pg-field-is-null.php                      29-May-2024 02:08                8511
function.pg-field-name.php                         29-May-2024 02:08                8880
function.pg-field-num.php                          29-May-2024 02:08                6479
function.pg-field-prtlen.php                       29-May-2024 02:08               10765
function.pg-field-size.php                         29-May-2024 02:08                9123
function.pg-field-table.php                        29-May-2024 02:08                8658
function.pg-field-type-oid.php                     29-May-2024 02:08                7426
function.pg-field-type.php                         29-May-2024 02:08                7142
function.pg-flush.php                              29-May-2024 02:08                3645
function.pg-free-result.php                        29-May-2024 02:08                7294
function.pg-get-notify.php                         29-May-2024 02:08                7532
function.pg-get-pid.php                            29-May-2024 02:08                5072
function.pg-get-result.php                         29-May-2024 02:08                8599
function.pg-host.php                               29-May-2024 02:08                6329
function.pg-insert.php                             29-May-2024 02:08               11462
function.pg-last-error.php                         29-May-2024 02:08                7413
function.pg-last-notice.php                        29-May-2024 02:08                8374
function.pg-last-oid.php                           29-May-2024 02:08                7376
function.pg-lo-close.php                           29-May-2024 02:08                7101
function.pg-lo-create.php                          29-May-2024 02:08                8482
function.pg-lo-export.php                          29-May-2024 02:08                8185
function.pg-lo-import.php                          29-May-2024 02:08                7335
function.pg-lo-open.php                            29-May-2024 02:08                8875
function.pg-lo-read-all.php                        29-May-2024 02:08                6310
function.pg-lo-read.php                            29-May-2024 02:08                7093
function.pg-lo-seek.php                            29-May-2024 02:08                7923
function.pg-lo-tell.php                            29-May-2024 02:08                6815
function.pg-lo-truncate.php                        29-May-2024 02:08                6639
function.pg-lo-unlink.php                          29-May-2024 02:08                7165
function.pg-lo-write.php                           29-May-2024 02:08                8100
function.pg-meta-data.php                          29-May-2024 02:08                7524
function.pg-num-fields.php                         29-May-2024 02:08                5918
function.pg-num-rows.php                           29-May-2024 02:08                5887
function.pg-options.php                            29-May-2024 02:08                5666
function.pg-parameter-status.php                   29-May-2024 02:08                8494
function.pg-pconnect.php                           29-May-2024 02:08                9439
function.pg-ping.php                               29-May-2024 02:08                6105
function.pg-port.php                               29-May-2024 02:08                5831
function.pg-prepare.php                            29-May-2024 02:08               10320
function.pg-put-line.php                           29-May-2024 02:08                8604
function.pg-query-params.php                       29-May-2024 02:08               10802
function.pg-query.php                              29-May-2024 02:08               11978
function.pg-result-error-field.php                 29-May-2024 02:08                9719
function.pg-result-error.php                       29-May-2024 02:08                8019
function.pg-result-seek.php                        29-May-2024 02:08                7243
function.pg-result-status.php                      29-May-2024 02:08                8621
function.pg-select.php                             29-May-2024 02:08               11965
function.pg-send-execute.php                       29-May-2024 02:08               10428
function.pg-send-prepare.php                       29-May-2024 02:08               10872
function.pg-send-query-params.php                  29-May-2024 02:08                8099
function.pg-send-query.php                         29-May-2024 02:08                9673
function.pg-set-client-encoding.php                29-May-2024 02:08                8757
function.pg-set-error-context-visibility.php       29-May-2024 02:08                7034
function.pg-set-error-verbosity.php                29-May-2024 02:08                8971
function.pg-socket.php                             29-May-2024 02:08                3796
function.pg-trace.php                              29-May-2024 02:08                9060
function.pg-transaction-status.php                 29-May-2024 02:08                6654
function.pg-tty.php                                29-May-2024 02:08                6101
function.pg-unescape-bytea.php                     29-May-2024 02:08                6296
function.pg-untrace.php                            29-May-2024 02:08                6792
function.pg-update.php                             29-May-2024 02:08               10604
function.pg-version.php                            29-May-2024 02:08                6557
function.php-ini-loaded-file.php                   29-May-2024 02:08                4585
function.php-ini-scanned-files.php                 29-May-2024 02:08                6112
function.php-sapi-name.php                         29-May-2024 02:08                5813
function.php-strip-whitespace.php                  29-May-2024 02:08                4550
function.php-uname.php                             29-May-2024 02:08                8876
function.phpcredits.php                            29-May-2024 02:08                7989
function.phpdbg-break-file.php                     29-May-2024 02:08                3742
function.phpdbg-break-function.php                 29-May-2024 02:08                3481
function.phpdbg-break-method.php                   29-May-2024 02:08                3815
function.phpdbg-break-next.php                     29-May-2024 02:08                3110
function.phpdbg-clear.php                          29-May-2024 02:08                3340
function.phpdbg-color.php                          29-May-2024 02:08                3681
function.phpdbg-end-oplog.php                      29-May-2024 02:08                2608
function.phpdbg-exec.php                           29-May-2024 02:08                3098
function.phpdbg-get-executable.php                 29-May-2024 02:08                2551
function.phpdbg-prompt.php                         29-May-2024 02:08                2824
function.phpdbg-start-oplog.php                    29-May-2024 02:08                2238
function.phpinfo.php                               29-May-2024 02:08                9043
function.phpversion.php                            29-May-2024 02:08               10851
function.pi.php                                    29-May-2024 02:08                3048
function.png2wbmp.php                              29-May-2024 02:08                6657
function.popen.php                                 29-May-2024 02:08                8291
function.pos.php                                   29-May-2024 02:08                1635
function.posix-access.php                          29-May-2024 02:08                6647
function.posix-ctermid.php                         29-May-2024 02:08                4473
function.posix-eaccess.php                         29-May-2024 02:08                7436
function.posix-errno.php                           29-May-2024 02:08                1794
function.posix-fpathconf.php                       29-May-2024 02:08                6907
function.posix-get-last-error.php                  29-May-2024 02:08                4166
function.posix-getcwd.php                          29-May-2024 02:08                4302
function.posix-getegid.php                         29-May-2024 02:08                5231
function.posix-geteuid.php                         29-May-2024 02:08                5221
function.posix-getgid.php                          29-May-2024 02:08                4661
function.posix-getgrgid.php                        29-May-2024 02:08                6462
function.posix-getgrnam.php                        29-May-2024 02:08                6419
function.posix-getgroups.php                       29-May-2024 02:08                4157
function.posix-getlogin.php                        29-May-2024 02:08                3632
function.posix-getpgid.php                         29-May-2024 02:08                4662
function.posix-getpgrp.php                         29-May-2024 02:08                2585
function.posix-getpid.php                          29-May-2024 02:08                3646
function.posix-getppid.php                         29-May-2024 02:08                2997
function.posix-getpwnam.php                        29-May-2024 02:08                6811
function.posix-getpwuid.php                        29-May-2024 02:08                6810
function.posix-getrlimit.php                       29-May-2024 02:08                8434
function.posix-getsid.php                          29-May-2024 02:08                4782
function.posix-getuid.php                          29-May-2024 02:08                3373
function.posix-initgroups.php                      29-May-2024 02:08                3317
function.posix-isatty.php                          29-May-2024 02:08                4510
function.posix-kill.php                            29-May-2024 02:08                3498
function.posix-mkfifo.php                          29-May-2024 02:08                3570
function.posix-mknod.php                           29-May-2024 02:08                7477
function.posix-pathconf.php                        29-May-2024 02:08                6238
function.posix-setegid.php                         29-May-2024 02:08                5134
function.posix-seteuid.php                         29-May-2024 02:08                3547
function.posix-setgid.php                          29-May-2024 02:08                5348
function.posix-setpgid.php                         29-May-2024 02:08                3419
function.posix-setrlimit.php                       29-May-2024 02:08                4618
function.posix-setsid.php                          29-May-2024 02:08                2511
function.posix-setuid.php                          29-May-2024 02:08                5494
function.posix-strerror.php                        29-May-2024 02:08                4811
function.posix-sysconf.php                         29-May-2024 02:08                4043
function.posix-times.php                           29-May-2024 02:08                4657
function.posix-ttyname.php                         29-May-2024 02:08                5349
function.posix-uname.php                           29-May-2024 02:08                4796
function.pow.php                                   29-May-2024 02:08                6598
function.preg-filter.php                           29-May-2024 02:08                9831
function.preg-grep.php                             29-May-2024 02:08                5861
function.preg-last-error-msg.php                   29-May-2024 02:08                4041
function.preg-last-error.php                       29-May-2024 02:08                5099
function.preg-match-all.php                        29-May-2024 02:08               25026
function.preg-match.php                            29-May-2024 02:08               23228
function.preg-quote.php                            29-May-2024 02:08                8372
function.preg-replace-callback-array.php           29-May-2024 02:08               10474
function.preg-replace-callback.php                 29-May-2024 02:08               16428
function.preg-replace.php                          29-May-2024 02:08               24186
function.preg-split.php                            29-May-2024 02:08               12546
function.prev.php                                  29-May-2024 02:08                9618
function.print-r.php                               29-May-2024 02:08                9058
function.print.php                                 29-May-2024 02:08               12269
function.printf.php                                29-May-2024 02:08               26886
function.proc-close.php                            29-May-2024 02:08                3661
function.proc-get-status.php                       29-May-2024 02:08                6721
function.proc-nice.php                             29-May-2024 02:08                7740
function.proc-open.php                             29-May-2024 02:08               21931
function.proc-terminate.php                        29-May-2024 02:08                4650
function.property-exists.php                       29-May-2024 02:08                8449
function.ps-add-bookmark.php                       29-May-2024 02:08                5078
function.ps-add-launchlink.php                     29-May-2024 02:08                5793
function.ps-add-locallink.php                      29-May-2024 02:08                6577
function.ps-add-note.php                           29-May-2024 02:08                7303
function.ps-add-pdflink.php                        29-May-2024 02:08                6950
function.ps-add-weblink.php                        29-May-2024 02:08                5879
function.ps-arc.php                                29-May-2024 02:08                5338
function.ps-arcn.php                               29-May-2024 02:08                5344
function.ps-begin-page.php                         29-May-2024 02:08                7001
function.ps-begin-pattern.php                      29-May-2024 02:08               13430
function.ps-begin-template.php                     29-May-2024 02:08               11414
function.ps-circle.php                             29-May-2024 02:08                4857
function.ps-clip.php                               29-May-2024 02:08                3136
function.ps-close-image.php                        29-May-2024 02:08                4031
function.ps-close.php                              29-May-2024 02:08                3774
function.ps-closepath-stroke.php                   29-May-2024 02:08                3209
function.ps-closepath.php                          29-May-2024 02:08                3370
function.ps-continue-text.php                      29-May-2024 02:08                4182
function.ps-curveto.php                            29-May-2024 02:08                5213
function.ps-delete.php                             29-May-2024 02:08                3653
function.ps-end-page.php                           29-May-2024 02:08                3379
function.ps-end-pattern.php                        29-May-2024 02:08                3310
function.ps-end-template.php                       29-May-2024 02:08                3317
function.ps-fill-stroke.php                        29-May-2024 02:08                3415
function.ps-fill.php                               29-May-2024 02:08                3348
function.ps-findfont.php                           29-May-2024 02:08                7226
function.ps-get-buffer.php                         29-May-2024 02:08                3240
function.ps-get-parameter.php                      29-May-2024 02:08                7999
function.ps-get-value.php                          29-May-2024 02:08                9509
function.ps-hyphenate.php                          29-May-2024 02:08                7370
function.ps-include-file.php                       29-May-2024 02:08                3190
function.ps-lineto.php                             29-May-2024 02:08                8330
function.ps-makespotcolor.php                      29-May-2024 02:08               10241
function.ps-moveto.php                             29-May-2024 02:08                3947
function.ps-new.php                                29-May-2024 02:08                3060
function.ps-open-file.php                          29-May-2024 02:08                3788
function.ps-open-image-file.php                    29-May-2024 02:08                5001
function.ps-open-image.php                         29-May-2024 02:08                7088
function.ps-open-memory-image.php                  29-May-2024 02:08                2874
function.ps-place-image.php                        29-May-2024 02:08                5348
function.ps-rect.php                               29-May-2024 02:08                5068
function.ps-restore.php                            29-May-2024 02:08                3492
function.ps-rotate.php                             29-May-2024 02:08               12201
function.ps-save.php                               29-May-2024 02:08                3239
function.ps-scale.php                              29-May-2024 02:08                3856
function.ps-set-border-color.php                   29-May-2024 02:08                4974
function.ps-set-border-dash.php                    29-May-2024 02:08                4562
function.ps-set-border-style.php                   29-May-2024 02:08                4626
function.ps-set-info.php                           29-May-2024 02:08                6100
function.ps-set-parameter.php                      29-May-2024 02:08                4036
function.ps-set-text-pos.php                       29-May-2024 02:08                9407
function.ps-set-value.php                          29-May-2024 02:08                4848
function.ps-setcolor.php                           29-May-2024 02:08                6055
function.ps-setdash.php                            29-May-2024 02:08                3743
function.ps-setflat.php                            29-May-2024 02:08                3177
function.ps-setfont.php                            29-May-2024 02:08                4161
function.ps-setgray.php                            29-May-2024 02:08                3416
function.ps-setlinecap.php                         29-May-2024 02:08                3942
function.ps-setlinejoin.php                        29-May-2024 02:08                3960
function.ps-setlinewidth.php                       29-May-2024 02:08                3824
function.ps-setmiterlimit.php                      29-May-2024 02:08                4244
function.ps-setoverprintmode.php                   29-May-2024 02:08                3214
function.ps-setpolydash.php                        29-May-2024 02:08                7826
function.ps-shading-pattern.php                    29-May-2024 02:08                4350
function.ps-shading.php                            29-May-2024 02:08                7285
function.ps-shfill.php                             29-May-2024 02:08                4065
function.ps-show-boxed.php                         29-May-2024 02:08               12829
function.ps-show-xy.php                            29-May-2024 02:08                4344
function.ps-show-xy2.php                           29-May-2024 02:08                3191
function.ps-show.php                               29-May-2024 02:08                5849
function.ps-show2.php                              29-May-2024 02:08                3415
function.ps-string-geometry.php                    29-May-2024 02:08                4948
function.ps-stringwidth.php                        29-May-2024 02:08                4425
function.ps-stroke.php                             29-May-2024 02:08                3545
function.ps-symbol-name.php                        29-May-2024 02:08                3953
function.ps-symbol-width.php                       29-May-2024 02:08                4497
function.ps-symbol.php                             29-May-2024 02:08                3811
function.ps-translate.php                          29-May-2024 02:08               14220
function.pspell-add-to-personal.php                29-May-2024 02:08                6457
function.pspell-add-to-session.php                 29-May-2024 02:08                4114
function.pspell-check.php                          29-May-2024 02:08                5029
function.pspell-clear-session.php                  29-May-2024 02:08                5869
function.pspell-config-create.php                  29-May-2024 02:08                8041
function.pspell-config-data-dir.php                29-May-2024 02:08                3394
function.pspell-config-dict-dir.php                29-May-2024 02:08                3393
function.pspell-config-ignore.php                  29-May-2024 02:08                5753
function.pspell-config-mode.php                    29-May-2024 02:08                6597
function.pspell-config-personal.php                29-May-2024 02:08                6543
function.pspell-config-repl.php                    29-May-2024 02:08                6846
function.pspell-config-runtogether.php             29-May-2024 02:08                6406
function.pspell-config-save-repl.php               29-May-2024 02:08                5350
function.pspell-new-config.php                     29-May-2024 02:08                6389
function.pspell-new-personal.php                   29-May-2024 02:08               10985
function.pspell-new.php                            29-May-2024 02:08                9518
function.pspell-save-wordlist.php                  29-May-2024 02:08                6065
function.pspell-store-replacement.php              29-May-2024 02:08                7740
function.pspell-suggest.php                        29-May-2024 02:08                5565
function.putenv.php                                29-May-2024 02:08                3989
function.quoted-printable-decode.php               29-May-2024 02:08                5111
function.quoted-printable-encode.php               29-May-2024 02:08                5094
function.quotemeta.php                             29-May-2024 02:08                5710
function.rad2deg.php                               29-May-2024 02:08                3515
function.radius-acct-open.php                      29-May-2024 02:08                3230
function.radius-add-server.php                     29-May-2024 02:08                7799
function.radius-auth-open.php                      29-May-2024 02:08                3243
function.radius-close.php                          29-May-2024 02:08                2694
function.radius-config.php                         29-May-2024 02:08                4105
function.radius-create-request.php                 29-May-2024 02:08                5352
function.radius-cvt-addr.php                       29-May-2024 02:08                6215
function.radius-cvt-int.php                        29-May-2024 02:08                5615
function.radius-cvt-string.php                     29-May-2024 02:08                5669
function.radius-demangle-mppe-key.php              29-May-2024 02:08                3257
function.radius-demangle.php                       29-May-2024 02:08                2988
function.radius-get-attr.php                       29-May-2024 02:08                6469
function.radius-get-tagged-attr-data.php           29-May-2024 02:08                6567
function.radius-get-tagged-attr-tag.php            29-May-2024 02:08                6620
function.radius-get-vendor-attr.php                29-May-2024 02:08                8210
function.radius-put-addr.php                       29-May-2024 02:08                5640
function.radius-put-attr.php                       29-May-2024 02:08                8867
function.radius-put-int.php                        29-May-2024 02:08                7604
function.radius-put-string.php                     29-May-2024 02:08                7984
function.radius-put-vendor-addr.php                29-May-2024 02:08                5589
function.radius-put-vendor-attr.php                29-May-2024 02:08                7846
function.radius-put-vendor-int.php                 29-May-2024 02:08                6361
function.radius-put-vendor-string.php              29-May-2024 02:08                6754
function.radius-request-authenticator.php          29-May-2024 02:08                3179
function.radius-salt-encrypt-attr.php              29-May-2024 02:08                4277
function.radius-send-request.php                   29-May-2024 02:08                4019
function.radius-server-secret.php                  29-May-2024 02:08                2716
function.radius-strerror.php                       29-May-2024 02:08                2601
function.rand.php                                  29-May-2024 02:08               10065
function.random-bytes.php                          29-May-2024 02:08                9481
function.random-int.php                            29-May-2024 02:08                9206
function.range.php                                 29-May-2024 02:08               16593
function.rar-wrapper-cache-stats.php               29-May-2024 02:08                2315
function.rawurldecode.php                          29-May-2024 02:08                4606
function.rawurlencode.php                          29-May-2024 02:08                6206
function.read-exif-data.php                        29-May-2024 02:08                2461
function.readdir.php                               29-May-2024 02:08                9870
function.readfile.php                              29-May-2024 02:08                9725
function.readgzfile.php                            29-May-2024 02:08                4551
function.readline-add-history.php                  29-May-2024 02:08                2778
function.readline-callback-handler-install.php     29-May-2024 02:08                9286
function.readline-callback-handler-remove.php      29-May-2024 02:08                3817
function.readline-callback-read-char.php           29-May-2024 02:08                3753
function.readline-clear-history.php                29-May-2024 02:08                2506
function.readline-completion-function.php          29-May-2024 02:08                2979
function.readline-info.php                         29-May-2024 02:08                4830
function.readline-list-history.php                 29-May-2024 02:08                2299
function.readline-on-new-line.php                  29-May-2024 02:08                2598
function.readline-read-history.php                 29-May-2024 02:08                3484
function.readline-redisplay.php                    29-May-2024 02:08                2239
function.readline-write-history.php                29-May-2024 02:08                3456
function.readline.php                              29-May-2024 02:08                5113
function.readlink.php                              29-May-2024 02:08                4508
function.realpath-cache-get.php                    29-May-2024 02:08                4151
function.realpath-cache-size.php                   29-May-2024 02:08                3681
function.realpath.php                              29-May-2024 02:08                8366
function.recode-file.php                           29-May-2024 02:08                5864
function.recode-string.php                         29-May-2024 02:08                5189
function.recode.php                                29-May-2024 02:08                1727
function.register-shutdown-function.php            29-May-2024 02:08                7280
function.register-tick-function.php                29-May-2024 02:08                5436
function.rename.php                                29-May-2024 02:08                5992
function.require-once.php                          29-May-2024 02:08                1801
function.require.php                               29-May-2024 02:08                2032
function.reset.php                                 29-May-2024 02:08                9436
function.restore-error-handler.php                 29-May-2024 02:08                5743
function.restore-exception-handler.php             29-May-2024 02:08                6491
function.restore-include-path.php                  29-May-2024 02:08                5053
function.return.php                                29-May-2024 02:08                4129
function.rewind.php                                29-May-2024 02:08                6280
function.rewinddir.php                             29-May-2024 02:08                3522
function.rmdir.php                                 29-May-2024 02:08                5188
function.rnp-backend-string.php                    29-May-2024 02:08                2242
function.rnp-backend-version.php                   29-May-2024 02:08                2178
function.rnp-decrypt.php                           29-May-2024 02:08                3237
function.rnp-dump-packets-to-json.php              29-May-2024 02:08                3151
function.rnp-dump-packets.php                      29-May-2024 02:08                3105
function.rnp-ffi-create.php                        29-May-2024 02:08                3200
function.rnp-ffi-destroy.php                       29-May-2024 02:08                2436
function.rnp-ffi-set-pass-provider.php             29-May-2024 02:08                6731
function.rnp-import-keys.php                       29-May-2024 02:08                3489
function.rnp-import-signatures.php                 29-May-2024 02:08                3479
function.rnp-key-export-autocrypt.php              29-May-2024 02:08                4540
function.rnp-key-export-revocation.php             29-May-2024 02:08                5185
function.rnp-key-export.php                        29-May-2024 02:08                3459
function.rnp-key-get-info.php                      29-May-2024 02:08                7972
function.rnp-key-remove.php                        29-May-2024 02:08                3599
function.rnp-key-revoke.php                        29-May-2024 02:08                4831
function.rnp-list-keys.php                         29-May-2024 02:08                3142
function.rnp-load-keys-from-path.php               29-May-2024 02:08                3838
function.rnp-load-keys.php                         29-May-2024 02:08                3794
function.rnp-locate-key.php                        29-May-2024 02:08                3562
function.rnp-op-encrypt.php                        29-May-2024 02:08                7924
function.rnp-op-generate-key.php                   29-May-2024 02:08                7543
function.rnp-op-sign-cleartext.php                 29-May-2024 02:08                5193
function.rnp-op-sign-detached.php                  29-May-2024 02:08                5072
function.rnp-op-sign.php                           29-May-2024 02:08                6153
function.rnp-op-verify-detached.php                29-May-2024 02:08                7077
function.rnp-op-verify.php                         29-May-2024 02:08                6816
function.rnp-save-keys-to-path.php                 29-May-2024 02:08                3852
function.rnp-save-keys.php                         29-May-2024 02:08                3825
function.rnp-supported-features.php                29-May-2024 02:08                2919
function.rnp-version-string-full.php               29-May-2024 02:08                2263
function.rnp-version-string.php                    29-May-2024 02:08                2160
function.round.php                                 29-May-2024 02:08               23842
function.rpmaddtag.php                             29-May-2024 02:08                3318
function.rpmdbinfo.php                             29-May-2024 02:08                5200
function.rpmdbsearch.php                           29-May-2024 02:08                6100
function.rpmgetsymlink.php                         29-May-2024 02:08                2963
function.rpminfo.php                               29-May-2024 02:08                5382
function.rpmvercmp.php                             29-May-2024 02:08                4885
function.rrd-create.php                            29-May-2024 02:08                2924
function.rrd-error.php                             29-May-2024 02:08                2096
function.rrd-fetch.php                             29-May-2024 02:08                2901
function.rrd-first.php                             29-May-2024 02:08                2879
function.rrd-graph.php                             29-May-2024 02:08                3088
function.rrd-info.php                              29-May-2024 02:08                2501
function.rrd-last.php                              29-May-2024 02:08                2417
function.rrd-lastupdate.php                        29-May-2024 02:08                2610
function.rrd-restore.php                           29-May-2024 02:08                3334
function.rrd-tune.php                              29-May-2024 02:08                2989
function.rrd-update.php                            29-May-2024 02:08                3055
function.rrd-version.php                           29-May-2024 02:08                2163
function.rrd-xport.php                             29-May-2024 02:08                2674
function.rrdc-disconnect.php                       29-May-2024 02:08                2458
function.rsort.php                                 29-May-2024 02:08                9319
function.rtrim.php                                 29-May-2024 02:08                9456
function.runkit7-constant-add.php                  29-May-2024 02:08                4409
function.runkit7-constant-redefine.php             29-May-2024 02:08                4309
function.runkit7-constant-remove.php               29-May-2024 02:08                3619
function.runkit7-function-add.php                  29-May-2024 02:08                9697
function.runkit7-function-copy.php                 29-May-2024 02:08                5479
function.runkit7-function-redefine.php             29-May-2024 02:08               10099
function.runkit7-function-remove.php               29-May-2024 02:08                4061
function.runkit7-function-rename.php               29-May-2024 02:08                4338
function.runkit7-import.php                        29-May-2024 02:08                3826
function.runkit7-method-add.php                    29-May-2024 02:08               11738
function.runkit7-method-copy.php                   29-May-2024 02:08                7039
function.runkit7-method-redefine.php               29-May-2024 02:08               12174
function.runkit7-method-remove.php                 29-May-2024 02:08                6404
function.runkit7-method-rename.php                 29-May-2024 02:08                6566
function.runkit7-object-id.php                     29-May-2024 02:08                3745
function.runkit7-superglobals.php                  29-May-2024 02:08                2613
function.runkit7-zval-inspect.php                  29-May-2024 02:08                5086
function.sapi-windows-cp-conv.php                  29-May-2024 02:08                4731
function.sapi-windows-cp-get.php                   29-May-2024 02:08                3448
function.sapi-windows-cp-is-utf8.php               29-May-2024 02:08                2718
function.sapi-windows-cp-set.php                   29-May-2024 02:08                3062
function.sapi-windows-generate-ctrl-event.php      29-May-2024 02:08                7771
function.sapi-windows-set-ctrl-handler.php         29-May-2024 02:08                7567
function.sapi-windows-vt100-support.php            29-May-2024 02:08               11114
function.scandir.php                               29-May-2024 02:08                8503
function.scoutapm-get-calls.php                    29-May-2024 02:08                4419
function.scoutapm-list-instrumented-functions.php  29-May-2024 02:08                3759
function.seaslog-get-author.php                    29-May-2024 02:08                3084
function.seaslog-get-version.php                   29-May-2024 02:08                3071
function.sem-acquire.php                           29-May-2024 02:08                5272
function.sem-get.php                               29-May-2024 02:08                7119
function.sem-release.php                           29-May-2024 02:08                4286
function.sem-remove.php                            29-May-2024 02:08                4252
function.serialize.php                             29-May-2024 02:08               10130
function.session-abort.php                         29-May-2024 02:08                4157
function.session-cache-expire.php                  29-May-2024 02:08                7508
function.session-cache-limiter.php                 29-May-2024 02:08                8853
function.session-commit.php                        29-May-2024 02:08                1839
function.session-create-id.php                     29-May-2024 02:08                9839
function.session-decode.php                        29-May-2024 02:08                3739
function.session-destroy.php                       29-May-2024 02:08                8807
function.session-encode.php                        29-May-2024 02:08                3820
function.session-gc.php                            29-May-2024 02:08                7574
function.session-get-cookie-params.php             29-May-2024 02:08                5304
function.session-id.php                            29-May-2024 02:08                5984
function.session-module-name.php                   29-May-2024 02:08                4375
function.session-name.php                          29-May-2024 02:08                7726
function.session-regenerate-id.php                 29-May-2024 02:08               15774
function.session-register-shutdown.php             29-May-2024 02:08                2721
function.session-reset.php                         29-May-2024 02:08                4247
function.session-save-path.php                     29-May-2024 02:08                4747
function.session-set-cookie-params.php             29-May-2024 02:08               10519
function.session-set-save-handler.php              29-May-2024 02:08               22971
function.session-start.php                         29-May-2024 02:08               14322
function.session-status.php                        29-May-2024 02:08                3252
function.session-unset.php                         29-May-2024 02:08                4811
function.session-write-close.php                   29-May-2024 02:08                4061
function.set-error-handler.php                     29-May-2024 02:08               25411
function.set-exception-handler.php                 29-May-2024 02:08                6870
function.set-file-buffer.php                       29-May-2024 02:08                1804
function.set-include-path.php                      29-May-2024 02:08                6117
function.set-time-limit.php                        29-May-2024 02:08                4485
function.setcookie.php                             29-May-2024 02:08               25172
function.setlocale.php                             29-May-2024 02:08               14535
function.setrawcookie.php                          29-May-2024 02:08                6225
function.settype.php                               29-May-2024 02:08                6284
function.sha1-file.php                             29-May-2024 02:08                5659
function.sha1.php                                  29-May-2024 02:08                5738
function.shell-exec.php                            29-May-2024 02:08                5642
function.shm-attach.php                            29-May-2024 02:08                6001
function.shm-detach.php                            29-May-2024 02:08                4513
function.shm-get-var.php                           29-May-2024 02:08                4342
function.shm-has-var.php                           29-May-2024 02:08                4365
function.shm-put-var.php                           29-May-2024 02:08                5418
function.shm-remove-var.php                        29-May-2024 02:08                4256
function.shm-remove.php                            29-May-2024 02:08                3983
function.shmop-close.php                           29-May-2024 02:08                4762
function.shmop-delete.php                          29-May-2024 02:08                4240
function.shmop-open.php                            29-May-2024 02:08                9512
function.shmop-read.php                            29-May-2024 02:08                6701
function.shmop-size.php                            29-May-2024 02:08                4255
function.shmop-write.php                           29-May-2024 02:08                6171
function.show-source.php                           29-May-2024 02:08                1762
function.shuffle.php                               29-May-2024 02:08                6867
function.simdjson-decode.php                       29-May-2024 02:08               16957
function.simdjson-is-valid.php                     29-May-2024 02:08               10440
function.simdjson-key-count.php                    29-May-2024 02:08                4804
function.simdjson-key-exists.php                   29-May-2024 02:08                4599
function.simdjson-key-value.php                    29-May-2024 02:08                7328
function.similar-text.php                          29-May-2024 02:08                7158
function.simplexml-import-dom.php                  29-May-2024 02:08                6347
function.simplexml-load-file.php                   29-May-2024 02:08               10163
function.simplexml-load-string.php                 29-May-2024 02:08                9895
function.sin.php                                   29-May-2024 02:08                4502
function.sinh.php                                  29-May-2024 02:08                3139
function.sizeof.php                                29-May-2024 02:08                1655
function.sleep.php                                 29-May-2024 02:08                6968
function.snmp-get-quick-print.php                  29-May-2024 02:08                3603
function.snmp-get-valueretrieval.php               29-May-2024 02:08                4413
function.snmp-read-mib.php                         29-May-2024 02:08                4874
function.snmp-set-enum-print.php                   29-May-2024 02:08                5345
function.snmp-set-oid-numeric-print.php            29-May-2024 02:08                2332
function.snmp-set-oid-output-format.php            29-May-2024 02:08                7775
function.snmp-set-quick-print.php                  29-May-2024 02:08                6994
function.snmp-set-valueretrieval.php               29-May-2024 02:08                9473
function.snmp2-get.php                             29-May-2024 02:08                5785
function.snmp2-getnext.php                         29-May-2024 02:08                6153
function.snmp2-real-walk.php                       29-May-2024 02:08                6592
function.snmp2-set.php                             29-May-2024 02:08               10864
function.snmp2-walk.php                            29-May-2024 02:08                7077
function.snmp3-get.php                             29-May-2024 02:08                8878
function.snmp3-getnext.php                         29-May-2024 02:08                9206
function.snmp3-real-walk.php                       29-May-2024 02:08                9884
function.snmp3-set.php                             29-May-2024 02:08               13645
function.snmp3-walk.php                            29-May-2024 02:08               10351
function.snmpget.php                               29-May-2024 02:08                5707
function.snmpgetnext.php                           29-May-2024 02:08                6019
function.snmprealwalk.php                          29-May-2024 02:08                6343
function.snmpset.php                               29-May-2024 02:08               10818
function.snmpwalk.php                              29-May-2024 02:08                6960
function.snmpwalkoid.php                           29-May-2024 02:08                7689
function.socket-accept.php                         29-May-2024 02:08                6700
function.socket-addrinfo-bind.php                  29-May-2024 02:08                5382
function.socket-addrinfo-connect.php               29-May-2024 02:08                5151
function.socket-addrinfo-explain.php               29-May-2024 02:08                4426
function.socket-addrinfo-lookup.php                29-May-2024 02:08                5980
function.socket-atmark.php                         29-May-2024 02:08                4931
function.socket-bind.php                           29-May-2024 02:08               10846
function.socket-clear-error.php                    29-May-2024 02:08                4602
function.socket-close.php                          29-May-2024 02:08                4551
function.socket-cmsg-space.php                     29-May-2024 02:08                3724
function.socket-connect.php                        29-May-2024 02:08                7804
function.socket-create-listen.php                  29-May-2024 02:08                7000
function.socket-create-pair.php                    29-May-2024 02:08               19471
function.socket-create.php                         29-May-2024 02:08               12025
function.socket-export-stream.php                  29-May-2024 02:08                3485
function.socket-get-option.php                     29-May-2024 02:08               30087
function.socket-get-status.php                     29-May-2024 02:08                1838
function.socket-getopt.php                         29-May-2024 02:08                1818
function.socket-getpeername.php                    29-May-2024 02:08                8316
function.socket-getsockname.php                    29-May-2024 02:08                7611
function.socket-import-stream.php                  29-May-2024 02:08                5111
function.socket-last-error.php                     29-May-2024 02:08                7207
function.socket-listen.php                         29-May-2024 02:08                7001
function.socket-read.php                           29-May-2024 02:08                7963
function.socket-recv.php                           29-May-2024 02:08               16487
function.socket-recvfrom.php                       29-May-2024 02:08               13594
function.socket-recvmsg.php                        29-May-2024 02:08                4380
function.socket-select.php                         29-May-2024 02:08               14850
function.socket-send.php                           29-May-2024 02:08                6718
function.socket-sendmsg.php                        29-May-2024 02:08                4513
function.socket-sendto.php                         29-May-2024 02:08                9999
function.socket-set-block.php                      29-May-2024 02:08                6078
function.socket-set-blocking.php                   29-May-2024 02:08                1858
function.socket-set-nonblock.php                   29-May-2024 02:08                6464
function.socket-set-option.php                     29-May-2024 02:08               11288
function.socket-set-timeout.php                    29-May-2024 02:08                1826
function.socket-setopt.php                         29-May-2024 02:08                1812
function.socket-shutdown.php                       29-May-2024 02:08                4918
function.socket-strerror.php                       29-May-2024 02:08                7007
function.socket-write.php                          29-May-2024 02:08                7151
function.socket-wsaprotocol-info-export.php        29-May-2024 02:08                5003
function.socket-wsaprotocol-info-import.php        29-May-2024 02:08                4370
function.socket-wsaprotocol-info-release.php       29-May-2024 02:08                3566
function.sodium-add.php                            29-May-2024 02:08                3178
function.sodium-base642bin.php                     29-May-2024 02:08                4565
function.sodium-bin2base64.php                     29-May-2024 02:08                4095
function.sodium-bin2hex.php                        29-May-2024 02:08                2792
function.sodium-compare.php                        29-May-2024 02:08                3416
function.sodium-crypto-aead-aes256gcm-decrypt.php  29-May-2024 02:08                4795
function.sodium-crypto-aead-aes256gcm-encrypt.php  29-May-2024 02:08                4596
function.sodium-crypto-aead-aes256gcm-is-availa..> 29-May-2024 02:08                2826
function.sodium-crypto-aead-aes256gcm-keygen.php   29-May-2024 02:08                2816
function.sodium-crypto-aead-chacha20poly1305-de..> 29-May-2024 02:08                4660
function.sodium-crypto-aead-chacha20poly1305-en..> 29-May-2024 02:08                4476
function.sodium-crypto-aead-chacha20poly1305-ie..> 29-May-2024 02:08                4890
function.sodium-crypto-aead-chacha20poly1305-ie..> 29-May-2024 02:08                4642
function.sodium-crypto-aead-chacha20poly1305-ie..> 29-May-2024 02:08                3010
function.sodium-crypto-aead-chacha20poly1305-ke..> 29-May-2024 02:08                2945
function.sodium-crypto-aead-xchacha20poly1305-i..> 29-May-2024 02:08                5068
function.sodium-crypto-aead-xchacha20poly1305-i..> 29-May-2024 02:08                4860
function.sodium-crypto-aead-xchacha20poly1305-i..> 29-May-2024 02:08                2986
function.sodium-crypto-auth-keygen.php             29-May-2024 02:08                2637
function.sodium-crypto-auth-verify.php             29-May-2024 02:08                3981
function.sodium-crypto-auth.php                    29-May-2024 02:08                3448
function.sodium-crypto-box-keypair-from-secretk..> 29-May-2024 02:08                3527
function.sodium-crypto-box-keypair.php             29-May-2024 02:08                2918
function.sodium-crypto-box-open.php                29-May-2024 02:08                4095
function.sodium-crypto-box-publickey-from-secre..> 29-May-2024 02:08                3358
function.sodium-crypto-box-publickey.php           29-May-2024 02:08                3071
function.sodium-crypto-box-seal-open.php           29-May-2024 02:08                6122
function.sodium-crypto-box-seal.php                29-May-2024 02:08                7249
function.sodium-crypto-box-secretkey.php           29-May-2024 02:08                3038
function.sodium-crypto-box-seed-keypair.php        29-May-2024 02:08                3097
function.sodium-crypto-box.php                     29-May-2024 02:08                4414
function.sodium-crypto-core-ristretto255-add.php   29-May-2024 02:08                6082
function.sodium-crypto-core-ristretto255-from-h..> 29-May-2024 02:08                5442
function.sodium-crypto-core-ristretto255-is-val..> 29-May-2024 02:08                5607
function.sodium-crypto-core-ristretto255-random..> 29-May-2024 02:08                5579
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 02:08                6349
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 02:08                3599
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 02:08                5441
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 02:08                3858
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 02:08                5425
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 02:08                5738
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 02:08                3543
function.sodium-crypto-core-ristretto255-scalar..> 29-May-2024 02:08                6340
function.sodium-crypto-core-ristretto255-sub.php   29-May-2024 02:08                6119
function.sodium-crypto-generichash-final.php       29-May-2024 02:08                6865
function.sodium-crypto-generichash-init.php        29-May-2024 02:08                6912
function.sodium-crypto-generichash-keygen.php      29-May-2024 02:08                2447
function.sodium-crypto-generichash-update.php      29-May-2024 02:08                6545
function.sodium-crypto-generichash.php             29-May-2024 02:08                3853
function.sodium-crypto-kdf-derive-from-key.php     29-May-2024 02:08                4064
function.sodium-crypto-kdf-keygen.php              29-May-2024 02:08                2549
function.sodium-crypto-kx-client-session-keys.php  29-May-2024 02:08                3480
function.sodium-crypto-kx-keypair.php              29-May-2024 02:08                4976
function.sodium-crypto-kx-publickey.php            29-May-2024 02:08                2890
function.sodium-crypto-kx-secretkey.php            29-May-2024 02:08                2901
function.sodium-crypto-kx-seed-keypair.php         29-May-2024 02:08                2802
function.sodium-crypto-kx-server-session-keys.php  29-May-2024 02:08                3546
function.sodium-crypto-pwhash-scryptsalsa208sha..> 29-May-2024 02:08                3407
function.sodium-crypto-pwhash-scryptsalsa208sha..> 29-May-2024 02:08                3610
function.sodium-crypto-pwhash-scryptsalsa208sha..> 29-May-2024 02:08                6546
function.sodium-crypto-pwhash-str-needs-rehash.php 29-May-2024 02:08                4023
function.sodium-crypto-pwhash-str-verify.php       29-May-2024 02:08                4881
function.sodium-crypto-pwhash-str.php              29-May-2024 02:08                8696
function.sodium-crypto-pwhash.php                  29-May-2024 02:08               10517
function.sodium-crypto-scalarmult-base.php         29-May-2024 02:08                2065
function.sodium-crypto-scalarmult-ristretto255-..> 29-May-2024 02:08                3512
function.sodium-crypto-scalarmult-ristretto255.php 29-May-2024 02:08                3861
function.sodium-crypto-scalarmult.php              29-May-2024 02:08                3072
function.sodium-crypto-secretbox-keygen.php        29-May-2024 02:08                6232
function.sodium-crypto-secretbox-open.php          29-May-2024 02:08                8872
function.sodium-crypto-secretbox.php               29-May-2024 02:08                8864
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 02:08               10969
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 02:08               10303
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 02:08                2713
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 02:08                5830
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 02:08                5938
function.sodium-crypto-secretstream-xchacha20po..> 29-May-2024 02:08                2976
function.sodium-crypto-shorthash-keygen.php        29-May-2024 02:08                2660
function.sodium-crypto-shorthash.php               29-May-2024 02:08                3281
function.sodium-crypto-sign-detached.php           29-May-2024 02:08                3274
function.sodium-crypto-sign-ed25519-pk-to-curve..> 29-May-2024 02:08                2961
function.sodium-crypto-sign-ed25519-sk-to-curve..> 29-May-2024 02:08                3114
function.sodium-crypto-sign-keypair-from-secret..> 29-May-2024 02:08                3353
function.sodium-crypto-sign-keypair.php            29-May-2024 02:08                2435
function.sodium-crypto-sign-open.php               29-May-2024 02:08                3364
function.sodium-crypto-sign-publickey-from-secr..> 29-May-2024 02:08                2916
function.sodium-crypto-sign-publickey.php          29-May-2024 02:08                2926
function.sodium-crypto-sign-secretkey.php          29-May-2024 02:08                2902
function.sodium-crypto-sign-seed-keypair.php       29-May-2024 02:08                3135
function.sodium-crypto-sign-verify-detached.php    29-May-2024 02:08                3661
function.sodium-crypto-sign.php                    29-May-2024 02:08                3352
function.sodium-crypto-stream-keygen.php           29-May-2024 02:08                2618
function.sodium-crypto-stream-xchacha20-keygen.php 29-May-2024 02:08                2776
function.sodium-crypto-stream-xchacha20-xor-ic.php 29-May-2024 02:08                9805
function.sodium-crypto-stream-xchacha20-xor.php    29-May-2024 02:08                4888
function.sodium-crypto-stream-xchacha20.php        29-May-2024 02:08                3808
function.sodium-crypto-stream-xor.php              29-May-2024 02:08                3691
function.sodium-crypto-stream.php                  29-May-2024 02:08                3527
function.sodium-hex2bin.php                        29-May-2024 02:08                3400
function.sodium-increment.php                      29-May-2024 02:08                2516
function.sodium-memcmp.php                         29-May-2024 02:08                3720
function.sodium-memzero.php                        29-May-2024 02:08                2608
function.sodium-pad.php                            29-May-2024 02:08                2849
function.sodium-unpad.php                          29-May-2024 02:08                2804
function.solr-get-version.php                      29-May-2024 02:08                3843
function.sort.php                                  29-May-2024 02:08               12062
function.soundex.php                               29-May-2024 02:08                7219
function.spl-autoload-call.php                     29-May-2024 02:08                2592
function.spl-autoload-extensions.php               29-May-2024 02:08                4847
function.spl-autoload-functions.php                29-May-2024 02:08                3188
function.spl-autoload-register.php                 29-May-2024 02:08               13206
function.spl-autoload-unregister.php               29-May-2024 02:08                3056
function.spl-autoload.php                          29-May-2024 02:08                4659
function.spl-classes.php                           29-May-2024 02:08                3758
function.spl-object-hash.php                       29-May-2024 02:08                4944
function.spl-object-id.php                         29-May-2024 02:08                4135
function.sprintf.php                               29-May-2024 02:08               27577
function.sqlsrv-begin-transaction.php              29-May-2024 02:08               11240
function.sqlsrv-cancel.php                         29-May-2024 02:08               10336
function.sqlsrv-client-info.php                    29-May-2024 02:08                6755
function.sqlsrv-close.php                          29-May-2024 02:08                5605
function.sqlsrv-commit.php                         29-May-2024 02:08               11120
function.sqlsrv-configure.php                      29-May-2024 02:08                4741
function.sqlsrv-connect.php                        29-May-2024 02:08               12202
function.sqlsrv-errors.php                         29-May-2024 02:08               10044
function.sqlsrv-execute.php                        29-May-2024 02:08               10159
function.sqlsrv-fetch-array.php                    29-May-2024 02:08               15623
function.sqlsrv-fetch-object.php                   29-May-2024 02:08               12381
function.sqlsrv-fetch.php                          29-May-2024 02:08               10828
function.sqlsrv-field-metadata.php                 29-May-2024 02:08                8866
function.sqlsrv-free-stmt.php                      29-May-2024 02:08                7737
function.sqlsrv-get-config.php                     29-May-2024 02:08                3344
function.sqlsrv-get-field.php                      29-May-2024 02:08               10200
function.sqlsrv-has-rows.php                       29-May-2024 02:08                6359
function.sqlsrv-next-result.php                    29-May-2024 02:08                9273
function.sqlsrv-num-fields.php                     29-May-2024 02:08                8193
function.sqlsrv-num-rows.php                       29-May-2024 02:08                7920
function.sqlsrv-prepare.php                        29-May-2024 02:08               14538
function.sqlsrv-query.php                          29-May-2024 02:08               11891
function.sqlsrv-rollback.php                       29-May-2024 02:08               10590
function.sqlsrv-rows-affected.php                  29-May-2024 02:08                7970
function.sqlsrv-send-stream-data.php               29-May-2024 02:08                8539
function.sqlsrv-server-info.php                    29-May-2024 02:08                6155
function.sqrt.php                                  29-May-2024 02:08                4529
function.srand.php                                 29-May-2024 02:08                6939
function.sscanf.php                                29-May-2024 02:08               11191
function.ssdeep-fuzzy-compare.php                  29-May-2024 02:08                3286
function.ssdeep-fuzzy-hash-filename.php            29-May-2024 02:08                3011
function.ssdeep-fuzzy-hash.php                     29-May-2024 02:08                2855
function.ssh2-auth-agent.php                       29-May-2024 02:08                4770
function.ssh2-auth-hostbased-file.php              29-May-2024 02:08                7750
function.ssh2-auth-none.php                        29-May-2024 02:08                4874
function.ssh2-auth-password.php                    29-May-2024 02:08                5033
function.ssh2-auth-pubkey-file.php                 29-May-2024 02:08                7251
function.ssh2-connect.php                          29-May-2024 02:08               15764
function.ssh2-disconnect.php                       29-May-2024 02:08                3112
function.ssh2-exec.php                             29-May-2024 02:08                7637
function.ssh2-fetch-stream.php                     29-May-2024 02:08                5546
function.ssh2-fingerprint.php                      29-May-2024 02:08                5545
function.ssh2-forward-accept.php                   29-May-2024 02:08                3055
function.ssh2-forward-listen.php                   29-May-2024 02:08                4494
function.ssh2-methods-negotiated.php               29-May-2024 02:08                8004
function.ssh2-poll.php                             29-May-2024 02:08                3535
function.ssh2-publickey-add.php                    29-May-2024 02:08                8364
function.ssh2-publickey-init.php                   29-May-2024 02:08                4617
function.ssh2-publickey-list.php                   29-May-2024 02:08                8757
function.ssh2-publickey-remove.php                 29-May-2024 02:08                4655
function.ssh2-scp-recv.php                         29-May-2024 02:08                5475
function.ssh2-scp-send.php                         29-May-2024 02:08                6086
function.ssh2-send-eof.php                         29-May-2024 02:08                3465
function.ssh2-sftp-chmod.php                       29-May-2024 02:08                5985
function.ssh2-sftp-lstat.php                       29-May-2024 02:08                7283
function.ssh2-sftp-mkdir.php                       29-May-2024 02:08                6858
function.ssh2-sftp-readlink.php                    29-May-2024 02:08                5345
function.ssh2-sftp-realpath.php                    29-May-2024 02:08                5567
function.ssh2-sftp-rename.php                      29-May-2024 02:08                5577
function.ssh2-sftp-rmdir.php                       29-May-2024 02:08                5561
function.ssh2-sftp-stat.php                        29-May-2024 02:08                7198
function.ssh2-sftp-symlink.php                     29-May-2024 02:08                5767
function.ssh2-sftp-unlink.php                      29-May-2024 02:08                5041
function.ssh2-sftp.php                             29-May-2024 02:08                5483
function.ssh2-shell.php                            29-May-2024 02:08                8098
function.ssh2-tunnel.php                           29-May-2024 02:08                5336
function.stat.php                                  29-May-2024 02:08               15801
function.stats-absolute-deviation.php              29-May-2024 02:08                2844
function.stats-cdf-beta.php                        29-May-2024 02:08                5211
function.stats-cdf-binomial.php                    29-May-2024 02:08                5196
function.stats-cdf-cauchy.php                      29-May-2024 02:08                5231
function.stats-cdf-chisquare.php                   29-May-2024 02:08                4550
function.stats-cdf-exponential.php                 29-May-2024 02:08                4581
function.stats-cdf-f.php                           29-May-2024 02:08                5136
function.stats-cdf-gamma.php                       29-May-2024 02:08                5195
function.stats-cdf-laplace.php                     29-May-2024 02:08                5216
function.stats-cdf-logistic.php                    29-May-2024 02:08                5251
function.stats-cdf-negative-binomial.php           29-May-2024 02:08                5339
function.stats-cdf-noncentral-chisquare.php        29-May-2024 02:08                5441
function.stats-cdf-noncentral-f.php                29-May-2024 02:08                6015
function.stats-cdf-noncentral-t.php                29-May-2024 02:08                5301
function.stats-cdf-normal.php                      29-May-2024 02:08                5233
function.stats-cdf-poisson.php                     29-May-2024 02:08                4515
function.stats-cdf-t.php                           29-May-2024 02:08                4443
function.stats-cdf-uniform.php                     29-May-2024 02:08                5196
function.stats-cdf-weibull.php                     29-May-2024 02:08                5233
function.stats-covariance.php                      29-May-2024 02:08                3044
function.stats-dens-beta.php                       29-May-2024 02:08                3530
function.stats-dens-cauchy.php                     29-May-2024 02:08                3588
function.stats-dens-chisquare.php                  29-May-2024 02:08                3258
function.stats-dens-exponential.php                29-May-2024 02:08                3248
function.stats-dens-f.php                          29-May-2024 02:08                3528
function.stats-dens-gamma.php                      29-May-2024 02:08                3581
function.stats-dens-laplace.php                    29-May-2024 02:08                3615
function.stats-dens-logistic.php                   29-May-2024 02:08                3627
function.stats-dens-normal.php                     29-May-2024 02:08                3598
function.stats-dens-pmf-binomial.php               29-May-2024 02:08                3652
function.stats-dens-pmf-hypergeometric.php         29-May-2024 02:08                4304
function.stats-dens-pmf-negative-binomial.php      29-May-2024 02:08                3781
function.stats-dens-pmf-poisson.php                29-May-2024 02:08                3249
function.stats-dens-t.php                          29-May-2024 02:08                3162
function.stats-dens-uniform.php                    29-May-2024 02:08                3563
function.stats-dens-weibull.php                    29-May-2024 02:08                3595
function.stats-harmonic-mean.php                   29-May-2024 02:08                2743
function.stats-kurtosis.php                        29-May-2024 02:08                2751
function.stats-rand-gen-beta.php                   29-May-2024 02:08                3057
function.stats-rand-gen-chisquare.php              29-May-2024 02:08                2730
function.stats-rand-gen-exponential.php            29-May-2024 02:08                2728
function.stats-rand-gen-f.php                      29-May-2024 02:08                3111
function.stats-rand-gen-funiform.php               29-May-2024 02:08                3038
function.stats-rand-gen-gamma.php                  29-May-2024 02:08                3124
function.stats-rand-gen-ibinomial-negative.php     29-May-2024 02:08                3204
function.stats-rand-gen-ibinomial.php              29-May-2024 02:08                3128
function.stats-rand-gen-int.php                    29-May-2024 02:08                2288
function.stats-rand-gen-ipoisson.php               29-May-2024 02:08                2703
function.stats-rand-gen-iuniform.php               29-May-2024 02:08                3105
function.stats-rand-gen-noncentral-chisquare.php   29-May-2024 02:08                3246
function.stats-rand-gen-noncentral-f.php           29-May-2024 02:08                3599
function.stats-rand-gen-noncentral-t.php           29-May-2024 02:08                3159
function.stats-rand-gen-normal.php                 29-May-2024 02:08                3072
function.stats-rand-gen-t.php                      29-May-2024 02:08                2622
function.stats-rand-get-seeds.php                  29-May-2024 02:08                2331
function.stats-rand-phrase-to-seeds.php            29-May-2024 02:08                2711
function.stats-rand-ranf.php                       29-May-2024 02:08                2332
function.stats-rand-setall.php                     29-May-2024 02:08                2980
function.stats-skew.php                            29-May-2024 02:08                2717
function.stats-standard-deviation.php              29-May-2024 02:08                3885
function.stats-stat-binomial-coef.php              29-May-2024 02:08                3017
function.stats-stat-correlation.php                29-May-2024 02:08                3224
function.stats-stat-factorial.php                  29-May-2024 02:08                2590
function.stats-stat-independent-t.php              29-May-2024 02:08                3305
function.stats-stat-innerproduct.php               29-May-2024 02:08                3166
function.stats-stat-paired-t.php                   29-May-2024 02:08                3103
function.stats-stat-percentile.php                 29-May-2024 02:08                2969
function.stats-stat-powersum.php                   29-May-2024 02:08                2961
function.stats-variance.php                        29-May-2024 02:08                3388
function.stomp-connect-error.php                   29-May-2024 02:08                3680
function.stomp-version.php                         29-May-2024 02:08                3111
function.str-contains.php                          29-May-2024 02:08                8211
function.str-decrement.php                         29-May-2024 02:08                6506
function.str-ends-with.php                         29-May-2024 02:08                8140
function.str-getcsv.php                            29-May-2024 02:08                8981
function.str-increment.php                         29-May-2024 02:08                6193
function.str-ireplace.php                          29-May-2024 02:08                9145
function.str-pad.php                               29-May-2024 02:08                8219
function.str-repeat.php                            29-May-2024 02:08                4637
function.str-replace.php                           29-May-2024 02:08               16687
function.str-rot13.php                             29-May-2024 02:08                3564
function.str-shuffle.php                           29-May-2024 02:08                5912
function.str-split.php                             29-May-2024 02:08                8523
function.str-starts-with.php                       29-May-2024 02:08                8164
function.str-word-count.php                        29-May-2024 02:08                8973
function.strcasecmp.php                            29-May-2024 02:08                6201
function.strchr.php                                29-May-2024 02:08                1678
function.strcmp.php                                29-May-2024 02:08                5979
function.strcoll.php                               29-May-2024 02:08                5058
function.strcspn.php                               29-May-2024 02:08               11266
function.stream-bucket-append.php                  29-May-2024 02:08                2272
function.stream-bucket-make-writeable.php          29-May-2024 02:08                4419
function.stream-bucket-new.php                     29-May-2024 02:08                2306
function.stream-bucket-prepend.php                 29-May-2024 02:08                6322
function.stream-context-create.php                 29-May-2024 02:08                7840
function.stream-context-get-default.php            29-May-2024 02:08                8860
function.stream-context-get-options.php            29-May-2024 02:08                4485
function.stream-context-get-params.php             29-May-2024 02:08                5529
function.stream-context-set-default.php            29-May-2024 02:08                6231
function.stream-context-set-option.php             29-May-2024 02:08                5507
function.stream-context-set-options.php            29-May-2024 02:08                6435
function.stream-context-set-params.php             29-May-2024 02:08                4699
function.stream-copy-to-stream.php                 29-May-2024 02:08                7730
function.stream-filter-append.php                  29-May-2024 02:08               10911
function.stream-filter-prepend.php                 29-May-2024 02:08                8225
function.stream-filter-register.php                29-May-2024 02:08               18393
function.stream-filter-remove.php                  29-May-2024 02:08                6652
function.stream-get-contents.php                   29-May-2024 02:08                9064
function.stream-get-filters.php                    29-May-2024 02:08                4025
function.stream-get-line.php                       29-May-2024 02:08                5211
function.stream-get-meta-data.php                  29-May-2024 02:08               14473
function.stream-get-transports.php                 29-May-2024 02:08                4002
function.stream-get-wrappers.php                   29-May-2024 02:08                4745
function.stream-is-local.php                       29-May-2024 02:08                4263
function.stream-isatty.php                         29-May-2024 02:08                3978
function.stream-notification-callback.php          29-May-2024 02:08               22315
function.stream-register-wrapper.php               29-May-2024 02:08                1940
function.stream-resolve-include-path.php           29-May-2024 02:08                4366
function.stream-select.php                         29-May-2024 02:08               16391
function.stream-set-blocking.php                   29-May-2024 02:08                4867
function.stream-set-chunk-size.php                 29-May-2024 02:08                4292
function.stream-set-read-buffer.php                29-May-2024 02:08                3753
function.stream-set-timeout.php                    29-May-2024 02:08                8087
function.stream-set-write-buffer.php               29-May-2024 02:08                5867
function.stream-socket-accept.php                  29-May-2024 02:08                7592
function.stream-socket-client.php                  29-May-2024 02:08               17710
function.stream-socket-enable-crypto.php           29-May-2024 02:08               13363
function.stream-socket-get-name.php                29-May-2024 02:08                3931
function.stream-socket-pair.php                    29-May-2024 02:08                9818
function.stream-socket-recvfrom.php                29-May-2024 02:08               10824
function.stream-socket-sendto.php                  29-May-2024 02:08                7513
function.stream-socket-server.php                  29-May-2024 02:08               15167
function.stream-socket-shutdown.php                29-May-2024 02:08                6620
function.stream-supports-lock.php                  29-May-2024 02:08                3244
function.stream-wrapper-register.php               29-May-2024 02:08                9342
function.stream-wrapper-restore.php                29-May-2024 02:08                2948
function.stream-wrapper-unregister.php             29-May-2024 02:08                3149
function.strftime.php                              29-May-2024 02:08               55275
function.strip-tags.php                            29-May-2024 02:08                9165
function.stripcslashes.php                         29-May-2024 02:08                4028
function.stripos.php                               29-May-2024 02:08               11697
function.stripslashes.php                          29-May-2024 02:08                7459
function.stristr.php                               29-May-2024 02:08               10409
function.strlen.php                                29-May-2024 02:08                4923
function.strnatcasecmp.php                         29-May-2024 02:08                7420
function.strnatcmp.php                             29-May-2024 02:08                8596
function.strncasecmp.php                           29-May-2024 02:08                6743
function.strncmp.php                               29-May-2024 02:08                6697
function.strpbrk.php                               29-May-2024 02:08                5246
function.strpos.php                                29-May-2024 02:08               13550
function.strptime.php                              29-May-2024 02:08               10815
function.strrchr.php                               29-May-2024 02:08                8435
function.strrev.php                                29-May-2024 02:08                3211
function.strripos.php                              29-May-2024 02:08               10464
function.strrpos.php                               29-May-2024 02:08               13106
function.strspn.php                                29-May-2024 02:08                9378
function.strstr.php                                29-May-2024 02:08                8635
function.strtok.php                                29-May-2024 02:08               13263
function.strtolower.php                            29-May-2024 02:08                5771
function.strtotime.php                             29-May-2024 02:08               12386
function.strtoupper.php                            29-May-2024 02:08                5766
function.strtr.php                                 29-May-2024 02:08               11391
function.strval.php                                29-May-2024 02:08                6184
function.substr-compare.php                        29-May-2024 02:08               10947
function.substr-count.php                          29-May-2024 02:08                9328
function.substr-replace.php                        29-May-2024 02:08               16003
function.substr.php                                29-May-2024 02:08               22211
function.svn-add.php                               29-May-2024 02:08                6232
function.svn-auth-get-parameter.php                29-May-2024 02:08                3956
function.svn-auth-set-parameter.php                29-May-2024 02:08                5389
function.svn-blame.php                             29-May-2024 02:08                4982
function.svn-cat.php                               29-May-2024 02:08                4817
function.svn-checkout.php                          29-May-2024 02:08                7342
function.svn-cleanup.php                           29-May-2024 02:08                5149
function.svn-client-version.php                    29-May-2024 02:08                3448
function.svn-commit.php                            29-May-2024 02:08                7797
function.svn-delete.php                            29-May-2024 02:08                4712
function.svn-diff.php                              29-May-2024 02:08               13355
function.svn-export.php                            29-May-2024 02:08                5377
function.svn-fs-abort-txn.php                      29-May-2024 02:08                3167
function.svn-fs-apply-text.php                     29-May-2024 02:08                2757
function.svn-fs-begin-txn2.php                     29-May-2024 02:08                2700
function.svn-fs-change-node-prop.php               29-May-2024 02:08                3228
function.svn-fs-check-path.php                     29-May-2024 02:08                2802
function.svn-fs-contents-changed.php               29-May-2024 02:08                3233
function.svn-fs-copy.php                           29-May-2024 02:08                4160
function.svn-fs-delete.php                         29-May-2024 02:08                3445
function.svn-fs-dir-entries.php                    29-May-2024 02:08                2815
function.svn-fs-file-contents.php                  29-May-2024 02:08                2838
function.svn-fs-file-length.php                    29-May-2024 02:08                2761
function.svn-fs-is-dir.php                         29-May-2024 02:08                3492
function.svn-fs-is-file.php                        29-May-2024 02:08                3480
function.svn-fs-make-dir.php                       29-May-2024 02:08                3469
function.svn-fs-make-file.php                      29-May-2024 02:08                3486
function.svn-fs-node-created-rev.php               29-May-2024 02:08                2804
function.svn-fs-node-prop.php                      29-May-2024 02:08                2902
function.svn-fs-props-changed.php                  29-May-2024 02:08                3220
function.svn-fs-revision-prop.php                  29-May-2024 02:08                2915
function.svn-fs-revision-root.php                  29-May-2024 02:08                2783
function.svn-fs-txn-root.php                       29-May-2024 02:08                2548
function.svn-fs-youngest-rev.php                   29-May-2024 02:08                2590
function.svn-import.php                            29-May-2024 02:08                6013
function.svn-log.php                               29-May-2024 02:08                9063
function.svn-ls.php                                29-May-2024 02:08                7317
function.svn-mkdir.php                             29-May-2024 02:08                3268
function.svn-repos-create.php                      29-May-2024 02:08                2968
function.svn-repos-fs-begin-txn-for-commit.php     29-May-2024 02:08                3288
function.svn-repos-fs-commit-txn.php               29-May-2024 02:08                2645
function.svn-repos-fs.php                          29-May-2024 02:08                2545
function.svn-repos-hotcopy.php                     29-May-2024 02:08                2914
function.svn-repos-open.php                        29-May-2024 02:08                2517
function.svn-repos-recover.php                     29-May-2024 02:08                2561
function.svn-revert.php                            29-May-2024 02:08                3631
function.svn-status.php                            29-May-2024 02:08               14674
function.svn-update.php                            29-May-2024 02:08                6154
function.swoole-async-dns-lookup.php               29-May-2024 02:08                3878
function.swoole-async-read.php                     29-May-2024 02:08                4489
function.swoole-async-readfile.php                 29-May-2024 02:08                3903
function.swoole-async-set.php                      29-May-2024 02:08                2433
function.swoole-async-write.php                    29-May-2024 02:08                3783
function.swoole-async-writefile.php                29-May-2024 02:08                3811
function.swoole-clear-error.php                    29-May-2024 02:08                2283
function.swoole-client-select.php                  29-May-2024 02:08                3521
function.swoole-cpu-num.php                        29-May-2024 02:08                2140
function.swoole-errno.php                          29-May-2024 02:08                2117
function.swoole-error-log.php                      29-May-2024 02:08                3584
function.swoole-event-add.php                      29-May-2024 02:08                3528
function.swoole-event-defer.php                    29-May-2024 02:08                2666
function.swoole-event-del.php                      29-May-2024 02:08                2632
function.swoole-event-exit.php                     29-May-2024 02:08                2183
function.swoole-event-set.php                      29-May-2024 02:08                3516
function.swoole-event-wait.php                     29-May-2024 02:08                2154
function.swoole-event-write.php                    29-May-2024 02:08                2904
function.swoole-get-local-ip.php                   29-May-2024 02:08                2211
function.swoole-last-error.php                     29-May-2024 02:08                2166
function.swoole-load-module.php                    29-May-2024 02:08                2324
function.swoole-select.php                         29-May-2024 02:08                3488
function.swoole-set-process-name.php               29-May-2024 02:08                2661
function.swoole-strerror.php                       29-May-2024 02:08                2615
function.swoole-timer-after.php                    29-May-2024 02:08                3039
function.swoole-timer-exists.php                   29-May-2024 02:08                2452
function.swoole-timer-tick.php                     29-May-2024 02:08                2916
function.swoole-version.php                        29-May-2024 02:08                2145
function.symlink.php                               29-May-2024 02:08                5542
function.sys-get-temp-dir.php                      29-May-2024 02:08                4045
function.sys-getloadavg.php                        29-May-2024 02:08                4135
function.syslog.php                                29-May-2024 02:08                9328
function.system.php                                29-May-2024 02:08                7375
function.taint.php                                 29-May-2024 02:08                2696
function.tan.php                                   29-May-2024 02:08                4203
function.tanh.php                                  29-May-2024 02:08                3136
function.tcpwrap-check.php                         29-May-2024 02:08                5831
function.tempnam.php                               29-May-2024 02:08                6939
function.textdomain.php                            29-May-2024 02:08                3260
function.tidy-access-count.php                     29-May-2024 02:08                6413
function.tidy-config-count.php                     29-May-2024 02:08                4329
function.tidy-error-count.php                      29-May-2024 02:08                5331
function.tidy-get-output.php                       29-May-2024 02:08                4284
function.tidy-warning-count.php                    29-May-2024 02:08                4898
function.time-nanosleep.php                        29-May-2024 02:08                8442
function.time-sleep-until.php                      29-May-2024 02:08                5697
function.time.php                                  29-May-2024 02:08                4457
function.timezone-abbreviations-list.php           29-May-2024 02:08                1939
function.timezone-identifiers-list.php             29-May-2024 02:08                1955
function.timezone-location-get.php                 29-May-2024 02:08                1911
function.timezone-name-from-abbr.php               29-May-2024 02:08                6251
function.timezone-name-get.php                     29-May-2024 02:08                1855
function.timezone-offset-get.php                   29-May-2024 02:08                1853
function.timezone-open.php                         29-May-2024 02:08                1841
function.timezone-transitions-get.php              29-May-2024 02:08                1914
function.timezone-version-get.php                  29-May-2024 02:08                4186
function.tmpfile.php                               29-May-2024 02:08                5355
function.token-get-all.php                         29-May-2024 02:08               11763
function.token-name.php                            29-May-2024 02:08                4141
function.touch.php                                 29-May-2024 02:08                7909
function.trader-acos.php                           29-May-2024 02:08                2489
function.trader-ad.php                             29-May-2024 02:08                3386
function.trader-add.php                            29-May-2024 02:08                2820
function.trader-adosc.php                          29-May-2024 02:08                4246
function.trader-adx.php                            29-May-2024 02:08                3478
function.trader-adxr.php                           29-May-2024 02:08                3489
function.trader-apo.php                            29-May-2024 02:08                3692
function.trader-aroon.php                          29-May-2024 02:08                3052
function.trader-aroonosc.php                       29-May-2024 02:08                3089
function.trader-asin.php                           29-May-2024 02:08                2507
function.trader-atan.php                           29-May-2024 02:08                2500
function.trader-atr.php                            29-May-2024 02:08                3468
function.trader-avgprice.php                       29-May-2024 02:08                3443
function.trader-bbands.php                         29-May-2024 02:08                4451
function.trader-beta.php                           29-May-2024 02:08                3025
function.trader-bop.php                            29-May-2024 02:08                3392
function.trader-cci.php                            29-May-2024 02:08                3473
function.trader-cdl2crows.php                      29-May-2024 02:08                3465
function.trader-cdl3blackcrows.php                 29-May-2024 02:08                3527
function.trader-cdl3inside.php                     29-May-2024 02:08                3508
function.trader-cdl3linestrike.php                 29-May-2024 02:08                3531
function.trader-cdl3outside.php                    29-May-2024 02:08                3523
function.trader-cdl3starsinsouth.php               29-May-2024 02:08                3572
function.trader-cdl3whitesoldiers.php              29-May-2024 02:08                3596
function.trader-cdlabandonedbaby.php               29-May-2024 02:08                3975
function.trader-cdladvanceblock.php                29-May-2024 02:08                3549
function.trader-cdlbelthold.php                    29-May-2024 02:08                3505
function.trader-cdlbreakaway.php                   29-May-2024 02:08                3519
function.trader-cdlclosingmarubozu.php             29-May-2024 02:08                3590
function.trader-cdlconcealbabyswall.php            29-May-2024 02:08                3613
function.trader-cdlcounterattack.php               29-May-2024 02:08                3577
function.trader-cdldarkcloudcover.php              29-May-2024 02:08                3969
function.trader-cdldoji.php                        29-May-2024 02:08                3462
function.trader-cdldojistar.php                    29-May-2024 02:08                3497
function.trader-cdldragonflydoji.php               29-May-2024 02:08                3552
function.trader-cdlengulfing.php                   29-May-2024 02:08                3537
function.trader-cdleveningdojistar.php             29-May-2024 02:08                3986
function.trader-cdleveningstar.php                 29-May-2024 02:08                3963
function.trader-cdlgapsidesidewhite.php            29-May-2024 02:08                3620
function.trader-cdlgravestonedoji.php              29-May-2024 02:08                3573
function.trader-cdlhammer.php                      29-May-2024 02:08                3488
function.trader-cdlhangingman.php                  29-May-2024 02:08                3509
function.trader-cdlharami.php                      29-May-2024 02:08                3490
function.trader-cdlharamicross.php                 29-May-2024 02:08                3532
function.trader-cdlhighwave.php                    29-May-2024 02:08                3506
function.trader-cdlhikkake.php                     29-May-2024 02:08                3495
function.trader-cdlhikkakemod.php                  29-May-2024 02:08                3536
function.trader-cdlhomingpigeon.php                29-May-2024 02:08                3557
function.trader-cdlidentical3crows.php             29-May-2024 02:08                3581
function.trader-cdlinneck.php                      29-May-2024 02:08                3507
function.trader-cdlinvertedhammer.php              29-May-2024 02:08                3555
function.trader-cdlkicking.php                     29-May-2024 02:08                3509
function.trader-cdlkickingbylength.php             29-May-2024 02:08                3615
function.trader-cdlladderbottom.php                29-May-2024 02:08                3565
function.trader-cdllongleggeddoji.php              29-May-2024 02:08                3570
function.trader-cdllongline.php                    29-May-2024 02:08                3514
function.trader-cdlmarubozu.php                    29-May-2024 02:08                3500
function.trader-cdlmatchinglow.php                 29-May-2024 02:08                3526
function.trader-cdlmathold.php                     29-May-2024 02:08                3909
function.trader-cdlmorningdojistar.php             29-May-2024 02:08                3982
function.trader-cdlmorningstar.php                 29-May-2024 02:08                3943
function.trader-cdlonneck.php                      29-May-2024 02:08                3487
function.trader-cdlpiercing.php                    29-May-2024 02:08                3504
function.trader-cdlrickshawman.php                 29-May-2024 02:08                3544
function.trader-cdlrisefall3methods.php            29-May-2024 02:08                3614
function.trader-cdlseparatinglines.php             29-May-2024 02:08                3596
function.trader-cdlshootingstar.php                29-May-2024 02:08                3555
function.trader-cdlshortline.php                   29-May-2024 02:08                3527
function.trader-cdlspinningtop.php                 29-May-2024 02:08                3542
function.trader-cdlstalledpattern.php              29-May-2024 02:08                3577
function.trader-cdlsticksandwich.php               29-May-2024 02:08                3558
function.trader-cdltakuri.php                      29-May-2024 02:08                3529
function.trader-cdltasukigap.php                   29-May-2024 02:08                3504
function.trader-cdlthrusting.php                   29-May-2024 02:08                3513
function.trader-cdltristar.php                     29-May-2024 02:08                3501
function.trader-cdlunique3river.php                29-May-2024 02:08                3552
function.trader-cdlupsidegap2crows.php             29-May-2024 02:08                3600
function.trader-cdlxsidegap3methods.php            29-May-2024 02:08                3599
function.trader-ceil.php                           29-May-2024 02:08                2524
function.trader-cmo.php                            29-May-2024 02:08                2741
function.trader-correl.php                         29-May-2024 02:08                3077
function.trader-cos.php                            29-May-2024 02:08                2490
function.trader-cosh.php                           29-May-2024 02:08                2506
function.trader-dema.php                           29-May-2024 02:08                2752
function.trader-div.php                            29-May-2024 02:08                2836
function.trader-dx.php                             29-May-2024 02:08                3454
function.trader-ema.php                            29-May-2024 02:08                2735
function.trader-errno.php                          29-May-2024 02:08                2210
function.trader-exp.php                            29-May-2024 02:08                2534
function.trader-floor.php                          29-May-2024 02:08                2516
function.trader-get-compat.php                     29-May-2024 02:08                2400
function.trader-get-unstable-period.php            29-May-2024 02:08                2741
function.trader-ht-dcperiod.php                    29-May-2024 02:08                2504
function.trader-ht-dcphase.php                     29-May-2024 02:08                2475
function.trader-ht-phasor.php                      29-May-2024 02:08                2456
function.trader-ht-sine.php                        29-May-2024 02:08                2435
function.trader-ht-trendline.php                   29-May-2024 02:08                2496
function.trader-ht-trendmode.php                   29-May-2024 02:08                2486
function.trader-kama.php                           29-May-2024 02:08                2790
function.trader-linearreg-angle.php                29-May-2024 02:08                2884
function.trader-linearreg-intercept.php            29-May-2024 02:08                2942
function.trader-linearreg-slope.php                29-May-2024 02:08                2894
function.trader-linearreg.php                      29-May-2024 02:08                2806
function.trader-ln.php                             29-May-2024 02:08                2492
function.trader-log10.php                          29-May-2024 02:08                2496
function.trader-ma.php                             29-May-2024 02:08                3156
function.trader-macd.php                           29-May-2024 02:08                3677
function.trader-macdext.php                        29-May-2024 02:08                5170
function.trader-macdfix.php                        29-May-2024 02:08                2836
function.trader-mama.php                           29-May-2024 02:08                3177
function.trader-mavp.php                           29-May-2024 02:08                4081
function.trader-max.php                            29-May-2024 02:08                2756
function.trader-maxindex.php                       29-May-2024 02:08                2813
function.trader-medprice.php                       29-May-2024 02:08                2719
function.trader-mfi.php                            29-May-2024 02:08                3811
function.trader-midpoint.php                       29-May-2024 02:08                2787
function.trader-midprice.php                       29-May-2024 02:08                3103
function.trader-min.php                            29-May-2024 02:08                2763
function.trader-minindex.php                       29-May-2024 02:08                2808
function.trader-minmax.php                         29-May-2024 02:08                2812
function.trader-minmaxindex.php                    29-May-2024 02:08                2863
function.trader-minus-di.php                       29-May-2024 02:08                3541
function.trader-minus-dm.php                       29-May-2024 02:08                3103
function.trader-mom.php                            29-May-2024 02:08                2727
function.trader-mult.php                           29-May-2024 02:08                2836
function.trader-natr.php                           29-May-2024 02:08                3479
function.trader-obv.php                            29-May-2024 02:08                2674
function.trader-plus-di.php                        29-May-2024 02:08                3512
function.trader-plus-dm.php                        29-May-2024 02:08                3090
function.trader-ppo.php                            29-May-2024 02:08                3696
function.trader-roc.php                            29-May-2024 02:08                2751
function.trader-rocp.php                           29-May-2024 02:08                2779
function.trader-rocr.php                           29-May-2024 02:08                2764
function.trader-rocr100.php                        29-May-2024 02:08                2804
function.trader-rsi.php                            29-May-2024 02:08                2732
function.trader-sar.php                            29-May-2024 02:08                3734
function.trader-sarext.php                         29-May-2024 02:08                7146
function.trader-set-compat.php                     29-May-2024 02:08                2642
function.trader-set-unstable-period.php            29-May-2024 02:08                3230
function.trader-sin.php                            29-May-2024 02:08                2514
function.trader-sinh.php                           29-May-2024 02:08                2502
function.trader-sma.php                            29-May-2024 02:08                2732
function.trader-sqrt.php                           29-May-2024 02:08                2495
function.trader-stddev.php                         29-May-2024 02:08                3076
function.trader-stoch.php                          29-May-2024 02:08                5346
function.trader-stochf.php                         29-May-2024 02:08                4453
function.trader-stochrsi.php                       29-May-2024 02:08                4209
function.trader-sub.php                            29-May-2024 02:08                2841
function.trader-sum.php                            29-May-2024 02:08                2714
function.trader-t3.php                             29-May-2024 02:08                3095
function.trader-tan.php                            29-May-2024 02:08                2483
function.trader-tanh.php                           29-May-2024 02:08                2507
function.trader-tema.php                           29-May-2024 02:08                2758
function.trader-trange.php                         29-May-2024 02:08                3001
function.trader-trima.php                          29-May-2024 02:08                2760
function.trader-trix.php                           29-May-2024 02:08                2770
function.trader-tsf.php                            29-May-2024 02:08                2739
function.trader-typprice.php                       29-May-2024 02:08                3024
function.trader-ultosc.php                         29-May-2024 02:08                4336
function.trader-var.php                            29-May-2024 02:08                3046
function.trader-wclprice.php                       29-May-2024 02:08                3029
function.trader-willr.php                          29-May-2024 02:08                3485
function.trader-wma.php                            29-May-2024 02:08                2756
function.trait-exists.php                          29-May-2024 02:08                3108
function.trigger-error.php                         29-May-2024 02:08                7681
function.trim.php                                  29-May-2024 02:08               12608
function.uasort.php                                29-May-2024 02:08               10126
function.ucfirst.php                               29-May-2024 02:08                6164
function.ucwords.php                               29-May-2024 02:08                9608
function.ui-draw-text-font-fontfamilies.php        29-May-2024 02:08                2410
function.ui-quit.php                               29-May-2024 02:08                2050
function.ui-run.php                                29-May-2024 02:08                2441
function.uksort.php                                29-May-2024 02:08                9623
function.umask.php                                 29-May-2024 02:08                5620
function.uniqid.php                                29-May-2024 02:08                7901
function.unixtojd.php                              29-May-2024 02:08                3927
function.unlink.php                                29-May-2024 02:08                6072
function.unpack.php                                29-May-2024 02:08               10486
function.unregister-tick-function.php              29-May-2024 02:08                3126
function.unserialize.php                           29-May-2024 02:08               16791
function.unset.php                                 29-May-2024 02:08               14748
function.untaint.php                               29-May-2024 02:08                2552
function.uopz-add-function.php                     29-May-2024 02:08                7139
function.uopz-allow-exit.php                       29-May-2024 02:08                4618
function.uopz-backup.php                           29-May-2024 02:08                4584
function.uopz-compose.php                          29-May-2024 02:08                6856
function.uopz-copy.php                             29-May-2024 02:08                5171
function.uopz-del-function.php                     29-May-2024 02:08                6579
function.uopz-delete.php                           29-May-2024 02:08                5965
function.uopz-extend.php                           29-May-2024 02:08                5037
function.uopz-flags.php                            29-May-2024 02:08               10945
function.uopz-function.php                         29-May-2024 02:08                7315
function.uopz-get-exit-status.php                  29-May-2024 02:08                4167
function.uopz-get-hook.php                         29-May-2024 02:08                5330
function.uopz-get-mock.php                         29-May-2024 02:08                4957
function.uopz-get-property.php                     29-May-2024 02:08                6193
function.uopz-get-return.php                       29-May-2024 02:08                4450
function.uopz-get-static.php                       29-May-2024 02:08                5157
function.uopz-implement.php                        29-May-2024 02:08                5062
function.uopz-overload.php                         29-May-2024 02:08                3937
function.uopz-redefine.php                         29-May-2024 02:08                5148
function.uopz-rename.php                           29-May-2024 02:08                6770
function.uopz-restore.php                          29-May-2024 02:08                4942
function.uopz-set-hook.php                         29-May-2024 02:08                5664
function.uopz-set-mock.php                         29-May-2024 02:08               10777
function.uopz-set-property.php                     29-May-2024 02:08                7497
function.uopz-set-return.php                       29-May-2024 02:08                9628
function.uopz-set-static.php                       29-May-2024 02:08                5750
function.uopz-undefine.php                         29-May-2024 02:08                4706
function.uopz-unset-hook.php                       29-May-2024 02:08                5555
function.uopz-unset-mock.php                       29-May-2024 02:08                5308
function.uopz-unset-return.php                     29-May-2024 02:08                4926
function.urldecode.php                             29-May-2024 02:08                6310
function.urlencode.php                             29-May-2024 02:08                9429
function.use-soap-error-handler.php                29-May-2024 02:08                3923
function.user-error.php                            29-May-2024 02:08                1731
function.usleep.php                                29-May-2024 02:08                6747
function.usort.php                                 29-May-2024 02:08               24619
function.utf8-decode.php                           29-May-2024 02:08               18415
function.utf8-encode.php                           29-May-2024 02:08               15056
function.var-dump.php                              29-May-2024 02:08                6712
function.var-export.php                            29-May-2024 02:08               16044
function.var-representation.php                    29-May-2024 02:08               13263
function.variant-abs.php                           29-May-2024 02:08                4016
function.variant-add.php                           29-May-2024 02:08                5349
function.variant-and.php                           29-May-2024 02:08                7441
function.variant-cast.php                          29-May-2024 02:08                3542
function.variant-cat.php                           29-May-2024 02:08                4558
function.variant-cmp.php                           29-May-2024 02:08                7860
function.variant-date-from-timestamp.php           29-May-2024 02:08                3665
function.variant-date-to-timestamp.php             29-May-2024 02:08                3775
function.variant-div.php                           29-May-2024 02:08                6260
function.variant-eqv.php                           29-May-2024 02:08                4294
function.variant-fix.php                           29-May-2024 02:08                5341
function.variant-get-type.php                      29-May-2024 02:08                3532
function.variant-idiv.php                          29-May-2024 02:08                5626
function.variant-imp.php                           29-May-2024 02:08                6995
function.variant-int.php                           29-May-2024 02:08                4839
function.variant-mod.php                           29-May-2024 02:08                4629
function.variant-mul.php                           29-May-2024 02:08                5741
function.variant-neg.php                           29-May-2024 02:08                3696
function.variant-not.php                           29-May-2024 02:08                3962
function.variant-or.php                            29-May-2024 02:08                7597
function.variant-pow.php                           29-May-2024 02:08                4467
function.variant-round.php                         29-May-2024 02:08                4372
function.variant-set-type.php                      29-May-2024 02:08                3668
function.variant-set.php                           29-May-2024 02:08                2904
function.variant-sub.php                           29-May-2024 02:08                5311
function.variant-xor.php                           29-May-2024 02:08                6336
function.version-compare.php                       29-May-2024 02:08               11254
function.vfprintf.php                              29-May-2024 02:08               19323
function.virtual.php                               29-May-2024 02:08                5099
function.vprintf.php                               29-May-2024 02:08               18728
function.vsprintf.php                              29-May-2024 02:08               18608
function.wddx-add-vars.php                         29-May-2024 02:08                3785
function.wddx-deserialize.php                      29-May-2024 02:08                3542
function.wddx-packet-end.php                       29-May-2024 02:08                2857
function.wddx-packet-start.php                     29-May-2024 02:08                3036
function.wddx-serialize-value.php                  29-May-2024 02:08                3266
function.wddx-serialize-vars.php                   29-May-2024 02:08                5983
function.win32-continue-service.php                29-May-2024 02:08                6700
function.win32-create-service.php                  29-May-2024 02:08               28787
function.win32-delete-service.php                  29-May-2024 02:08                7159
function.win32-get-last-control-message.php        29-May-2024 02:08                8541
function.win32-pause-service.php                   29-May-2024 02:08                6701
function.win32-query-service-status.php            29-May-2024 02:08                8793
function.win32-send-custom-control.php             29-May-2024 02:08                7365
function.win32-set-service-exit-code.php           29-May-2024 02:08                5877
function.win32-set-service-exit-mode.php           29-May-2024 02:08                6025
function.win32-set-service-status.php              29-May-2024 02:08                9302
function.win32-start-service-ctrl-dispatcher.php   29-May-2024 02:08               11333
function.win32-start-service.php                   29-May-2024 02:08                6705
function.win32-stop-service.php                    29-May-2024 02:08                6620
function.wincache-fcache-fileinfo.php              29-May-2024 02:08                9279
function.wincache-fcache-meminfo.php               29-May-2024 02:08                7094
function.wincache-lock.php                         29-May-2024 02:08                8547
function.wincache-ocache-fileinfo.php              29-May-2024 02:08                9943
function.wincache-ocache-meminfo.php               29-May-2024 02:08                7280
function.wincache-refresh-if-changed.php           29-May-2024 02:08                7850
function.wincache-rplist-fileinfo.php              29-May-2024 02:08                7649
function.wincache-rplist-meminfo.php               29-May-2024 02:08                7209
function.wincache-scache-info.php                  29-May-2024 02:08                9567
function.wincache-scache-meminfo.php               29-May-2024 02:08                6696
function.wincache-ucache-add.php                   29-May-2024 02:08               13580
function.wincache-ucache-cas.php                   29-May-2024 02:08                6502
function.wincache-ucache-clear.php                 29-May-2024 02:08                7588
function.wincache-ucache-dec.php                   29-May-2024 02:08                6441
function.wincache-ucache-delete.php                29-May-2024 02:08               11395
function.wincache-ucache-exists.php                29-May-2024 02:08                6195
function.wincache-ucache-get.php                   29-May-2024 02:08               10625
function.wincache-ucache-inc.php                   29-May-2024 02:08                6433
function.wincache-ucache-info.php                  29-May-2024 02:08               11404
function.wincache-ucache-meminfo.php               29-May-2024 02:08                6885
function.wincache-ucache-set.php                   29-May-2024 02:08               13646
function.wincache-unlock.php                       29-May-2024 02:08                7809
function.wordwrap.php                              29-May-2024 02:08                9098
function.xattr-get.php                             29-May-2024 02:08                6034
function.xattr-list.php                            29-May-2024 02:08                6488
function.xattr-remove.php                          29-May-2024 02:08                6283
function.xattr-set.php                             29-May-2024 02:08                8028
function.xattr-supported.php                       29-May-2024 02:08                5349
function.xdiff-file-bdiff-size.php                 29-May-2024 02:08                4857
function.xdiff-file-bdiff.php                      29-May-2024 02:08                5973
function.xdiff-file-bpatch.php                     29-May-2024 02:08                6530
function.xdiff-file-diff-binary.php                29-May-2024 02:08                6393
function.xdiff-file-diff.php                       29-May-2024 02:08                7410
function.xdiff-file-merge3.php                     29-May-2024 02:08                6822
function.xdiff-file-patch-binary.php               29-May-2024 02:08                6679
function.xdiff-file-patch.php                      29-May-2024 02:08                8929
function.xdiff-file-rabdiff.php                    29-May-2024 02:08                6529
function.xdiff-string-bdiff-size.php               29-May-2024 02:08                5175
function.xdiff-string-bdiff.php                    29-May-2024 02:08                3879
function.xdiff-string-bpatch.php                   29-May-2024 02:08                3977
function.xdiff-string-diff-binary.php              29-May-2024 02:08                4367
function.xdiff-string-diff.php                     29-May-2024 02:08                7649
function.xdiff-string-merge3.php                   29-May-2024 02:08                4826
function.xdiff-string-patch-binary.php             29-May-2024 02:08                4509
function.xdiff-string-patch.php                    29-May-2024 02:08                8296
function.xdiff-string-rabdiff.php                  29-May-2024 02:08                4466
function.xhprof-disable.php                        29-May-2024 02:08                3986
function.xhprof-enable.php                         29-May-2024 02:08                7077
function.xhprof-sample-disable.php                 29-May-2024 02:08                4665
function.xhprof-sample-enable.php                  29-May-2024 02:08                3434
function.xml-error-string.php                      29-May-2024 02:08                3380
function.xml-get-current-byte-index.php            29-May-2024 02:08                4410
function.xml-get-current-column-number.php         29-May-2024 02:08                4206
function.xml-get-current-line-number.php           29-May-2024 02:08                4030
function.xml-get-error-code.php                    29-May-2024 02:08                3730
function.xml-parse-into-struct.php                 29-May-2024 02:08               19058
function.xml-parse.php                             29-May-2024 02:08                8167
function.xml-parser-create-ns.php                  29-May-2024 02:08                5328
function.xml-parser-create.php                     29-May-2024 02:08                4853
function.xml-parser-free.php                       29-May-2024 02:08                3998
function.xml-parser-get-option.php                 29-May-2024 02:08                5869
function.xml-parser-set-option.php                 29-May-2024 02:08                7683
function.xml-set-character-data-handler.php        29-May-2024 02:08                5642
function.xml-set-default-handler.php               29-May-2024 02:08                5542
function.xml-set-element-handler.php               29-May-2024 02:08                8707
function.xml-set-end-namespace-decl-handler.php    29-May-2024 02:08                6439
function.xml-set-external-entity-ref-handler.php   29-May-2024 02:08                8322
function.xml-set-notation-decl-handler.php         29-May-2024 02:08                7637
function.xml-set-object.php                        29-May-2024 02:08                9179
function.xml-set-processing-instruction-handler..> 29-May-2024 02:08                6586
function.xml-set-start-namespace-decl-handler.php  29-May-2024 02:08                6810
function.xml-set-unparsed-entity-decl-handler.php  29-May-2024 02:08                8499
function.xmlrpc-decode-request.php                 29-May-2024 02:08                2747
function.xmlrpc-decode.php                         29-May-2024 02:08                3997
function.xmlrpc-encode-request.php                 29-May-2024 02:08                8419
function.xmlrpc-encode.php                         29-May-2024 02:08                2321
function.xmlrpc-get-type.php                       29-May-2024 02:08                6255
function.xmlrpc-is-fault.php                       29-May-2024 02:08                3865
function.xmlrpc-parse-method-descriptions.php      29-May-2024 02:08                2515
function.xmlrpc-server-add-introspection-data.php  29-May-2024 02:08                2716
function.xmlrpc-server-call-method.php             29-May-2024 02:08                3128
function.xmlrpc-server-create.php                  29-May-2024 02:08                2245
function.xmlrpc-server-destroy.php                 29-May-2024 02:08                2450
function.xmlrpc-server-register-introspection-c..> 29-May-2024 02:08                2791
function.xmlrpc-server-register-method.php         29-May-2024 02:08                2875
function.xmlrpc-set-type.php                       29-May-2024 02:08                5424
function.yaml-emit-file.php                        29-May-2024 02:08                6741
function.yaml-emit.php                             29-May-2024 02:08               12311
function.yaml-parse-file.php                       29-May-2024 02:08                6082
function.yaml-parse-url.php                        29-May-2024 02:08                6407
function.yaml-parse.php                            29-May-2024 02:08                9916
function.yaz-addinfo.php                           29-May-2024 02:08                3408
function.yaz-ccl-conf.php                          29-May-2024 02:08                5696
function.yaz-ccl-parse.php                         29-May-2024 02:08                6766
function.yaz-close.php                             29-May-2024 02:08                3568
function.yaz-connect.php                           29-May-2024 02:08                9124
function.yaz-database.php                          29-May-2024 02:08                3456
function.yaz-element.php                           29-May-2024 02:08                3890
function.yaz-errno.php                             29-May-2024 02:08                3646
function.yaz-error.php                             29-May-2024 02:08                3401
function.yaz-es-result.php                         29-May-2024 02:08                3319
function.yaz-es.php                                29-May-2024 02:08                7156
function.yaz-get-option.php                        29-May-2024 02:08                3396
function.yaz-hits.php                              29-May-2024 02:08                4890
function.yaz-itemorder.php                         29-May-2024 02:08                7069
function.yaz-present.php                           29-May-2024 02:08                3032
function.yaz-range.php                             29-May-2024 02:08                3630
function.yaz-record.php                            29-May-2024 02:08               14238
function.yaz-scan-result.php                       29-May-2024 02:08                4037
function.yaz-scan.php                              29-May-2024 02:08                9362
function.yaz-schema.php                            29-May-2024 02:08                3466
function.yaz-search.php                            29-May-2024 02:08                8715
function.yaz-set-option.php                        29-May-2024 02:08                7029
function.yaz-sort.php                              29-May-2024 02:08                5586
function.yaz-syntax.php                            29-May-2024 02:08                3424
function.yaz-wait.php                              29-May-2024 02:08                4167
function.zend-thread-id.php                        29-May-2024 02:08                3707
function.zend-version.php                          29-May-2024 02:08                3829
function.zip-close.php                             29-May-2024 02:08                3876
function.zip-entry-close.php                       29-May-2024 02:08                4102
function.zip-entry-compressedsize.php              29-May-2024 02:08                4384
function.zip-entry-compressionmethod.php           29-May-2024 02:08                4471
function.zip-entry-filesize.php                    29-May-2024 02:08                4313
function.zip-entry-name.php                        29-May-2024 02:08                4232
function.zip-entry-open.php                        29-May-2024 02:08                5733
function.zip-entry-read.php                        29-May-2024 02:08                5060
function.zip-open.php                              29-May-2024 02:08                4448
function.zip-read.php                              29-May-2024 02:08                4661
function.zlib-decode.php                           29-May-2024 02:08                3426
function.zlib-encode.php                           29-May-2024 02:08                5350
function.zlib-get-coding-type.php                  29-May-2024 02:08                2894
function.zookeeper-dispatch.php                    29-May-2024 02:08                8296
functional.parallel.php                            29-May-2024 02:08                2600
functions.anonymous.php                            29-May-2024 02:08               23313
functions.arguments.php                            29-May-2024 02:08               40931
functions.arrow.php                                29-May-2024 02:08                9696
functions.first_class_callable_syntax.php          29-May-2024 02:08               10947
functions.internal.php                             29-May-2024 02:08                7257
functions.returning-values.php                     29-May-2024 02:08                5965
functions.user-defined.php                         29-May-2024 02:08                8794
functions.variable-functions.php                   29-May-2024 02:08               11132
gearman.configuration.php                          29-May-2024 02:08                1236
gearman.constants.php                              29-May-2024 02:08               23794
gearman.examples-reverse-bg.php                    29-May-2024 02:08               10697
gearman.examples-reverse-task.php                  29-May-2024 02:08               17346
gearman.examples-reverse.php                       29-May-2024 02:08               12770
gearman.examples.php                               29-May-2024 02:08                1609
gearman.installation.php                           29-May-2024 02:08                1532
gearman.requirements.php                           29-May-2024 02:08                1495
gearman.resources.php                              29-May-2024 02:08                1223
gearman.setup.php                                  29-May-2024 02:08                1575
gearmanclient.addoptions.php                       29-May-2024 02:08                3356
gearmanclient.addserver.php                        29-May-2024 02:08                5476
gearmanclient.addservers.php                       29-May-2024 02:08                4919
gearmanclient.addtask.php                          29-May-2024 02:08               15079
gearmanclient.addtaskbackground.php                29-May-2024 02:08               20880
gearmanclient.addtaskhigh.php                      29-May-2024 02:08               11607
gearmanclient.addtaskhighbackground.php            29-May-2024 02:08                6543
gearmanclient.addtasklow.php                       29-May-2024 02:08               11589
gearmanclient.addtasklowbackground.php             29-May-2024 02:08                6536
gearmanclient.addtaskstatus.php                    29-May-2024 02:08                9804
gearmanclient.clearcallbacks.php                   29-May-2024 02:08                4352
gearmanclient.clone.php                            29-May-2024 02:08                2655
gearmanclient.construct.php                        29-May-2024 02:08                2826
gearmanclient.context.php                          29-May-2024 02:08                2894
gearmanclient.data.php                             29-May-2024 02:08                3161
gearmanclient.do.php                               29-May-2024 02:08               22107
gearmanclient.dobackground.php                     29-May-2024 02:08                9617
gearmanclient.dohigh.php                           29-May-2024 02:08                5096
gearmanclient.dohighbackground.php                 29-May-2024 02:08                4923
gearmanclient.dojobhandle.php                      29-May-2024 02:08                2951
gearmanclient.dolow.php                            29-May-2024 02:08                5082
gearmanclient.dolowbackground.php                  29-May-2024 02:08                4905
gearmanclient.donormal.php                         29-May-2024 02:08               22675
gearmanclient.dostatus.php                         29-May-2024 02:08                8107
gearmanclient.echo.php                             29-May-2024 02:08                3003
gearmanclient.error.php                            29-May-2024 02:08                2886
gearmanclient.geterrno.php                         29-May-2024 02:08                2661
gearmanclient.jobstatus.php                        29-May-2024 02:08                8300
gearmanclient.ping.php                             29-May-2024 02:08                2976
gearmanclient.removeoptions.php                    29-May-2024 02:08                2704
gearmanclient.returncode.php                       29-May-2024 02:08                2311
gearmanclient.runtasks.php                         29-May-2024 02:08                3712
gearmanclient.setclientcallback.php                29-May-2024 02:08                5374
gearmanclient.setcompletecallback.php              29-May-2024 02:08                5258
gearmanclient.setcontext.php                       29-May-2024 02:08                3242
gearmanclient.setcreatedcallback.php               29-May-2024 02:08                4797
gearmanclient.setdata.php                          29-May-2024 02:08                3442
gearmanclient.setdatacallback.php                  29-May-2024 02:08                4782
gearmanclient.setexceptioncallback.php             29-May-2024 02:08                4702
gearmanclient.setfailcallback.php                  29-May-2024 02:08                4788
gearmanclient.setoptions.php                       29-May-2024 02:08                2690
gearmanclient.setstatuscallback.php                29-May-2024 02:08                4788
gearmanclient.settimeout.php                       29-May-2024 02:08                2734
gearmanclient.setwarningcallback.php               29-May-2024 02:08                4791
gearmanclient.setworkloadcallback.php              29-May-2024 02:08                4945
gearmanclient.timeout.php                          29-May-2024 02:08                2756
gearmanclient.wait.php                             29-May-2024 02:08                2803
gearmanjob.complete.php                            29-May-2024 02:08                3597
gearmanjob.construct.php                           29-May-2024 02:08                2345
gearmanjob.data.php                                29-May-2024 02:08                3557
gearmanjob.exception.php                           29-May-2024 02:08                3764
gearmanjob.fail.php                                29-May-2024 02:08                3675
gearmanjob.functionname.php                        29-May-2024 02:08                2932
gearmanjob.handle.php                              29-May-2024 02:08                2819
gearmanjob.returncode.php                          29-May-2024 02:08                2616
gearmanjob.sendcomplete.php                        29-May-2024 02:08                3316
gearmanjob.senddata.php                            29-May-2024 02:08                3283
gearmanjob.sendexception.php                       29-May-2024 02:08                3496
gearmanjob.sendfail.php                            29-May-2024 02:08                3392
gearmanjob.sendstatus.php                          29-May-2024 02:08                4011
gearmanjob.sendwarning.php                         29-May-2024 02:08                3492
gearmanjob.setreturn.php                           29-May-2024 02:08                2576
gearmanjob.status.php                              29-May-2024 02:08                4294
gearmanjob.unique.php                              29-May-2024 02:08                3056
gearmanjob.warning.php                             29-May-2024 02:08                3775
gearmanjob.workload.php                            29-May-2024 02:08                2814
gearmanjob.workloadsize.php                        29-May-2024 02:08                2632
gearmantask.construct.php                          29-May-2024 02:08                2370
gearmantask.create.php                             29-May-2024 02:08                2807
gearmantask.data.php                               29-May-2024 02:08                2793
gearmantask.datasize.php                           29-May-2024 02:08                2816
gearmantask.function.php                           29-May-2024 02:08                2657
gearmantask.functionname.php                       29-May-2024 02:08                2592
gearmantask.isknown.php                            29-May-2024 02:08                2468
gearmantask.isrunning.php                          29-May-2024 02:08                2468
gearmantask.jobhandle.php                          29-May-2024 02:08                2965
gearmantask.recvdata.php                           29-May-2024 02:08                3473
gearmantask.returncode.php                         29-May-2024 02:08                2643
gearmantask.senddata.php                           29-May-2024 02:08                3286
gearmantask.sendworkload.php                       29-May-2024 02:08                3435
gearmantask.taskdenominator.php                    29-May-2024 02:08                3009
gearmantask.tasknumerator.php                      29-May-2024 02:08                2981
gearmantask.unique.php                             29-May-2024 02:08                3226
gearmantask.uuid.php                               29-May-2024 02:08                3401
gearmanworker.addfunction.php                      29-May-2024 02:08                7905
gearmanworker.addoptions.php                       29-May-2024 02:08                3400
gearmanworker.addserver.php                        29-May-2024 02:08                5203
gearmanworker.addservers.php                       29-May-2024 02:08                4641
gearmanworker.clone.php                            29-May-2024 02:08                2326
gearmanworker.construct.php                        29-May-2024 02:08                2799
gearmanworker.echo.php                             29-May-2024 02:08                3036
gearmanworker.error.php                            29-May-2024 02:08                2853
gearmanworker.geterrno.php                         29-May-2024 02:08                2628
gearmanworker.options.php                          29-May-2024 02:08                2635
gearmanworker.register.php                         29-May-2024 02:08                3793
gearmanworker.removeoptions.php                    29-May-2024 02:08                3422
gearmanworker.returncode.php                       29-May-2024 02:08                2823
gearmanworker.setid.php                            29-May-2024 02:08                4081
gearmanworker.setoptions.php                       29-May-2024 02:08                3555
gearmanworker.settimeout.php                       29-May-2024 02:08                7799
gearmanworker.timeout.php                          29-May-2024 02:08                2735
gearmanworker.unregister.php                       29-May-2024 02:08                3357
gearmanworker.unregisterall.php                    29-May-2024 02:08                2999
gearmanworker.wait.php                             29-May-2024 02:08                7868
gearmanworker.work.php                             29-May-2024 02:08                5570
gender-gender.connect.php                          29-May-2024 02:08                2574
gender-gender.construct.php                        29-May-2024 02:08                2433
gender-gender.country.php                          29-May-2024 02:08                3814
gender-gender.get.php                              29-May-2024 02:08                2890
gender-gender.isnick.php                           29-May-2024 02:08                3494
gender-gender.similarnames.php                     29-May-2024 02:08                3003
gender.example.admin.php                           29-May-2024 02:08                8096
gender.examples.php                                29-May-2024 02:08                1385
gender.installation.php                            29-May-2024 02:08                1908
gender.setup.php                                   29-May-2024 02:08                1373
generator.current.php                              29-May-2024 02:08                2115
generator.getreturn.php                            29-May-2024 02:08                3803
generator.key.php                                  29-May-2024 02:08                3887
generator.next.php                                 29-May-2024 02:08                2425
generator.rewind.php                               29-May-2024 02:08                2179
generator.send.php                                 29-May-2024 02:08                5438
generator.throw.php                                29-May-2024 02:08                4981
generator.valid.php                                29-May-2024 02:08                2303
generator.wakeup.php                               29-May-2024 02:08                2176
geoip.configuration.php                            29-May-2024 02:08                2409
geoip.constants.php                                29-May-2024 02:08                6237
geoip.installation.php                             29-May-2024 02:08                1651
geoip.requirements.php                             29-May-2024 02:08                1658
geoip.resources.php                                29-May-2024 02:08                1179
geoip.setup.php                                    29-May-2024 02:08                1539
gettext.configuration.php                          29-May-2024 02:08                1236
gettext.constants.php                              29-May-2024 02:08                1174
gettext.installation.php                           29-May-2024 02:08                1378
gettext.requirements.php                           29-May-2024 02:08                1356
gettext.resources.php                              29-May-2024 02:08                1193
gettext.setup.php                                  29-May-2024 02:08                1582
getting-started.php                                29-May-2024 02:08                1930
globiterator.construct.php                         29-May-2024 02:08                7672
globiterator.count.php                             29-May-2024 02:08                4406
gmagick.addimage.php                               29-May-2024 02:08                2865
gmagick.addnoiseimage.php                          29-May-2024 02:08                2920
gmagick.annotateimage.php                          29-May-2024 02:08                4455
gmagick.blurimage.php                              29-May-2024 02:08                3316
gmagick.borderimage.php                            29-May-2024 02:08                3765
gmagick.charcoalimage.php                          29-May-2024 02:08                3266
gmagick.chopimage.php                              29-May-2024 02:08                3918
gmagick.clear.php                                  29-May-2024 02:08                2599
gmagick.commentimage.php                           29-May-2024 02:08                2867
gmagick.compositeimage.php                         29-May-2024 02:08                4081
gmagick.configuration.php                          29-May-2024 02:08                1239
gmagick.constants.php                              29-May-2024 02:08              103100
gmagick.construct.php                              29-May-2024 02:08                2629
gmagick.cropimage.php                              29-May-2024 02:08                4053
gmagick.cropthumbnailimage.php                     29-May-2024 02:08                3303
gmagick.current.php                                29-May-2024 02:08                2500
gmagick.cyclecolormapimage.php                     29-May-2024 02:08                2993
gmagick.deconstructimages.php                      29-May-2024 02:08                2748
gmagick.despeckleimage.php                         29-May-2024 02:08                3419
gmagick.destroy.php                                29-May-2024 02:08                2731
gmagick.drawimage.php                              29-May-2024 02:08                2989
gmagick.edgeimage.php                              29-May-2024 02:08                2936
gmagick.embossimage.php                            29-May-2024 02:08                3444
gmagick.enhanceimage.php                           29-May-2024 02:08                2610
gmagick.equalizeimage.php                          29-May-2024 02:08                2569
gmagick.examples.php                               29-May-2024 02:08                3429
gmagick.flipimage.php                              29-May-2024 02:08                2901
gmagick.flopimage.php                              29-May-2024 02:08                2898
gmagick.frameimage.php                             29-May-2024 02:08                4590
gmagick.gammaimage.php                             29-May-2024 02:08                3147
gmagick.getcopyright.php                           29-May-2024 02:08                2591
gmagick.getfilename.php                            29-May-2024 02:08                2541
gmagick.getimagebackgroundcolor.php                29-May-2024 02:08                2678
gmagick.getimageblueprimary.php                    29-May-2024 02:08                2995
gmagick.getimagebordercolor.php                    29-May-2024 02:08                2722
gmagick.getimagechanneldepth.php                   29-May-2024 02:08                2783
gmagick.getimagecolors.php                         29-May-2024 02:08                2577
gmagick.getimagecolorspace.php                     29-May-2024 02:08                2535
gmagick.getimagecompose.php                        29-May-2024 02:08                2615
gmagick.getimagedelay.php                          29-May-2024 02:08                2512
gmagick.getimagedepth.php                          29-May-2024 02:08                2482
gmagick.getimagedispose.php                        29-May-2024 02:08                2536
gmagick.getimageextrema.php                        29-May-2024 02:08                2741
gmagick.getimagefilename.php                       29-May-2024 02:08                2620
gmagick.getimageformat.php                         29-May-2024 02:08                2603
gmagick.getimagegamma.php                          29-May-2024 02:08                2503
gmagick.getimagegreenprimary.php                   29-May-2024 02:08                2722
gmagick.getimageheight.php                         29-May-2024 02:08                2534
gmagick.getimagehistogram.php                      29-May-2024 02:08                2895
gmagick.getimageindex.php                          29-May-2024 02:08                2665
gmagick.getimageinterlacescheme.php                29-May-2024 02:08                2653
gmagick.getimageiterations.php                     29-May-2024 02:08                2580
gmagick.getimagematte.php                          29-May-2024 02:08                2920
gmagick.getimagemattecolor.php                     29-May-2024 02:08                2628
gmagick.getimageprofile.php                        29-May-2024 02:08                2735
gmagick.getimageredprimary.php                     29-May-2024 02:08                2743
gmagick.getimagerenderingintent.php                29-May-2024 02:08                2664
gmagick.getimageresolution.php                     29-May-2024 02:08                2596
gmagick.getimagescene.php                          29-May-2024 02:08                2499
gmagick.getimagesignature.php                      29-May-2024 02:08                2614
gmagick.getimagetype.php                           29-May-2024 02:08                2506
gmagick.getimageunits.php                          29-May-2024 02:08                2276
gmagick.getimagewhitepoint.php                     29-May-2024 02:08                2719
gmagick.getimagewidth.php                          29-May-2024 02:08                2513
gmagick.getpackagename.php                         29-May-2024 02:08                2567
gmagick.getquantumdepth.php                        29-May-2024 02:08                2744
gmagick.getreleasedate.php                         29-May-2024 02:08                2601
gmagick.getsamplingfactors.php                     29-May-2024 02:08                2654
gmagick.getsize.php                                29-May-2024 02:08                2803
gmagick.getversion.php                             29-May-2024 02:08                2544
gmagick.hasnextimage.php                           29-May-2024 02:08                2901
gmagick.haspreviousimage.php                       29-May-2024 02:08                2945
gmagick.implodeimage.php                           29-May-2024 02:08                2976
gmagick.installation.php                           29-May-2024 02:08                1889
gmagick.labelimage.php                             29-May-2024 02:08                2745
gmagick.levelimage.php                             29-May-2024 02:08                4696
gmagick.magnifyimage.php                           29-May-2024 02:08                2595
gmagick.mapimage.php                               29-May-2024 02:08                3281
gmagick.medianfilterimage.php                      29-May-2024 02:08                3065
gmagick.minifyimage.php                            29-May-2024 02:08                2629
gmagick.modulateimage.php                          29-May-2024 02:08                3894
gmagick.motionblurimage.php                        29-May-2024 02:08                3919
gmagick.newimage.php                               29-May-2024 02:08                3941
gmagick.nextimage.php                              29-May-2024 02:08                2752
gmagick.normalizeimage.php                         29-May-2024 02:08                3021
gmagick.oilpaintimage.php                          29-May-2024 02:08                3037
gmagick.previousimage.php                          29-May-2024 02:08                2747
gmagick.profileimage.php                           29-May-2024 02:08                3595
gmagick.quantizeimage.php                          29-May-2024 02:08                5364
gmagick.quantizeimages.php                         29-May-2024 02:08                5367
gmagick.queryfontmetrics.php                       29-May-2024 02:08                2922
gmagick.queryfonts.php                             29-May-2024 02:08                2698
gmagick.queryformats.php                           29-May-2024 02:08                3115
gmagick.radialblurimage.php                        29-May-2024 02:08                3241
gmagick.raiseimage.php                             29-May-2024 02:08                4432
gmagick.read.php                                   29-May-2024 02:08                2760
gmagick.readimage.php                              29-May-2024 02:08                2810
gmagick.readimageblob.php                          29-May-2024 02:08                3233
gmagick.readimagefile.php                          29-May-2024 02:08                3110
gmagick.reducenoiseimage.php                       29-May-2024 02:08                3215
gmagick.removeimage.php                            29-May-2024 02:08                2577
gmagick.removeimageprofile.php                     29-May-2024 02:08                2922
gmagick.requirements.php                           29-May-2024 02:08                1658
gmagick.resampleimage.php                          29-May-2024 02:08                3944
gmagick.resizeimage.php                            29-May-2024 02:08                4281
gmagick.rollimage.php                              29-May-2024 02:08                3020
gmagick.rotateimage.php                            29-May-2024 02:08                3195
gmagick.scaleimage.php                             29-May-2024 02:08                3563
gmagick.separateimagechannel.php                   29-May-2024 02:08                3207
gmagick.setcompressionquality.php                  29-May-2024 02:08                4211
gmagick.setfilename.php                            29-May-2024 02:08                2940
gmagick.setimagebackgroundcolor.php                29-May-2024 02:08                3009
gmagick.setimageblueprimary.php                    29-May-2024 02:08                3303
gmagick.setimagebordercolor.php                    29-May-2024 02:08                2971
gmagick.setimagechanneldepth.php                   29-May-2024 02:08                3450
gmagick.setimagecolorspace.php                     29-May-2024 02:08                3092
gmagick.setimagecompose.php                        29-May-2024 02:08                2858
gmagick.setimagedelay.php                          29-May-2024 02:08                2872
gmagick.setimagedepth.php                          29-May-2024 02:08                2870
gmagick.setimagedispose.php                        29-May-2024 02:08                2914
gmagick.setimagefilename.php                       29-May-2024 02:08                2964
gmagick.setimageformat.php                         29-May-2024 02:08                2927
gmagick.setimagegamma.php                          29-May-2024 02:08                2864
gmagick.setimagegreenprimary.php                   29-May-2024 02:08                3311
gmagick.setimageindex.php                          29-May-2024 02:08                3011
gmagick.setimageinterlacescheme.php                29-May-2024 02:08                3158
gmagick.setimageiterations.php                     29-May-2024 02:08                2967
gmagick.setimageprofile.php                        29-May-2024 02:08                3400
gmagick.setimageredprimary.php                     29-May-2024 02:08                3214
gmagick.setimagerenderingintent.php                29-May-2024 02:08                3189
gmagick.setimageresolution.php                     29-May-2024 02:08                3208
gmagick.setimagescene.php                          29-May-2024 02:08                2860
gmagick.setimagetype.php                           29-May-2024 02:08                2985
gmagick.setimageunits.php                          29-May-2024 02:08                3044
gmagick.setimagewhitepoint.php                     29-May-2024 02:08                3240
gmagick.setsamplingfactors.php                     29-May-2024 02:08                3086
gmagick.setsize.php                                29-May-2024 02:08                3556
gmagick.setup.php                                  29-May-2024 02:08                1505
gmagick.shearimage.php                             29-May-2024 02:08                3938
gmagick.solarizeimage.php                          29-May-2024 02:08                3118
gmagick.spreadimage.php                            29-May-2024 02:08                2962
gmagick.stripimage.php                             29-May-2024 02:08                2557
gmagick.swirlimage.php                             29-May-2024 02:08                3043
gmagick.thumbnailimage.php                         29-May-2024 02:08                3874
gmagick.trimimage.php                              29-May-2024 02:08                3107
gmagick.write.php                                  29-May-2024 02:08                1748
gmagick.writeimage.php                             29-May-2024 02:08                3519
gmagickdraw.annotate.php                           29-May-2024 02:08                3204
gmagickdraw.arc.php                                29-May-2024 02:08                4364
gmagickdraw.bezier.php                             29-May-2024 02:08                2643
gmagickdraw.ellipse.php                            29-May-2024 02:08                4285
gmagickdraw.getfillcolor.php                       29-May-2024 02:08                2446
gmagickdraw.getfillopacity.php                     29-May-2024 02:08                2397
gmagickdraw.getfont.php                            29-May-2024 02:08                2388
gmagickdraw.getfontsize.php                        29-May-2024 02:08                2439
gmagickdraw.getfontstyle.php                       29-May-2024 02:08                2515
gmagickdraw.getfontweight.php                      29-May-2024 02:08                2360
gmagickdraw.getstrokecolor.php                     29-May-2024 02:08                2501
gmagickdraw.getstrokeopacity.php                   29-May-2024 02:08                2474
gmagickdraw.getstrokewidth.php                     29-May-2024 02:08                2493
gmagickdraw.gettextdecoration.php                  29-May-2024 02:08                2427
gmagickdraw.gettextencoding.php                    29-May-2024 02:08                2516
gmagickdraw.line.php                               29-May-2024 02:08                3648
gmagickdraw.point.php                              29-May-2024 02:08                2935
gmagickdraw.polygon.php                            29-May-2024 02:08                2710
gmagickdraw.polyline.php                           29-May-2024 02:08                2745
gmagickdraw.rectangle.php                          29-May-2024 02:08                3752
gmagickdraw.rotate.php                             29-May-2024 02:08                2701
gmagickdraw.roundrectangle.php                     29-May-2024 02:08                4529
gmagickdraw.scale.php                              29-May-2024 02:08                2999
gmagickdraw.setfillcolor.php                       29-May-2024 02:08                2961
gmagickdraw.setfillopacity.php                     29-May-2024 02:08                2799
gmagickdraw.setfont.php                            29-May-2024 02:08                2699
gmagickdraw.setfontsize.php                        29-May-2024 02:08                2729
gmagickdraw.setfontstyle.php                       29-May-2024 02:08                2860
gmagickdraw.setfontweight.php                      29-May-2024 02:08                2731
gmagickdraw.setstrokecolor.php                     29-May-2024 02:08                2985
gmagickdraw.setstrokeopacity.php                   29-May-2024 02:08                2817
gmagickdraw.setstrokewidth.php                     29-May-2024 02:08                2777
gmagickdraw.settextdecoration.php                  29-May-2024 02:08                2863
gmagickdraw.settextencoding.php                    29-May-2024 02:08                3071
gmagickpixel.construct.php                         29-May-2024 02:08                2579
gmagickpixel.getcolor.php                          29-May-2024 02:08                4363
gmagickpixel.getcolorcount.php                     29-May-2024 02:08                2488
gmagickpixel.getcolorvalue.php                     29-May-2024 02:08                2907
gmagickpixel.setcolor.php                          29-May-2024 02:08                3038
gmagickpixel.setcolorvalue.php                     29-May-2024 02:08                3317
gmp.configuration.php                              29-May-2024 02:08                1211
gmp.constants.php                                  29-May-2024 02:08                4414
gmp.construct.php                                  29-May-2024 02:08                3756
gmp.examples.php                                   29-May-2024 02:08                3067
gmp.installation.php                               29-May-2024 02:08                1323
gmp.requirements.php                               29-May-2024 02:08                1703
gmp.serialize.php                                  29-May-2024 02:08                2220
gmp.setup.php                                      29-May-2024 02:08                1467
gmp.unserialize.php                                29-May-2024 02:08                2543
gnupg.configuration.php                            29-May-2024 02:08                1220
gnupg.constants.php                                29-May-2024 02:08                9412
gnupg.examples-clearsign.php                       29-May-2024 02:08                6346
gnupg.examples.php                                 29-May-2024 02:08                1391
gnupg.installation.php                             29-May-2024 02:08                1513
gnupg.requirements.php                             29-May-2024 02:08                1262
gnupg.resources.php                                29-May-2024 02:08                1179
gnupg.setup.php                                    29-May-2024 02:08                1554
hash.configuration.php                             29-May-2024 02:08                1215
hash.constants.php                                 29-May-2024 02:08                1736
hash.installation.php                              29-May-2024 02:08                1613
hash.requirements.php                              29-May-2024 02:08                1184
hash.resources.php                                 29-May-2024 02:08                1328
hash.setup.php                                     29-May-2024 02:08                1535
hashcontext.construct.php                          29-May-2024 02:08                1911
hashcontext.serialize.php                          29-May-2024 02:08                2344
hashcontext.unserialize.php                        29-May-2024 02:08                2650
history.php                                        29-May-2024 02:08                2084
history.php.books.php                              29-May-2024 02:08                2480
history.php.php                                    29-May-2024 02:08                9158
history.php.publications.php                       29-May-2024 02:08                1756
history.php.related.php                            29-May-2024 02:08                5358
hrtime-performancecounter.getfrequency.php         29-May-2024 02:08                2744
hrtime-performancecounter.getticks.php             29-May-2024 02:08                2617
hrtime-performancecounter.gettickssince.php        29-May-2024 02:08                2936
hrtime-stopwatch.getelapsedticks.php               29-May-2024 02:08                2519
hrtime-stopwatch.getelapsedtime.php                29-May-2024 02:08                2931
hrtime-stopwatch.getlastelapsedticks.php           29-May-2024 02:08                2587
hrtime-stopwatch.getlastelapsedtime.php            29-May-2024 02:08                2955
hrtime-stopwatch.isrunning.php                     29-May-2024 02:08                2445
hrtime-stopwatch.start.php                         29-May-2024 02:08                2381
hrtime-stopwatch.stop.php                          29-May-2024 02:08                2260
hrtime.example.basic.php                           29-May-2024 02:08                5474
hrtime.examples.php                                29-May-2024 02:08                1379
hrtime.installation.php                            29-May-2024 02:08                1908
hrtime.setup.php                                   29-May-2024 02:08                1370
ibase.configuration.php                            29-May-2024 02:08                7884
ibase.constants.php                                29-May-2024 02:08               21288
ibase.installation.php                             29-May-2024 02:08                3089
ibase.requirements.php                             29-May-2024 02:08                1159
ibase.resources.php                                29-May-2024 02:08                1179
ibase.setup.php                                    29-May-2024 02:08                1572
ibm-db2.configuration.php                          29-May-2024 02:08               20760
ibm-db2.constants.php                              29-May-2024 02:08                9031
ibm-db2.installation.php                           29-May-2024 02:08                3479
ibm-db2.requirements.php                           29-May-2024 02:08                3201
ibm-db2.resources.php                              29-May-2024 02:08                1265
ibm-db2.setup.php                                  29-May-2024 02:08                1584
iconv.configuration.php                            29-May-2024 02:08                4507
iconv.constants.php                                29-May-2024 02:08                3619
iconv.installation.php                             29-May-2024 02:08                1470
iconv.requirements.php                             29-May-2024 02:08                1420
iconv.resources.php                                29-May-2024 02:08                1179
iconv.setup.php                                    29-May-2024 02:08                1564
igbinary.configuration.php                         29-May-2024 02:08                3358
igbinary.installation.php                          29-May-2024 02:08                1916
igbinary.requirements.php                          29-May-2024 02:08                1180
igbinary.setup.php                                 29-May-2024 02:08                1512
image.configuration.php                            29-May-2024 02:08                3200
image.constants.php                                29-May-2024 02:08               52308
image.examples-png.php                             29-May-2024 02:08                4683
image.examples-watermark.php                       29-May-2024 02:08                5707
image.examples.merged-watermark.php                29-May-2024 02:08                8419
image.examples.php                                 29-May-2024 02:08                1605
image.installation.php                             29-May-2024 02:08                5818
image.requirements.php                             29-May-2024 02:08                4184
image.resources.php                                29-May-2024 02:08                2022
image.setup.php                                    29-May-2024 02:08                1560
imagick.adaptiveblurimage.php                      29-May-2024 02:08                6871
imagick.adaptiveresizeimage.php                    29-May-2024 02:08                8981
imagick.adaptivesharpenimage.php                   29-May-2024 02:08                6411
imagick.adaptivethresholdimage.php                 29-May-2024 02:08                6239
imagick.addimage.php                               29-May-2024 02:08                2918
imagick.addnoiseimage.php                          29-May-2024 02:08                5568
imagick.affinetransformimage.php                   29-May-2024 02:08                6635
imagick.animateimages.php                          29-May-2024 02:08                3148
imagick.annotateimage.php                          29-May-2024 02:08                8670
imagick.appendimages.php                           29-May-2024 02:08                6678
imagick.autolevelimage.php                         29-May-2024 02:08                4466
imagick.averageimages.php                          29-May-2024 02:08                2687
imagick.blackthresholdimage.php                    29-May-2024 02:08                5293
imagick.blueshiftimage.php                         29-May-2024 02:08                4511
imagick.blurimage.php                              29-May-2024 02:08                5749
imagick.borderimage.php                            29-May-2024 02:08                6043
imagick.brightnesscontrastimage.php                29-May-2024 02:08                5671
imagick.charcoalimage.php                          29-May-2024 02:08                5004
imagick.chopimage.php                              29-May-2024 02:08                7001
imagick.clampimage.php                             29-May-2024 02:08                2739
imagick.clear.php                                  29-May-2024 02:08                2268
imagick.clipimage.php                              29-May-2024 02:08                2503
imagick.clipimagepath.php                          29-May-2024 02:08                3124
imagick.clippathimage.php                          29-May-2024 02:08                3520
imagick.clone.php                                  29-May-2024 02:08                4124
imagick.clutimage.php                              29-May-2024 02:08                6005
imagick.coalesceimages.php                         29-May-2024 02:08                2804
imagick.colorfloodfillimage.php                    29-May-2024 02:08                5407
imagick.colorizeimage.php                          29-May-2024 02:08                6861
imagick.colormatriximage.php                       29-May-2024 02:08                7634
imagick.combineimages.php                          29-May-2024 02:08                3362
imagick.commentimage.php                           29-May-2024 02:08                4971
imagick.compareimagechannels.php                   29-May-2024 02:08                3958
imagick.compareimagelayers.php                     29-May-2024 02:08                5428
imagick.compareimages.php                          29-May-2024 02:08                5650
imagick.compositeimage.php                         29-May-2024 02:08                8153
imagick.configuration.php                          29-May-2024 02:08                4350
imagick.constants.php                              29-May-2024 02:08              157646
imagick.construct.php                              29-May-2024 02:08                2600
imagick.contrastimage.php                          29-May-2024 02:08                5032
imagick.contraststretchimage.php                   29-May-2024 02:08                3942
imagick.convolveimage.php                          29-May-2024 02:08                5948
imagick.count.php                                  29-May-2024 02:08                2728
imagick.cropimage.php                              29-May-2024 02:08                6155
imagick.cropthumbnailimage.php                     29-May-2024 02:08                3473
imagick.current.php                                29-May-2024 02:08                2465
imagick.cyclecolormapimage.php                     29-May-2024 02:08                3001
imagick.decipherimage.php                          29-May-2024 02:08                3240
imagick.deconstructimages.php                      29-May-2024 02:08                2620
imagick.deleteimageartifact.php                    29-May-2024 02:08                3636
imagick.deleteimageproperty.php                    29-May-2024 02:08                2661
imagick.deskewimage.php                            29-May-2024 02:08               11008
imagick.despeckleimage.php                         29-May-2024 02:08                4243
imagick.destroy.php                                29-May-2024 02:08                2406
imagick.displayimage.php                           29-May-2024 02:08                2802
imagick.displayimages.php                          29-May-2024 02:08                2846
imagick.distortimage.php                           29-May-2024 02:08               11800
imagick.drawimage.php                              29-May-2024 02:08                2702
imagick.edgeimage.php                              29-May-2024 02:08                4670
imagick.embossimage.php                            29-May-2024 02:08                5367
imagick.encipherimage.php                          29-May-2024 02:08                3236
imagick.enhanceimage.php                           29-May-2024 02:08                4210
imagick.equalizeimage.php                          29-May-2024 02:08                4177
imagick.evaluateimage.php                          29-May-2024 02:08                5924
imagick.examples-1.php                             29-May-2024 02:08               29857
imagick.examples.php                               29-May-2024 02:08                1393
imagick.exportimagepixels.php                      29-May-2024 02:08                7905
imagick.extentimage.php                            29-May-2024 02:08                5232
imagick.filter.php                                 29-May-2024 02:08                7559
imagick.flattenimages.php                          29-May-2024 02:08                2791
imagick.flipimage.php                              29-May-2024 02:08                4504
imagick.floodfillpaintimage.php                    29-May-2024 02:08               11527
imagick.flopimage.php                              29-May-2024 02:08                4536
imagick.forwardfouriertransformimage.php           29-May-2024 02:08               12098
imagick.frameimage.php                             29-May-2024 02:08                8313
imagick.functionimage.php                          29-May-2024 02:08               13645
imagick.fximage.php                                29-May-2024 02:08                6048
imagick.gammaimage.php                             29-May-2024 02:08                5709
imagick.gaussianblurimage.php                      29-May-2024 02:08                6245
imagick.getcolorspace.php                          29-May-2024 02:08                2428
imagick.getcompression.php                         29-May-2024 02:08                2282
imagick.getcompressionquality.php                  29-May-2024 02:08                2356
imagick.getcopyright.php                           29-May-2024 02:08                2385
imagick.getfilename.php                            29-May-2024 02:08                2442
imagick.getfont.php                                29-May-2024 02:08                3054
imagick.getformat.php                              29-May-2024 02:08                2404
imagick.getgravity.php                             29-May-2024 02:08                2407
imagick.gethomeurl.php                             29-May-2024 02:08                2262
imagick.getimage.php                               29-May-2024 02:08                2446
imagick.getimagealphachannel.php                   29-May-2024 02:08                3492
imagick.getimageartifact.php                       29-May-2024 02:08                3536
imagick.getimageattribute.php                      29-May-2024 02:08                2801
imagick.getimagebackgroundcolor.php                29-May-2024 02:08                2612
imagick.getimageblob.php                           29-May-2024 02:08                2698
imagick.getimageblueprimary.php                    29-May-2024 02:08                2904
imagick.getimagebordercolor.php                    29-May-2024 02:08                2619
imagick.getimagechanneldepth.php                   29-May-2024 02:08                3208
imagick.getimagechanneldistortion.php              29-May-2024 02:08                4092
imagick.getimagechanneldistortions.php             29-May-2024 02:08                4447
imagick.getimagechannelextrema.php                 29-May-2024 02:08                3615
imagick.getimagechannelkurtosis.php                29-May-2024 02:08                3582
imagick.getimagechannelmean.php                    29-May-2024 02:08                3270
imagick.getimagechannelrange.php                   29-May-2024 02:08                3435
imagick.getimagechannelstatistics.php              29-May-2024 02:08                2611
imagick.getimageclipmask.php                       29-May-2024 02:08                2911
imagick.getimagecolormapcolor.php                  29-May-2024 02:08                2969
imagick.getimagecolors.php                         29-May-2024 02:08                2426
imagick.getimagecolorspace.php                     29-May-2024 02:08                2409
imagick.getimagecompose.php                        29-May-2024 02:08                2417
imagick.getimagecompression.php                    29-May-2024 02:08                2370
imagick.getimagecompressionquality.php             29-May-2024 02:08                2464
imagick.getimagedelay.php                          29-May-2024 02:08                2435
imagick.getimagedepth.php                          29-May-2024 02:08                2215
imagick.getimagedispose.php                        29-May-2024 02:08                2475
imagick.getimagedistortion.php                     29-May-2024 02:08                3275
imagick.getimageextrema.php                        29-May-2024 02:08                2850
imagick.getimagefilename.php                       29-May-2024 02:08                2549
imagick.getimageformat.php                         29-May-2024 02:08                2531
imagick.getimagegamma.php                          29-May-2024 02:08                2430
imagick.getimagegeometry.php                       29-May-2024 02:08                4137
imagick.getimagegravity.php                        29-May-2024 02:08                2700
imagick.getimagegreenprimary.php                   29-May-2024 02:08                2700
imagick.getimageheight.php                         29-May-2024 02:08                2461
imagick.getimagehistogram.php                      29-May-2024 02:08               17189
imagick.getimageindex.php                          29-May-2024 02:08                2957
imagick.getimageinterlacescheme.php                29-May-2024 02:08                2507
imagick.getimageinterpolatemethod.php              29-May-2024 02:08                2734
imagick.getimageiterations.php                     29-May-2024 02:08                2523
imagick.getimagelength.php                         29-May-2024 02:08                3383
imagick.getimagematte.php                          29-May-2024 02:08                2774
imagick.getimagemattecolor.php                     29-May-2024 02:08                2765
imagick.getimagemimetype.php                       29-May-2024 02:08                2280
imagick.getimageorientation.php                    29-May-2024 02:08                2627
imagick.getimagepage.php                           29-May-2024 02:08                2692
imagick.getimagepixelcolor.php                     29-May-2024 02:08                3170
imagick.getimageprofile.php                        29-May-2024 02:08                2814
imagick.getimageprofiles.php                       29-May-2024 02:08                3543
imagick.getimageproperties.php                     29-May-2024 02:08                5784
imagick.getimageproperty.php                       29-May-2024 02:08                4926
imagick.getimageredprimary.php                     29-May-2024 02:08                2768
imagick.getimageregion.php                         29-May-2024 02:08                3970
imagick.getimagerenderingintent.php                29-May-2024 02:08                2651
imagick.getimageresolution.php                     29-May-2024 02:08                2512
imagick.getimagesblob.php                          29-May-2024 02:08                2540
imagick.getimagescene.php                          29-May-2024 02:08                2417
imagick.getimagesignature.php                      29-May-2024 02:08                2546
imagick.getimagesize.php                           29-May-2024 02:08                2635
imagick.getimagetickspersecond.php                 29-May-2024 02:08                2563
imagick.getimagetotalinkdensity.php                29-May-2024 02:08                2493
imagick.getimagetype.php                           29-May-2024 02:08                4870
imagick.getimageunits.php                          29-May-2024 02:08                2459
imagick.getimagevirtualpixelmethod.php             29-May-2024 02:08                2630
imagick.getimagewhitepoint.php                     29-May-2024 02:08                2680
imagick.getimagewidth.php                          29-May-2024 02:08                2435
imagick.getinterlacescheme.php                     29-May-2024 02:08                2581
imagick.getiteratorindex.php                       29-May-2024 02:08                6048
imagick.getnumberimages.php                        29-May-2024 02:08                2530
imagick.getoption.php                              29-May-2024 02:08                2788
imagick.getpackagename.php                         29-May-2024 02:08                2503
imagick.getpage.php                                29-May-2024 02:08                2516
imagick.getpixeliterator.php                       29-May-2024 02:08                5975
imagick.getpixelregioniterator.php                 29-May-2024 02:08                6737
imagick.getpointsize.php                           29-May-2024 02:08                2770
imagick.getquantum.php                             29-May-2024 02:08                2308
imagick.getquantumdepth.php                        29-May-2024 02:08                2614
imagick.getquantumrange.php                        29-May-2024 02:08                2876
imagick.getregistry.php                            29-May-2024 02:08                2537
imagick.getreleasedate.php                         29-May-2024 02:08                2527
imagick.getresource.php                            29-May-2024 02:08                2945
imagick.getresourcelimit.php                       29-May-2024 02:08                3356
imagick.getsamplingfactors.php                     29-May-2024 02:08                2591
imagick.getsize.php                                29-May-2024 02:08                5833
imagick.getsizeoffset.php                          29-May-2024 02:08                2548
imagick.getversion.php                             29-May-2024 02:08                2513
imagick.haldclutimage.php                          29-May-2024 02:08                6083
imagick.hasnextimage.php                           29-May-2024 02:08                2658
imagick.haspreviousimage.php                       29-May-2024 02:08                2696
imagick.identifyformat.php                         29-May-2024 02:08                4486
imagick.identifyimage.php                          29-May-2024 02:08                4107
imagick.implodeimage.php                           29-May-2024 02:08                4660
imagick.importimagepixels.php                      29-May-2024 02:08               11353
imagick.installation.php                           29-May-2024 02:08                2908
imagick.inversefouriertransformimage.php           29-May-2024 02:08                3473
imagick.labelimage.php                             29-May-2024 02:08                2605
imagick.levelimage.php                             29-May-2024 02:08                7775
imagick.linearstretchimage.php                     29-May-2024 02:08                5687
imagick.liquidrescaleimage.php                     29-May-2024 02:08                4499
imagick.listregistry.php                           29-May-2024 02:08                2367
imagick.magnifyimage.php                           29-May-2024 02:08                4209
imagick.mapimage.php                               29-May-2024 02:08                3222
imagick.mattefloodfillimage.php                    29-May-2024 02:08                5744
imagick.medianfilterimage.php                      29-May-2024 02:08                5109
imagick.mergeimagelayers.php                       29-May-2024 02:08                6423
imagick.minifyimage.php                            29-May-2024 02:08                2386
imagick.modulateimage.php                          29-May-2024 02:08                5635
imagick.montageimage.php                           29-May-2024 02:08                4583
imagick.morphimages.php                            29-May-2024 02:08                2815
imagick.morphology.php                             29-May-2024 02:08               66541
imagick.mosaicimages.php                           29-May-2024 02:08                2696
imagick.motionblurimage.php                        29-May-2024 02:08                6806
imagick.negateimage.php                            29-May-2024 02:08                5559
imagick.newimage.php                               29-May-2024 02:08                7525
imagick.newpseudoimage.php                         29-May-2024 02:08                5817
imagick.nextimage.php                              29-May-2024 02:08                2318
imagick.normalizeimage.php                         29-May-2024 02:08                6408
imagick.oilpaintimage.php                          29-May-2024 02:08                4613
imagick.opaquepaintimage.php                       29-May-2024 02:08                4984
imagick.optimizeimagelayers.php                    29-May-2024 02:08                5260
imagick.orderedposterizeimage.php                  29-May-2024 02:08                6754
imagick.paintfloodfillimage.php                    29-May-2024 02:08                5730
imagick.paintopaqueimage.php                       29-May-2024 02:08                5355
imagick.painttransparentimage.php                  29-May-2024 02:08                4620
imagick.pingimage.php                              29-May-2024 02:08                2727
imagick.pingimageblob.php                          29-May-2024 02:08                5941
imagick.pingimagefile.php                          29-May-2024 02:08                5773
imagick.polaroidimage.php                          29-May-2024 02:08                4732
imagick.posterizeimage.php                         29-May-2024 02:08                5646
imagick.previewimages.php                          29-May-2024 02:08                3124
imagick.previousimage.php                          29-May-2024 02:08                2373
imagick.profileimage.php                           29-May-2024 02:08                3212
imagick.quantizeimage.php                          29-May-2024 02:08                6699
imagick.quantizeimages.php                         29-May-2024 02:08                4041
imagick.queryfontmetrics.php                       29-May-2024 02:08                5588
imagick.queryfonts.php                             29-May-2024 02:08                4734
imagick.queryformats.php                           29-May-2024 02:08                7109
imagick.radialblurimage.php                        29-May-2024 02:08                5516
imagick.raiseimage.php                             29-May-2024 02:08                6530
imagick.randomthresholdimage.php                   29-May-2024 02:08                6414
imagick.readimage.php                              29-May-2024 02:08                2569
imagick.readimageblob.php                          29-May-2024 02:08                5809
imagick.readimagefile.php                          29-May-2024 02:08                3210
imagick.readimages.php                             29-May-2024 02:08                2616
imagick.recolorimage.php                           29-May-2024 02:08                6284
imagick.reducenoiseimage.php                       29-May-2024 02:08                5159
imagick.remapimage.php                             29-May-2024 02:08                3428
imagick.removeimage.php                            29-May-2024 02:08                2509
imagick.removeimageprofile.php                     29-May-2024 02:08                2809
imagick.render.php                                 29-May-2024 02:08                2281
imagick.requirements.php                           29-May-2024 02:08                1541
imagick.resampleimage.php                          29-May-2024 02:08                5639
imagick.resetimagepage.php                         29-May-2024 02:08                2796
imagick.resizeimage.php                            29-May-2024 02:08               11242
imagick.resources.php                              29-May-2024 02:08                1193
imagick.rollimage.php                              29-May-2024 02:08                4811
imagick.rotateimage.php                            29-May-2024 02:08                5683
imagick.rotationalblurimage.php                    29-May-2024 02:08                5738
imagick.roundcorners.php                           29-May-2024 02:08                6646
imagick.sampleimage.php                            29-May-2024 02:08                2992
imagick.scaleimage.php                             29-May-2024 02:08                6910
imagick.segmentimage.php                           29-May-2024 02:08                6754
imagick.selectiveblurimage.php                     29-May-2024 02:08                6601
imagick.separateimagechannel.php                   29-May-2024 02:08                5395
imagick.sepiatoneimage.php                         29-May-2024 02:08                4891
imagick.setbackgroundcolor.php                     29-May-2024 02:08                3268
imagick.setcolorspace.php                          29-May-2024 02:08                2985
imagick.setcompression.php                         29-May-2024 02:08                2786
imagick.setcompressionquality.php                  29-May-2024 02:08                6931
imagick.setfilename.php                            29-May-2024 02:08                2656
imagick.setfirstiterator.php                       29-May-2024 02:08                2367
imagick.setfont.php                                29-May-2024 02:08                5498
imagick.setformat.php                              29-May-2024 02:08                2558
imagick.setgravity.php                             29-May-2024 02:08                2717
imagick.setimage.php                               29-May-2024 02:08                4702
imagick.setimagealphachannel.php                   29-May-2024 02:08                3643
imagick.setimageartifact.php                       29-May-2024 02:08                7291
imagick.setimageattribute.php                      29-May-2024 02:08                3146
imagick.setimagebackgroundcolor.php                29-May-2024 02:08                3497
imagick.setimagebias.php                           29-May-2024 02:08                6722
imagick.setimagebiasquantum.php                    29-May-2024 02:08                2876
imagick.setimageblueprimary.php                    29-May-2024 02:08                3171
imagick.setimagebordercolor.php                    29-May-2024 02:08                3475
imagick.setimagechanneldepth.php                   29-May-2024 02:08                3188
imagick.setimageclipmask.php                       29-May-2024 02:08                8653
imagick.setimagecolormapcolor.php                  29-May-2024 02:08                3211
imagick.setimagecolorspace.php                     29-May-2024 02:08                3232
imagick.setimagecompose.php                        29-May-2024 02:08                2951
imagick.setimagecompression.php                    29-May-2024 02:08                2922
imagick.setimagecompressionquality.php             29-May-2024 02:08                4853
imagick.setimagedelay.php                          29-May-2024 02:08                6164
imagick.setimagedepth.php                          29-May-2024 02:08                2769
imagick.setimagedispose.php                        29-May-2024 02:08                2813
imagick.setimageextent.php                         29-May-2024 02:08                3088
imagick.setimagefilename.php                       29-May-2024 02:08                2865
imagick.setimageformat.php                         29-May-2024 02:08                2713
imagick.setimagegamma.php                          29-May-2024 02:08                2773
imagick.setimagegravity.php                        29-May-2024 02:08                2882
imagick.setimagegreenprimary.php                   29-May-2024 02:08                3164
imagick.setimageindex.php                          29-May-2024 02:08                3342
imagick.setimageinterlacescheme.php                29-May-2024 02:08                2933
imagick.setimageinterpolatemethod.php              29-May-2024 02:08                2860
imagick.setimageiterations.php                     29-May-2024 02:08                5010
imagick.setimagematte.php                          29-May-2024 02:08                2754
imagick.setimagemattecolor.php                     29-May-2024 02:08                3659
imagick.setimageopacity.php                        29-May-2024 02:08                4981
imagick.setimageorientation.php                    29-May-2024 02:08                4722
imagick.setimagepage.php                           29-May-2024 02:08                3727
imagick.setimageprofile.php                        29-May-2024 02:08                3307
imagick.setimageproperty.php                       29-May-2024 02:08                5143
imagick.setimageredprimary.php                     29-May-2024 02:08                3160
imagick.setimagerenderingintent.php                29-May-2024 02:08                2939
imagick.setimageresolution.php                     29-May-2024 02:08                5004
imagick.setimagescene.php                          29-May-2024 02:08                2793
imagick.setimagetickspersecond.php                 29-May-2024 02:08                7747
imagick.setimagetype.php                           29-May-2024 02:08                2591
imagick.setimageunits.php                          29-May-2024 02:08                2627
imagick.setimagevirtualpixelmethod.php             29-May-2024 02:08                2747
imagick.setimagewhitepoint.php                     29-May-2024 02:08                3158
imagick.setinterlacescheme.php                     29-May-2024 02:08                2675
imagick.setiteratorindex.php                       29-May-2024 02:08                6220
imagick.setlastiterator.php                        29-May-2024 02:08                2381
imagick.setoption.php                              29-May-2024 02:08               11534
imagick.setpage.php                                29-May-2024 02:08                3480
imagick.setpointsize.php                           29-May-2024 02:08                5201
imagick.setprogressmonitor.php                     29-May-2024 02:08               10243
imagick.setregistry.php                            29-May-2024 02:08                3073
imagick.setresolution.php                          29-May-2024 02:08                3764
imagick.setresourcelimit.php                       29-May-2024 02:08                3686
imagick.setsamplingfactors.php                     29-May-2024 02:08                6776
imagick.setsize.php                                29-May-2024 02:08                2906
imagick.setsizeoffset.php                          29-May-2024 02:08                3390
imagick.settype.php                                29-May-2024 02:08                2537
imagick.setup.php                                  29-May-2024 02:08                1579
imagick.shadeimage.php                             29-May-2024 02:08                5625
imagick.shadowimage.php                            29-May-2024 02:08                5450
imagick.sharpenimage.php                           29-May-2024 02:08                5620
imagick.shaveimage.php                             29-May-2024 02:08                4753
imagick.shearimage.php                             29-May-2024 02:08                6463
imagick.sigmoidalcontrastimage.php                 29-May-2024 02:08                7981
imagick.sketchimage.php                            29-May-2024 02:08                5829
imagick.smushimages.php                            29-May-2024 02:08                5804
imagick.solarizeimage.php                          29-May-2024 02:08                4856
imagick.sparsecolorimage.php                       29-May-2024 02:08               26616
imagick.spliceimage.php                            29-May-2024 02:08                5818
imagick.spreadimage.php                            29-May-2024 02:08                4666
imagick.statisticimage.php                         29-May-2024 02:08                6740
imagick.steganoimage.php                           29-May-2024 02:08                3058
imagick.stereoimage.php                            29-May-2024 02:08                2844
imagick.stripimage.php                             29-May-2024 02:08                2492
imagick.subimagematch.php                          29-May-2024 02:08                7518
imagick.swirlimage.php                             29-May-2024 02:08                4718
imagick.textureimage.php                           29-May-2024 02:08                6133
imagick.thresholdimage.php                         29-May-2024 02:08                5272
imagick.thumbnailimage.php                         29-May-2024 02:08                7481
imagick.tintimage.php                              29-May-2024 02:08                7800
imagick.tostring.php                               29-May-2024 02:08                2934
imagick.transformimage.php                         29-May-2024 02:08                5967
imagick.transformimagecolorspace.php               29-May-2024 02:08                5724
imagick.transparentpaintimage.php                  29-May-2024 02:08                7201
imagick.transposeimage.php                         29-May-2024 02:08                4554
imagick.transverseimage.php                        29-May-2024 02:08                4542
imagick.trimimage.php                              29-May-2024 02:08                5687
imagick.uniqueimagecolors.php                      29-May-2024 02:08                5492
imagick.unsharpmaskimage.php                       29-May-2024 02:08                6708
imagick.valid.php                                  29-May-2024 02:08                2261
imagick.vignetteimage.php                          29-May-2024 02:08                6574
imagick.waveimage.php                              29-May-2024 02:08                6295
imagick.whitethresholdimage.php                    29-May-2024 02:08                5205
imagick.writeimage.php                             29-May-2024 02:08                3009
imagick.writeimagefile.php                         29-May-2024 02:08                3749
imagick.writeimages.php                            29-May-2024 02:08                2890
imagick.writeimagesfile.php                        29-May-2024 02:08                3799
imagickdraw.affine.php                             29-May-2024 02:08               16896
imagickdraw.annotation.php                         29-May-2024 02:08                3297
imagickdraw.arc.php                                29-May-2024 02:08                9613
imagickdraw.bezier.php                             29-May-2024 02:08               16786
imagickdraw.circle.php                             29-May-2024 02:08                9008
imagickdraw.clear.php                              29-May-2024 02:08                2334
imagickdraw.clone.php                              29-May-2024 02:08                2427
imagickdraw.color.php                              29-May-2024 02:08                3457
imagickdraw.comment.php                            29-May-2024 02:08                2683
imagickdraw.composite.php                          29-May-2024 02:08               11888
imagickdraw.construct.php                          29-May-2024 02:08                2202
imagickdraw.destroy.php                            29-May-2024 02:08                2303
imagickdraw.ellipse.php                            29-May-2024 02:08               12194
imagickdraw.getclippath.php                        29-May-2024 02:08                2302
imagickdraw.getcliprule.php                        29-May-2024 02:08                2423
imagickdraw.getclipunits.php                       29-May-2024 02:08                2367
imagickdraw.getfillcolor.php                       29-May-2024 02:08                2376
imagickdraw.getfillopacity.php                     29-May-2024 02:08                2336
imagickdraw.getfillrule.php                        29-May-2024 02:08                2385
imagickdraw.getfont.php                            29-May-2024 02:08                2269
imagickdraw.getfontfamily.php                      29-May-2024 02:08                2329
imagickdraw.getfontsize.php                        29-May-2024 02:08                2405
imagickdraw.getfontstretch.php                     29-May-2024 02:08                2375
imagickdraw.getfontstyle.php                       29-May-2024 02:08                2548
imagickdraw.getfontweight.php                      29-May-2024 02:08                2387
imagickdraw.getgravity.php                         29-May-2024 02:08                2453
imagickdraw.getstrokeantialias.php                 29-May-2024 02:08                2725
imagickdraw.getstrokecolor.php                     29-May-2024 02:08                2765
imagickdraw.getstrokedasharray.php                 29-May-2024 02:08                2463
imagickdraw.getstrokedashoffset.php                29-May-2024 02:08                2437
imagickdraw.getstrokelinecap.php                   29-May-2024 02:08                2578
imagickdraw.getstrokelinejoin.php                  29-May-2024 02:08                2607
imagickdraw.getstrokemiterlimit.php                29-May-2024 02:08                2699
imagickdraw.getstrokeopacity.php                   29-May-2024 02:08                2440
imagickdraw.getstrokewidth.php                     29-May-2024 02:08                2449
imagickdraw.gettextalignment.php                   29-May-2024 02:08                2469
imagickdraw.gettextantialias.php                   29-May-2024 02:08                2606
imagickdraw.gettextdecoration.php                  29-May-2024 02:08                2506
imagickdraw.gettextencoding.php                    29-May-2024 02:08                2431
imagickdraw.gettextinterlinespacing.php            29-May-2024 02:08                2412
imagickdraw.gettextinterwordspacing.php            29-May-2024 02:08                2436
imagickdraw.gettextkerning.php                     29-May-2024 02:08                2331
imagickdraw.gettextundercolor.php                  29-May-2024 02:08                2479
imagickdraw.getvectorgraphics.php                  29-May-2024 02:08                2529
imagickdraw.line.php                               29-May-2024 02:08                8307
imagickdraw.matte.php                              29-May-2024 02:08                8335
imagickdraw.pathclose.php                          29-May-2024 02:08                2426
imagickdraw.pathcurvetoabsolute.php                29-May-2024 02:08                4881
imagickdraw.pathcurvetoquadraticbezierabsolute.php 29-May-2024 02:08               11127
imagickdraw.pathcurvetoquadraticbezierrelative.php 29-May-2024 02:08                4262
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 29-May-2024 02:08               10316
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 29-May-2024 02:08               10418
imagickdraw.pathcurvetorelative.php                29-May-2024 02:08                4897
imagickdraw.pathcurvetosmoothabsolute.php          29-May-2024 02:08                4634
imagickdraw.pathcurvetosmoothrelative.php          29-May-2024 02:08                4641
imagickdraw.pathellipticarcabsolute.php            29-May-2024 02:08                5654
imagickdraw.pathellipticarcrelative.php            29-May-2024 02:08                5624
imagickdraw.pathfinish.php                         29-May-2024 02:08                2259
imagickdraw.pathlinetoabsolute.php                 29-May-2024 02:08                3187
imagickdraw.pathlinetohorizontalabsolute.php       29-May-2024 02:08                3037
imagickdraw.pathlinetohorizontalrelative.php       29-May-2024 02:08                3032
imagickdraw.pathlinetorelative.php                 29-May-2024 02:08                3237
imagickdraw.pathlinetoverticalabsolute.php         29-May-2024 02:08                3001
imagickdraw.pathlinetoverticalrelative.php         29-May-2024 02:08                3006
imagickdraw.pathmovetoabsolute.php                 29-May-2024 02:08                3234
imagickdraw.pathmovetorelative.php                 29-May-2024 02:08                3170
imagickdraw.pathstart.php                          29-May-2024 02:08               11756
imagickdraw.point.php                              29-May-2024 02:08                6841
imagickdraw.polygon.php                            29-May-2024 02:08                8924
imagickdraw.polyline.php                           29-May-2024 02:08                8928
imagickdraw.pop.php                                29-May-2024 02:08                2676
imagickdraw.popclippath.php                        29-May-2024 02:08                2218
imagickdraw.popdefs.php                            29-May-2024 02:08                7696
imagickdraw.poppattern.php                         29-May-2024 02:08                2409
imagickdraw.push.php                               29-May-2024 02:08                8422
imagickdraw.pushclippath.php                       29-May-2024 02:08                2910
imagickdraw.pushdefs.php                           29-May-2024 02:08                2517
imagickdraw.pushpattern.php                        29-May-2024 02:08               14588
imagickdraw.rectangle.php                          29-May-2024 02:08                8513
imagickdraw.render.php                             29-May-2024 02:08                2451
imagickdraw.resetvectorgraphics.php                29-May-2024 02:08                2419
imagickdraw.rotate.php                             29-May-2024 02:08                7708
imagickdraw.roundrectangle.php                     29-May-2024 02:08                9363
imagickdraw.scale.php                              29-May-2024 02:08                8054
imagickdraw.setclippath.php                        29-May-2024 02:08                8385
imagickdraw.setcliprule.php                        29-May-2024 02:08                9396
imagickdraw.setclipunits.php                       29-May-2024 02:08                8773
imagickdraw.setfillalpha.php                       29-May-2024 02:08                7729
imagickdraw.setfillcolor.php                       29-May-2024 02:08                7731
imagickdraw.setfillopacity.php                     29-May-2024 02:08                7787
imagickdraw.setfillpatternurl.php                  29-May-2024 02:08                3238
imagickdraw.setfillrule.php                        29-May-2024 02:08               12933
imagickdraw.setfont.php                            29-May-2024 02:08                9239
imagickdraw.setfontfamily.php                      29-May-2024 02:08                9851
imagickdraw.setfontsize.php                        29-May-2024 02:08                8235
imagickdraw.setfontstretch.php                     29-May-2024 02:08                9662
imagickdraw.setfontstyle.php                       29-May-2024 02:08                8952
imagickdraw.setfontweight.php                      29-May-2024 02:08                9103
imagickdraw.setgravity.php                         29-May-2024 02:08               10519
imagickdraw.setresolution.php                      29-May-2024 02:08                2915
imagickdraw.setstrokealpha.php                     29-May-2024 02:08                8389
imagickdraw.setstrokeantialias.php                 29-May-2024 02:08                8928
imagickdraw.setstrokecolor.php                     29-May-2024 02:08                8448
imagickdraw.setstrokedasharray.php                 29-May-2024 02:08               13369
imagickdraw.setstrokedashoffset.php                29-May-2024 02:08                9820
imagickdraw.setstrokelinecap.php                   29-May-2024 02:08                8536
imagickdraw.setstrokelinejoin.php                  29-May-2024 02:08               11422
imagickdraw.setstrokemiterlimit.php                29-May-2024 02:08               11239
imagickdraw.setstrokeopacity.php                   29-May-2024 02:08               10185
imagickdraw.setstrokepatternurl.php                29-May-2024 02:08                2934
imagickdraw.setstrokewidth.php                     29-May-2024 02:08                8420
imagickdraw.settextalignment.php                   29-May-2024 02:08                9401
imagickdraw.settextantialias.php                   29-May-2024 02:08                8815
imagickdraw.settextdecoration.php                  29-May-2024 02:08                7437
imagickdraw.settextencoding.php                    29-May-2024 02:08                3117
imagickdraw.settextinterlinespacing.php            29-May-2024 02:08                2909
imagickdraw.settextinterwordspacing.php            29-May-2024 02:08                2779
imagickdraw.settextkerning.php                     29-May-2024 02:08                2818
imagickdraw.settextundercolor.php                  29-May-2024 02:08                7753
imagickdraw.setvectorgraphics.php                  29-May-2024 02:08                8922
imagickdraw.setviewbox.php                         29-May-2024 02:08               10298
imagickdraw.skewx.php                              29-May-2024 02:08                8119
imagickdraw.skewy.php                              29-May-2024 02:08                8108
imagickdraw.translate.php                          29-May-2024 02:08                8446
imagickkernel.addkernel.php                        29-May-2024 02:08                7034
imagickkernel.addunitykernel.php                   29-May-2024 02:08               13670
imagickkernel.frombuiltin.php                      29-May-2024 02:08               26239
imagickkernel.frommatrix.php                       29-May-2024 02:08               23171
imagickkernel.getmatrix.php                        29-May-2024 02:08                7079
imagickkernel.scale.php                            29-May-2024 02:08               13201
imagickkernel.separate.php                         29-May-2024 02:08                9694
imagickpixel.clear.php                             29-May-2024 02:08                2364
imagickpixel.construct.php                         29-May-2024 02:08               11787
imagickpixel.destroy.php                           29-May-2024 02:08                2453
imagickpixel.getcolor.php                          29-May-2024 02:08                7871
imagickpixel.getcolorasstring.php                  29-May-2024 02:08                4840
imagickpixel.getcolorcount.php                     29-May-2024 02:08                4908
imagickpixel.getcolorquantum.php                   29-May-2024 02:08                2855
imagickpixel.getcolorvalue.php                     29-May-2024 02:08                8642
imagickpixel.getcolorvaluequantum.php              29-May-2024 02:08                6095
imagickpixel.gethsl.php                            29-May-2024 02:08                4343
imagickpixel.getindex.php                          29-May-2024 02:08                2278
imagickpixel.ispixelsimilar.php                    29-May-2024 02:08                3636
imagickpixel.ispixelsimilarquantum.php             29-May-2024 02:08                3242
imagickpixel.issimilar.php                         29-May-2024 02:08               16496
imagickpixel.setcolor.php                          29-May-2024 02:08                7465
imagickpixel.setcolorcount.php                     29-May-2024 02:08                2688
imagickpixel.setcolorvalue.php                     29-May-2024 02:08                5160
imagickpixel.setcolorvaluequantum.php              29-May-2024 02:08                8424
imagickpixel.sethsl.php                            29-May-2024 02:08                7516
imagickpixel.setindex.php                          29-May-2024 02:08                2617
imagickpixeliterator.clear.php                     29-May-2024 02:08                6275
imagickpixeliterator.construct.php                 29-May-2024 02:08                5948
imagickpixeliterator.destroy.php                   29-May-2024 02:08                2494
imagickpixeliterator.getcurrentiteratorrow.php     29-May-2024 02:08                2602
imagickpixeliterator.getiteratorrow.php            29-May-2024 02:08                2527
imagickpixeliterator.getnextiteratorrow.php        29-May-2024 02:08                6707
imagickpixeliterator.getpreviousiteratorrow.php    29-May-2024 02:08                2671
imagickpixeliterator.newpixeliterator.php          29-May-2024 02:08                2747
imagickpixeliterator.newpixelregioniterator.php    29-May-2024 02:08                4260
imagickpixeliterator.resetiterator.php             29-May-2024 02:08                8683
imagickpixeliterator.setiteratorfirstrow.php       29-May-2024 02:08                2588
imagickpixeliterator.setiteratorlastrow.php        29-May-2024 02:08                2581
imagickpixeliterator.setiteratorrow.php            29-May-2024 02:08                7086
imagickpixeliterator.synciterator.php              29-May-2024 02:08                2436
imap.configuration.php                             29-May-2024 02:08                3138
imap.constants.php                                 29-May-2024 02:08               24770
imap.installation.php                              29-May-2024 02:08                2587
imap.requirements.php                              29-May-2024 02:08                3018
imap.resources.php                                 29-May-2024 02:08                1388
imap.setup.php                                     29-May-2024 02:08                1549
index.php                                          29-May-2024 02:08               12976
indexes.examples.php                               29-May-2024 02:08              706195
indexes.functions.php                              29-May-2024 02:08             1141957
indexes.php                                        29-May-2024 02:08                1430
infiniteiterator.construct.php                     29-May-2024 02:08                5042
infiniteiterator.next.php                          29-May-2024 02:08                3282
info.configuration.php                             29-May-2024 02:08               12494
info.constants.php                                 29-May-2024 02:08               22744
info.installation.php                              29-May-2024 02:08                1194
info.requirements.php                              29-May-2024 02:08                1152
info.resources.php                                 29-May-2024 02:08                1172
info.setup.php                                     29-May-2024 02:08                1539
ini.core.php                                       29-May-2024 02:08               68531
ini.list.php                                       29-May-2024 02:08              105884
ini.php                                            29-May-2024 02:08                1551
ini.sections.php                                   29-May-2024 02:08                3859
inotify.configuration.php                          29-May-2024 02:08                1238
inotify.constants.php                              29-May-2024 02:08               10303
inotify.install.php                                29-May-2024 02:08                1673
inotify.requirements.php                           29-May-2024 02:08                1220
inotify.resources.php                              29-May-2024 02:08                1306
inotify.setup.php                                  29-May-2024 02:08                1576
install.cloud.azure.php                            29-May-2024 02:08                3786
install.cloud.digitalocean.php                     29-May-2024 02:08                2997
install.cloud.ec2.php                              29-May-2024 02:08                1419
install.cloud.php                                  29-May-2024 02:08                1684
install.fpm.configuration.php                      29-May-2024 02:08               33992
install.fpm.install.php                            29-May-2024 02:08                3307
install.fpm.php                                    29-May-2024 02:08                3634
install.general.php                                29-May-2024 02:08                3948
install.macosx.bundled.php                         29-May-2024 02:08                9956
install.macosx.compile.php                         29-May-2024 02:08                1342
install.macosx.packages.php                        29-May-2024 02:08                2838
install.macosx.php                                 29-May-2024 02:08                1883
install.pecl.downloads.php                         29-May-2024 02:08                3270
install.pecl.intro.php                             29-May-2024 02:08                2733
install.pecl.pear.php                              29-May-2024 02:08                2798
install.pecl.php                                   29-May-2024 02:08                1879
install.pecl.php-config.php                        29-May-2024 02:08                3845
install.pecl.phpize.php                            29-May-2024 02:08                2738
install.pecl.static.php                            29-May-2024 02:08                3207
install.pecl.windows.php                           29-May-2024 02:08                8403
install.php                                        29-May-2024 02:08                5334
install.problems.bugs.php                          29-May-2024 02:08                1850
install.problems.faq.php                           29-May-2024 02:08                1323
install.problems.php                               29-May-2024 02:08                1563
install.problems.support.php                       29-May-2024 02:08                2185
install.unix.apache2.php                           29-May-2024 02:08               11793
install.unix.commandline.php                       29-May-2024 02:08                3626
install.unix.debian.php                            29-May-2024 02:08                6187
install.unix.lighttpd-14.php                       29-May-2024 02:08                5758
install.unix.litespeed.php                         29-May-2024 02:08                8446
install.unix.nginx.php                             29-May-2024 02:08                8000
install.unix.openbsd.php                           29-May-2024 02:08                5579
install.unix.php                                   29-May-2024 02:08                7070
install.unix.solaris.php                           29-May-2024 02:08                3692
install.windows.apache2.php                        29-May-2024 02:08                6456
install.windows.building.php                       29-May-2024 02:08                1659
install.windows.commandline.php                    29-May-2024 02:08                7668
install.windows.manual.php                         29-May-2024 02:08                5444
install.windows.pecl.php                           29-May-2024 02:08                1602
install.windows.php                                29-May-2024 02:08                3073
install.windows.recommended.php                    29-May-2024 02:08                4584
install.windows.requirements.php                   29-May-2024 02:08                2210
install.windows.tools.php                          29-May-2024 02:08                1770
install.windows.troubleshooting.php                29-May-2024 02:08                1664
internaliterator.construct.php                     29-May-2024 02:08                1967
internaliterator.current.php                       29-May-2024 02:08                2259
internaliterator.key.php                           29-May-2024 02:08                2233
internaliterator.next.php                          29-May-2024 02:08                2245
internaliterator.rewind.php                        29-May-2024 02:08                2265
internaliterator.valid.php                         29-May-2024 02:08                2250
intl.configuration.php                             29-May-2024 02:08                5255
intl.constants.php                                 29-May-2024 02:08               69477
intl.examples.basic.php                            29-May-2024 02:08                4346
intl.examples.php                                  29-May-2024 02:08                1405
intl.installation.php                              29-May-2024 02:08                1736
intl.requirements.php                              29-May-2024 02:08                1345
intl.resources.php                                 29-May-2024 02:08                1172
intl.setup.php                                     29-May-2024 02:08                1547
intlbreakiterator.construct.php                    29-May-2024 02:08                4050
intlbreakiterator.createcharacterinstance.php      29-May-2024 02:08                3313
intlbreakiterator.createcodepointinstance.php      29-May-2024 02:08                2743
intlbreakiterator.createlineinstance.php           29-May-2024 02:08                3274
intlbreakiterator.createsentenceinstance.php       29-May-2024 02:08                3276
intlbreakiterator.createtitleinstance.php          29-May-2024 02:08                3256
intlbreakiterator.createwordinstance.php           29-May-2024 02:08                3210
intlbreakiterator.current.php                      29-May-2024 02:08                2432
intlbreakiterator.first.php                        29-May-2024 02:08                2416
intlbreakiterator.following.php                    29-May-2024 02:08                2731
intlbreakiterator.geterrorcode.php                 29-May-2024 02:08                2955
intlbreakiterator.geterrormessage.php              29-May-2024 02:08                3004
intlbreakiterator.getlocale.php                    29-May-2024 02:08                2841
intlbreakiterator.getpartsiterator.php             29-May-2024 02:08                3668
intlbreakiterator.gettext.php                      29-May-2024 02:08                2549
intlbreakiterator.isboundary.php                   29-May-2024 02:08                2701
intlbreakiterator.last.php                         29-May-2024 02:08                2415
intlbreakiterator.next.php                         29-May-2024 02:08                2865
intlbreakiterator.preceding.php                    29-May-2024 02:08                2709
intlbreakiterator.previous.php                     29-May-2024 02:08                2471
intlbreakiterator.settext.php                      29-May-2024 02:08                3560
intlcalendar.add.php                               29-May-2024 02:08                8816
intlcalendar.after.php                             29-May-2024 02:08                6822
intlcalendar.before.php                            29-May-2024 02:08                4210
intlcalendar.clear.php                             29-May-2024 02:08               19063
intlcalendar.construct.php                         29-May-2024 02:08                2338
intlcalendar.createinstance.php                    29-May-2024 02:08               13558
intlcalendar.equals.php                            29-May-2024 02:08               10917
intlcalendar.fielddifference.php                   29-May-2024 02:08               11342
intlcalendar.fromdatetime.php                      29-May-2024 02:08                8034
intlcalendar.get.php                               29-May-2024 02:08                8840
intlcalendar.getactualmaximum.php                  29-May-2024 02:08                8741
intlcalendar.getactualminimum.php                  29-May-2024 02:08                5937
intlcalendar.getavailablelocales.php               29-May-2024 02:08                4427
intlcalendar.getdayofweektype.php                  29-May-2024 02:08               10665
intlcalendar.geterrorcode.php                      29-May-2024 02:08                9131
intlcalendar.geterrormessage.php                   29-May-2024 02:08                6180
intlcalendar.getfirstdayofweek.php                 29-May-2024 02:08                8754
intlcalendar.getgreatestminimum.php                29-May-2024 02:08                4826
intlcalendar.getkeywordvaluesforlocale.php         29-May-2024 02:08                7516
intlcalendar.getleastmaximum.php                   29-May-2024 02:08                8388
intlcalendar.getlocale.php                         29-May-2024 02:08                6345
intlcalendar.getmaximum.php                        29-May-2024 02:08                5470
intlcalendar.getminimaldaysinfirstweek.php         29-May-2024 02:08                9053
intlcalendar.getminimum.php                        29-May-2024 02:08                4770
intlcalendar.getnow.php                            29-May-2024 02:08                5344
intlcalendar.getrepeatedwalltimeoption.php         29-May-2024 02:08               10327
intlcalendar.getskippedwalltimeoption.php          29-May-2024 02:08               12666
intlcalendar.gettime.php                           29-May-2024 02:08                6607
intlcalendar.gettimezone.php                       29-May-2024 02:08                7564
intlcalendar.gettype.php                           29-May-2024 02:08                5749
intlcalendar.getweekendtransition.php              29-May-2024 02:08                5432
intlcalendar.indaylighttime.php                    29-May-2024 02:08                8746
intlcalendar.isequivalentto.php                    29-May-2024 02:08                8488
intlcalendar.islenient.php                         29-May-2024 02:08                8395
intlcalendar.isset.php                             29-May-2024 02:08                4862
intlcalendar.isweekend.php                         29-May-2024 02:08                8988
intlcalendar.roll.php                              29-May-2024 02:08                9524
intlcalendar.set.php                               29-May-2024 02:08               16032
intlcalendar.setdate.php                           29-May-2024 02:08                4864
intlcalendar.setdatetime.php                       29-May-2024 02:08                6787
intlcalendar.setfirstdayofweek.php                 29-May-2024 02:08                8889
intlcalendar.setlenient.php                        29-May-2024 02:08                5089
intlcalendar.setminimaldaysinfirstweek.php         29-May-2024 02:08                5433
intlcalendar.setrepeatedwalltimeoption.php         29-May-2024 02:08                6551
intlcalendar.setskippedwalltimeoption.php          29-May-2024 02:08                7418
intlcalendar.settime.php                           29-May-2024 02:08                8727
intlcalendar.settimezone.php                       29-May-2024 02:08               11298
intlcalendar.todatetime.php                        29-May-2024 02:08                7173
intlchar.charage.php                               29-May-2024 02:08                5886
intlchar.chardigitvalue.php                        29-May-2024 02:08                5547
intlchar.chardirection.php                         29-May-2024 02:08               10708
intlchar.charfromname.php                          29-May-2024 02:08                7272
intlchar.charmirror.php                            29-May-2024 02:08                6565
intlchar.charname.php                              29-May-2024 02:08                7658
intlchar.chartype.php                              29-May-2024 02:08               11599
intlchar.chr.php                                   29-May-2024 02:08                5616
intlchar.digit.php                                 29-May-2024 02:08                8369
intlchar.enumcharnames.php                         29-May-2024 02:08                9079
intlchar.enumchartypes.php                         29-May-2024 02:08                5832
intlchar.foldcase.php                              29-May-2024 02:08                4101
intlchar.fordigit.php                              29-May-2024 02:08                7099
intlchar.getbidipairedbracket.php                  29-May-2024 02:08                6325
intlchar.getblockcode.php                          29-May-2024 02:08                5612
intlchar.getcombiningclass.php                     29-May-2024 02:08                4956
intlchar.getfc-nfkc-closure.php                    29-May-2024 02:08                4977
intlchar.getintpropertymaxvalue.php                29-May-2024 02:08                6376
intlchar.getintpropertyminvalue.php                29-May-2024 02:08                6369
intlchar.getintpropertyvalue.php                   29-May-2024 02:08                8080
intlchar.getnumericvalue.php                       29-May-2024 02:08                5662
intlchar.getpropertyenum.php                       29-May-2024 02:08                6723
intlchar.getpropertyname.php                       29-May-2024 02:08                9074
intlchar.getpropertyvalueenum.php                  29-May-2024 02:08                7980
intlchar.getpropertyvaluename.php                  29-May-2024 02:08               10895
intlchar.getunicodeversion.php                     29-May-2024 02:08                3951
intlchar.hasbinaryproperty.php                     29-May-2024 02:08                9041
intlchar.isalnum.php                               29-May-2024 02:08                5971
intlchar.isalpha.php                               29-May-2024 02:08                5850
intlchar.isbase.php                                29-May-2024 02:08                6176
intlchar.isblank.php                               29-May-2024 02:08                6842
intlchar.iscntrl.php                               29-May-2024 02:08                6922
intlchar.isdefined.php                             29-May-2024 02:08                6853
intlchar.isdigit.php                               29-May-2024 02:08                6173
intlchar.isgraph.php                               29-May-2024 02:08                6110
intlchar.isidignorable.php                         29-May-2024 02:08                6385
intlchar.isidpart.php                              29-May-2024 02:08                7026
intlchar.isidstart.php                             29-May-2024 02:08                6455
intlchar.isisocontrol.php                          29-May-2024 02:08                5662
intlchar.isjavaidpart.php                          29-May-2024 02:08                6947
intlchar.isjavaidstart.php                         29-May-2024 02:08                6677
intlchar.isjavaspacechar.php                       29-May-2024 02:08                6910
intlchar.islower.php                               29-May-2024 02:08                7326
intlchar.ismirrored.php                            29-May-2024 02:08                5786
intlchar.isprint.php                               29-May-2024 02:08                6247
intlchar.ispunct.php                               29-May-2024 02:08                5884
intlchar.isspace.php                               29-May-2024 02:08                6655
intlchar.istitle.php                               29-May-2024 02:08                7552
intlchar.isualphabetic.php                         29-May-2024 02:08                5999
intlchar.isulowercase.php                          29-May-2024 02:08                7031
intlchar.isupper.php                               29-May-2024 02:08                7324
intlchar.isuuppercase.php                          29-May-2024 02:08                7069
intlchar.isuwhitespace.php                         29-May-2024 02:08                7491
intlchar.iswhitespace.php                          29-May-2024 02:08                7384
intlchar.isxdigit.php                              29-May-2024 02:08                7243
intlchar.ord.php                                   29-May-2024 02:08                5468
intlchar.tolower.php                               29-May-2024 02:08                7731
intlchar.totitle.php                               29-May-2024 02:08                7882
intlchar.toupper.php                               29-May-2024 02:08                7623
intlcodepointbreakiterator.getlastcodepoint.php    29-May-2024 02:08                2674
intldateformatter.create.php                       29-May-2024 02:08               29255
intldateformatter.format.php                       29-May-2024 02:08               26568
intldateformatter.formatobject.php                 29-May-2024 02:08               14665
intldateformatter.getcalendar.php                  29-May-2024 02:08               11133
intldateformatter.getcalendarobject.php            29-May-2024 02:08                7639
intldateformatter.getdatetype.php                  29-May-2024 02:08               11591
intldateformatter.geterrorcode.php                 29-May-2024 02:08                8555
intldateformatter.geterrormessage.php              29-May-2024 02:08                8533
intldateformatter.getlocale.php                    29-May-2024 02:08               12263
intldateformatter.getpattern.php                   29-May-2024 02:08               10316
intldateformatter.gettimetype.php                  29-May-2024 02:08               11585
intldateformatter.gettimezone.php                  29-May-2024 02:08                8641
intldateformatter.gettimezoneid.php                29-May-2024 02:08                8873
intldateformatter.islenient.php                    29-May-2024 02:08               14678
intldateformatter.localtime.php                    29-May-2024 02:08               11537
intldateformatter.parse.php                        29-May-2024 02:08               12402
intldateformatter.setcalendar.php                  29-May-2024 02:08               14414
intldateformatter.setlenient.php                   29-May-2024 02:08               15519
intldateformatter.setpattern.php                   29-May-2024 02:08               11542
intldateformatter.settimezone.php                  29-May-2024 02:08               12511
intldatepatterngenerator.create.php                29-May-2024 02:08                4407
intldatepatterngenerator.getbestpattern.php        29-May-2024 02:08                6904
intlgregoriancalendar.construct.php                29-May-2024 02:08                5634
intlgregoriancalendar.createfromdate.php           29-May-2024 02:08                7391
intlgregoriancalendar.createfromdatetime.php       29-May-2024 02:08                9100
intlgregoriancalendar.getgregorianchange.php       29-May-2024 02:08                2654
intlgregoriancalendar.isleapyear.php               29-May-2024 02:08                3033
intlgregoriancalendar.setgregorianchange.php       29-May-2024 02:08                3055
intliterator.current.php                           29-May-2024 02:08                2306
intliterator.key.php                               29-May-2024 02:08                2275
intliterator.next.php                              29-May-2024 02:08                2291
intliterator.rewind.php                            29-May-2024 02:08                2319
intliterator.valid.php                             29-May-2024 02:08                2292
intlpartsiterator.getbreakiterator.php             29-May-2024 02:08                2517
intlrulebasedbreakiterator.construct.php           29-May-2024 02:08                3167
intlrulebasedbreakiterator.getbinaryrules.php      29-May-2024 02:08                2774
intlrulebasedbreakiterator.getrules.php            29-May-2024 02:08                2738
intlrulebasedbreakiterator.getrulestatus.php       29-May-2024 02:08                2710
intlrulebasedbreakiterator.getrulestatusvec.php    29-May-2024 02:08                2832
intltimezone.construct.php                         29-May-2024 02:08                1979
intltimezone.countequivalentids.php                29-May-2024 02:08                3649
intltimezone.createdefault.php                     29-May-2024 02:08                2962
intltimezone.createenumeration.php                 29-May-2024 02:08                4735
intltimezone.createtimezone.php                    29-May-2024 02:08                3625
intltimezone.createtimezoneidenumeration.php       29-May-2024 02:08                5810
intltimezone.fromdatetimezone.php                  29-May-2024 02:08                3746
intltimezone.getcanonicalid.php                    29-May-2024 02:08                4372
intltimezone.getdisplayname.php                    29-May-2024 02:08                5553
intltimezone.getdstsavings.php                     29-May-2024 02:08                3094
intltimezone.getequivalentid.php                   29-May-2024 02:08                4055
intltimezone.geterrorcode.php                      29-May-2024 02:08                3266
intltimezone.geterrormessage.php                   29-May-2024 02:08                3294
intltimezone.getgmt.php                            29-May-2024 02:08                2811
intltimezone.getid.php                             29-May-2024 02:08                3146
intltimezone.getidforwindowsid.php                 29-May-2024 02:08                5803
intltimezone.getoffset.php                         29-May-2024 02:08                5073
intltimezone.getrawoffset.php                      29-May-2024 02:08                3045
intltimezone.getregion.php                         29-May-2024 02:08                3651
intltimezone.gettzdataversion.php                  29-May-2024 02:08                3185
intltimezone.getunknown.php                        29-May-2024 02:08                3077
intltimezone.getwindowsid.php                      29-May-2024 02:08                4388
intltimezone.hassamerules.php                      29-May-2024 02:08                3487
intltimezone.todatetimezone.php                    29-May-2024 02:08                3395
intltimezone.usedaylighttime.php                   29-May-2024 02:08                3071
intro-whatcando.php                                29-May-2024 02:08                7525
intro-whatis.php                                   29-May-2024 02:08                4019
intro.apache.php                                   29-May-2024 02:08                1160
intro.apcu.php                                     29-May-2024 02:08                1807
intro.array.php                                    29-May-2024 02:08                1795
intro.bc.php                                       29-May-2024 02:08                4462
intro.bzip2.php                                    29-May-2024 02:08                1157
intro.calendar.php                                 29-May-2024 02:08                1923
intro.classobj.php                                 29-May-2024 02:08                1614
intro.cmark.php                                    29-May-2024 02:08                7336
intro.com.php                                      29-May-2024 02:08                2838
intro.componere.php                                29-May-2024 02:08                6662
intro.ctype.php                                    29-May-2024 02:08                3620
intro.cubrid.php                                   29-May-2024 02:08                1463
intro.curl.php                                     29-May-2024 02:08                1474
intro.datetime.php                                 29-May-2024 02:08                2441
intro.dba.php                                      29-May-2024 02:08                1489
intro.dbase.php                                    29-May-2024 02:08                6746
intro.dio.php                                      29-May-2024 02:08                1596
intro.dom.php                                      29-May-2024 02:08                1666
intro.ds.php                                       29-May-2024 02:08                1412
intro.eio.php                                      29-May-2024 02:08               14352
intro.enchant.php                                  29-May-2024 02:08                2602
intro.errorfunc.php                                29-May-2024 02:08                1739
intro.ev.php                                       29-May-2024 02:08                2253
intro.event.php                                    29-May-2024 02:08                1876
intro.exec.php                                     29-May-2024 02:08                1716
intro.exif.php                                     29-May-2024 02:08                1421
intro.expect.php                                   29-May-2024 02:08                1423
intro.fann.php                                     29-May-2024 02:08                1343
intro.fdf.php                                      29-May-2024 02:08                3818
intro.ffi.php                                      29-May-2024 02:08                2537
intro.fileinfo.php                                 29-May-2024 02:08                1358
intro.filesystem.php                               29-May-2024 02:08                1381
intro.filter.php                                   29-May-2024 02:08                2665
intro.fpm.php                                      29-May-2024 02:08                1287
intro.ftp.php                                      29-May-2024 02:08                1668
intro.funchand.php                                 29-May-2024 02:08                1170
intro.gearman.php                                  29-May-2024 02:08                1653
intro.gender.php                                   29-May-2024 02:08                1321
intro.geoip.php                                    29-May-2024 02:08                1494
intro.gettext.php                                  29-May-2024 02:08                1485
intro.gmagick.php                                  29-May-2024 02:08                1683
intro.gmp.php                                      29-May-2024 02:08                2994
intro.gnupg.php                                    29-May-2024 02:08                1210
intro.hash.php                                     29-May-2024 02:08                1193
intro.hrtime.php                                   29-May-2024 02:08                1655
intro.ibase.php                                    29-May-2024 02:08                3145
intro.ibm-db2.php                                  29-May-2024 02:08                1270
intro.iconv.php                                    29-May-2024 02:08                1811
intro.igbinary.php                                 29-May-2024 02:08                1665
intro.image.php                                    29-May-2024 02:08                6858
intro.imagick.php                                  29-May-2024 02:08                1733
intro.imap.php                                     29-May-2024 02:08                1610
intro.info.php                                     29-May-2024 02:08                1447
intro.inotify.php                                  29-May-2024 02:08                2373
intro.intl.php                                     29-May-2024 02:08                5004
intro.json.php                                     29-May-2024 02:08                1573
intro.ldap.php                                     29-May-2024 02:08                4070
intro.libxml.php                                   29-May-2024 02:08                1762
intro.lua.php                                      29-May-2024 02:08                1250
intro.luasandbox.php                               29-May-2024 02:08                2355
intro.lzf.php                                      29-May-2024 02:08                1411
intro.mail.php                                     29-May-2024 02:08                1197
intro.mailparse.php                                29-May-2024 02:08                1929
intro.math.php                                     29-May-2024 02:08                1901
intro.mbstring.php                                 29-May-2024 02:08                2654
intro.mcrypt.php                                   29-May-2024 02:08                2210
intro.memcache.php                                 29-May-2024 02:08                1653
intro.memcached.php                                29-May-2024 02:08                1893
intro.mhash.php                                    29-May-2024 02:08                2832
intro.misc.php                                     29-May-2024 02:08                1151
intro.mqseries.php                                 29-May-2024 02:08                1734
intro.mysql-xdevapi.php                            29-May-2024 02:08                1870
intro.mysql.php                                    29-May-2024 02:08                1885
intro.mysqli.php                                   29-May-2024 02:08                2049
intro.mysqlnd.php                                  29-May-2024 02:08                1945
intro.network.php                                  29-May-2024 02:08                1139
intro.oauth.php                                    29-May-2024 02:08                1291
intro.oci8.php                                     29-May-2024 02:08                1387
intro.opcache.php                                  29-May-2024 02:08                1578
intro.openal.php                                   29-May-2024 02:08                1243
intro.openssl.php                                  29-May-2024 02:08                1477
intro.outcontrol.php                               29-May-2024 02:08                1720
intro.parallel.php                                 29-May-2024 02:08                6481
intro.parle.php                                    29-May-2024 02:08                3429
intro.password.php                                 29-May-2024 02:08                1364
intro.pcntl.php                                    29-May-2024 02:08                2355
intro.pcre.php                                     29-May-2024 02:08                2465
intro.pdo.php                                      29-May-2024 02:08                1891
intro.pgsql.php                                    29-May-2024 02:08                1495
intro.phar.php                                     29-May-2024 02:08                9160
intro.phpdbg.php                                   29-May-2024 02:08                6031
intro.posix.php                                    29-May-2024 02:08                1701
intro.ps.php                                       29-May-2024 02:08                1752
intro.pspell.php                                   29-May-2024 02:08                1185
intro.pthreads.php                                 29-May-2024 02:08                9479
intro.quickhash.php                                29-May-2024 02:08                1257
intro.radius.php                                   29-May-2024 02:08                2157
intro.random.php                                   29-May-2024 02:08                1099
intro.rar.php                                      29-May-2024 02:08                1531
intro.readline.php                                 29-May-2024 02:08                1852
intro.recode.php                                   29-May-2024 02:08                2245
intro.reflection.php                               29-May-2024 02:08                1655
intro.rnp.php                                      29-May-2024 02:08                1270
intro.rpminfo.php                                  29-May-2024 02:08                1387
intro.rrd.php                                      29-May-2024 02:08                1365
intro.runkit7.php                                  29-May-2024 02:08                1469
intro.scoutapm.php                                 29-May-2024 02:08                1446
intro.seaslog.php                                  29-May-2024 02:08                3418
intro.sem.php                                      29-May-2024 02:08                3215
intro.session.php                                  29-May-2024 02:08                4645
intro.shmop.php                                    29-May-2024 02:08                1231
intro.simdjson.php                                 29-May-2024 02:08                1219
intro.simplexml.php                                29-May-2024 02:08                1273
intro.snmp.php                                     29-May-2024 02:08                1565
intro.soap.php                                     29-May-2024 02:08                1433
intro.sockets.php                                  29-May-2024 02:08                2364
intro.sodium.php                                   29-May-2024 02:08                1320
intro.solr.php                                     29-May-2024 02:08                1645
intro.spl.php                                      29-May-2024 02:08                1490
intro.sqlite3.php                                  29-May-2024 02:08                1140
intro.sqlsrv.php                                   29-May-2024 02:08                2156
intro.ssdeep.php                                   29-May-2024 02:08                1749
intro.ssh2.php                                     29-May-2024 02:08                1331
intro.stats.php                                    29-May-2024 02:08                1501
intro.stomp.php                                    29-May-2024 02:08                1334
intro.stream.php                                   29-May-2024 02:08                3650
intro.strings.php                                  29-May-2024 02:08                1580
intro.svm.php                                      29-May-2024 02:08                1215
intro.svn.php                                      29-May-2024 02:08                1689
intro.swoole.php                                   29-May-2024 02:08                1619
intro.sync.php                                     29-May-2024 02:08                2344
intro.taint.php                                    29-May-2024 02:08                4266
intro.tcpwrap.php                                  29-May-2024 02:08                1263
intro.tidy.php                                     29-May-2024 02:08                1399
intro.tokenizer.php                                29-May-2024 02:08                1422
intro.trader.php                                   29-May-2024 02:08                2378
intro.ui.php                                       29-May-2024 02:08                1191
intro.uodbc.php                                    29-May-2024 02:08                2748
intro.uopz.php                                     29-May-2024 02:08                2273
intro.url.php                                      29-May-2024 02:08                1124
intro.v8js.php                                     29-May-2024 02:08                1218
intro.var.php                                      29-May-2024 02:08                1260
intro.var_representation.php                       29-May-2024 02:08                1419
intro.varnish.php                                  29-May-2024 02:08                1308
intro.wddx.php                                     29-May-2024 02:08                2135
intro.win32service.php                             29-May-2024 02:08                1391
intro.wincache.php                                 29-May-2024 02:08                4880
intro.wkhtmltox.php                                29-May-2024 02:08                1267
intro.xattr.php                                    29-May-2024 02:08                1180
intro.xdiff.php                                    29-May-2024 02:08                2602
intro.xhprof.php                                   29-May-2024 02:08                2531
intro.xlswriter.php                                29-May-2024 02:08                1180
intro.xml.php                                      29-May-2024 02:08                2185
intro.xmldiff.php                                  29-May-2024 02:08                1401
intro.xmlreader.php                                29-May-2024 02:08                1575
intro.xmlrpc.php                                   29-May-2024 02:08                1801
intro.xmlwriter.php                                29-May-2024 02:08                1539
intro.xsl.php                                      29-May-2024 02:08                1328
intro.yac.php                                      29-May-2024 02:08                1192
intro.yaconf.php                                   29-May-2024 02:08                2537
intro.yaf.php                                      29-May-2024 02:08                1505
intro.yaml.php                                     29-May-2024 02:08                1371
intro.yar.php                                      29-May-2024 02:08                1328
intro.yaz.php                                      29-May-2024 02:08                2493
intro.zip.php                                      29-May-2024 02:08                1152
intro.zlib.php                                     29-May-2024 02:08                1642
intro.zmq.php                                      29-May-2024 02:08                1346
intro.zookeeper.php                                29-May-2024 02:08                1438
introduction.php                                   29-May-2024 02:08                1440
iterator.current.php                               29-May-2024 02:08                2128
iterator.key.php                                   29-May-2024 02:08                2505
iterator.next.php                                  29-May-2024 02:08                2373
iterator.rewind.php                                29-May-2024 02:08                2551
iterator.valid.php                                 29-May-2024 02:08                2720
iteratoraggregate.getiterator.php                  29-May-2024 02:08                2825
iteratoriterator.construct.php                     29-May-2024 02:08                3453
iteratoriterator.current.php                       29-May-2024 02:08                2707
iteratoriterator.getinneriterator.php              29-May-2024 02:08                3154
iteratoriterator.key.php                           29-May-2024 02:08                2655
iteratoriterator.next.php                          29-May-2024 02:08                2809
iteratoriterator.rewind.php                        29-May-2024 02:08                2828
iteratoriterator.valid.php                         29-May-2024 02:08                3026
json.configuration.php                             29-May-2024 02:08                1215
json.constants.php                                 29-May-2024 02:08               16271
json.installation.php                              29-May-2024 02:08                1686
json.requirements.php                              29-May-2024 02:08                1184
json.resources.php                                 29-May-2024 02:08                1172
json.setup.php                                     29-May-2024 02:08                1519
jsonserializable.jsonserialize.php                 29-May-2024 02:08               12441
langref.php                                        29-May-2024 02:08               19788
language.attributes.classes.php                    29-May-2024 02:08                6290
language.attributes.overview.php                   29-May-2024 02:08                9869
language.attributes.php                            29-May-2024 02:08                1682
language.attributes.reflection.php                 29-May-2024 02:08                7906
language.attributes.syntax.php                     29-May-2024 02:08                5902
language.basic-syntax.comments.php                 29-May-2024 02:08                3711
language.basic-syntax.instruction-separation.php   29-May-2024 02:08                3908
language.basic-syntax.php                          29-May-2024 02:08                1649
language.basic-syntax.phpmode.php                  29-May-2024 02:08                4255
language.basic-syntax.phptags.php                  29-May-2024 02:08                4565
language.constants.magic.php                       29-May-2024 02:08                5132
language.constants.php                             29-May-2024 02:08                5929
language.constants.predefined.php                  29-May-2024 02:08                1488
language.constants.syntax.php                      29-May-2024 02:08                9913
language.control-structures.php                    29-May-2024 02:08                2740
language.enumerations.backed.php                   29-May-2024 02:08                9494
language.enumerations.basics.php                   29-May-2024 02:08                7913
language.enumerations.constants.php                29-May-2024 02:08                2340
language.enumerations.examples.php                 29-May-2024 02:08                7193
language.enumerations.expressions.php              29-May-2024 02:08                6435
language.enumerations.listing.php                  29-May-2024 02:08                2226
language.enumerations.methods.php                  29-May-2024 02:08               13374
language.enumerations.object-differences.inheri..> 29-May-2024 02:08                5882
language.enumerations.object-differences.php       29-May-2024 02:08                4545
language.enumerations.overview.php                 29-May-2024 02:08                2210
language.enumerations.php                          29-May-2024 02:08                2370
language.enumerations.serialization.php            29-May-2024 02:08                4743
language.enumerations.static-methods.php           29-May-2024 02:08                3170
language.enumerations.traits.php                   29-May-2024 02:08                4254
language.errors.basics.php                         29-May-2024 02:08                4560
language.errors.php                                29-May-2024 02:08                1823
language.errors.php7.php                           29-May-2024 02:08                5823
language.exceptions.extending.php                  29-May-2024 02:08               19494
language.exceptions.php                            29-May-2024 02:08               26546
language.expressions.php                           29-May-2024 02:08               13724
language.fibers.php                                29-May-2024 02:08                6143
language.functions.php                             29-May-2024 02:08                1905
language.generators.comparison.php                 29-May-2024 02:08                8762
language.generators.overview.php                   29-May-2024 02:08                8858
language.generators.php                            29-May-2024 02:08                1580
language.generators.syntax.php                     29-May-2024 02:08               23350
language.namespaces.basics.php                     29-May-2024 02:08               10721
language.namespaces.definition.php                 29-May-2024 02:08                4132
language.namespaces.definitionmultiple.php         29-May-2024 02:08                8965
language.namespaces.dynamic.php                    29-May-2024 02:08                7999
language.namespaces.fallback.php                   29-May-2024 02:08                5870
language.namespaces.faq.php                        29-May-2024 02:08               30303
language.namespaces.global.php                     29-May-2024 02:08                2683
language.namespaces.importing.php                  29-May-2024 02:08               14451
language.namespaces.nested.php                     29-May-2024 02:08                2756
language.namespaces.nsconstants.php                29-May-2024 02:08                8537
language.namespaces.php                            29-May-2024 02:08                2298
language.namespaces.rationale.php                  29-May-2024 02:08                6002
language.namespaces.rules.php                      29-May-2024 02:08               11677
language.oop5.abstract.php                         29-May-2024 02:08               10684
language.oop5.anonymous.php                        29-May-2024 02:08               10219
language.oop5.autoload.php                         29-May-2024 02:08                6259
language.oop5.basic.php                            29-May-2024 02:08               46718
language.oop5.changelog.php                        29-May-2024 02:08               12277
language.oop5.cloning.php                          29-May-2024 02:08                8683
language.oop5.constants.php                        29-May-2024 02:08                8749
language.oop5.decon.php                            29-May-2024 02:08               26614
language.oop5.final.php                            29-May-2024 02:08                5899
language.oop5.inheritance.php                      29-May-2024 02:08               12250
language.oop5.interfaces.php                       29-May-2024 02:08               21944
language.oop5.iterations.php                       29-May-2024 02:08                5696
language.oop5.late-static-bindings.php             29-May-2024 02:08               13866
language.oop5.magic.php                            29-May-2024 02:08               43650
language.oop5.object-comparison.php                29-May-2024 02:08                8632
language.oop5.overloading.php                      29-May-2024 02:08               23155
language.oop5.paamayim-nekudotayim.php             29-May-2024 02:08                8138
language.oop5.php                                  29-May-2024 02:08                3226
language.oop5.properties.php                       29-May-2024 02:08               26237
language.oop5.references.php                       29-May-2024 02:08                5605
language.oop5.serialization.php                    29-May-2024 02:08                6605
language.oop5.static.php                           29-May-2024 02:08                8907
language.oop5.traits.php                           29-May-2024 02:08               33917
language.oop5.variance.php                         29-May-2024 02:08               15365
language.oop5.visibility.php                       29-May-2024 02:08               24535
language.operators.arithmetic.php                  29-May-2024 02:08                5567
language.operators.array.php                       29-May-2024 02:08                8731
language.operators.assignment.php                  29-May-2024 02:08               10398
language.operators.bitwise.php                     29-May-2024 02:08               42560
language.operators.comparison.php                  29-May-2024 02:08               40497
language.operators.errorcontrol.php                29-May-2024 02:08                5510
language.operators.execution.php                   29-May-2024 02:08                3135
language.operators.increment.php                   29-May-2024 02:08               13315
language.operators.logical.php                     29-May-2024 02:08                7559
language.operators.php                             29-May-2024 02:08                3554
language.operators.precedence.php                  29-May-2024 02:08               18518
language.operators.string.php                      29-May-2024 02:08                3032
language.operators.type.php                        29-May-2024 02:08               17731
language.references.arent.php                      29-May-2024 02:08                3056
language.references.pass.php                       29-May-2024 02:08                6327
language.references.php                            29-May-2024 02:08                1859
language.references.return.php                     29-May-2024 02:08                6642
language.references.spot.php                       29-May-2024 02:08                2584
language.references.unset.php                      29-May-2024 02:08                2190
language.references.whatare.php                    29-May-2024 02:08                1849
language.references.whatdo.php                     29-May-2024 02:08               17548
language.types.array.php                           29-May-2024 02:08               98270
language.types.boolean.php                         29-May-2024 02:08                9541
language.types.callable.php                        29-May-2024 02:08               11746
language.types.declarations.php                    29-May-2024 02:08               41078
language.types.enumerations.php                    29-May-2024 02:08                3566
language.types.float.php                           29-May-2024 02:08                8557
language.types.integer.php                         29-May-2024 02:08               20256
language.types.intro.php                           29-May-2024 02:08                5797
language.types.iterable.php                        29-May-2024 02:08                2925
language.types.mixed.php                           29-May-2024 02:08                1705
language.types.never.php                           29-May-2024 02:08                1904
language.types.null.php                            29-May-2024 02:08                3522
language.types.numeric-strings.php                 29-May-2024 02:08               10762
language.types.object.php                          29-May-2024 02:08                5350
language.types.php                                 29-May-2024 02:08                2824
language.types.relative-class-types.php            29-May-2024 02:08                2319
language.types.resource.php                        29-May-2024 02:08                2703
language.types.string.php                          29-May-2024 02:08               76367
language.types.type-juggling.php                   29-May-2024 02:08               25469
language.types.type-system.php                     29-May-2024 02:08                8059
language.types.value.php                           29-May-2024 02:08                2141
language.types.void.php                            29-May-2024 02:08                1913
language.variables.basics.php                      29-May-2024 02:08               12966
language.variables.external.php                    29-May-2024 02:08               17536
language.variables.php                             29-May-2024 02:08                1700
language.variables.predefined.php                  29-May-2024 02:08                2648
language.variables.scope.php                       29-May-2024 02:08               26472
language.variables.superglobals.php                29-May-2024 02:08                4125
language.variables.variable.php                    29-May-2024 02:08                9656
ldap.configuration.php                             29-May-2024 02:08                2317
ldap.constants.php                                 29-May-2024 02:08               32746
ldap.controls.php                                  29-May-2024 02:08                9923
ldap.examples-basic.php                            29-May-2024 02:08                8116
ldap.examples-controls.php                         29-May-2024 02:08               15985
ldap.examples.php                                  29-May-2024 02:08                1429
ldap.installation.php                              29-May-2024 02:08                2649
ldap.requirements.php                              29-May-2024 02:08                1500
ldap.resources.php                                 29-May-2024 02:08                1401
ldap.setup.php                                     29-May-2024 02:08                1546
ldap.using.php                                     29-May-2024 02:08                2244
libxml.configuration.php                           29-May-2024 02:08                1265
libxml.constants.php                               29-May-2024 02:08               13534
libxml.installation.php                            29-May-2024 02:08                1918
libxml.installation_old.php                        29-May-2024 02:08                2603
libxml.requirements.php                            29-May-2024 02:08                1337
libxml.resources.php                               29-May-2024 02:08                1186
libxml.setup.php                                   29-May-2024 02:08                1690
limititerator.construct.php                        29-May-2024 02:08                7290
limititerator.current.php                          29-May-2024 02:08                3540
limititerator.getposition.php                      29-May-2024 02:08                5709
limititerator.key.php                              29-May-2024 02:08                3590
limititerator.next.php                             29-May-2024 02:08                3267
limititerator.rewind.php                           29-May-2024 02:08                3435
limititerator.seek.php                             29-May-2024 02:08                4114
limititerator.valid.php                            29-May-2024 02:08                3497
locale.acceptfromhttp.php                          29-May-2024 02:08                6194
locale.canonicalize.php                            29-May-2024 02:08                3139
locale.composelocale.php                           29-May-2024 02:08               13404
locale.filtermatches.php                           29-May-2024 02:08                9249
locale.getallvariants.php                          29-May-2024 02:08                6647
locale.getdefault.php                              29-May-2024 02:08                5827
locale.getdisplaylanguage.php                      29-May-2024 02:08                9850
locale.getdisplayname.php                          29-May-2024 02:08                9832
locale.getdisplayregion.php                        29-May-2024 02:08                9798
locale.getdisplayscript.php                        29-May-2024 02:08                9805
locale.getdisplayvariant.php                       29-May-2024 02:08                9844
locale.getkeywords.php                             29-May-2024 02:08                7259
locale.getprimarylanguage.php                      29-May-2024 02:08                6048
locale.getregion.php                               29-May-2024 02:08                5989
locale.getscript.php                               29-May-2024 02:08                5670
locale.lookup.php                                  29-May-2024 02:08               10132
locale.parselocale.php                             29-May-2024 02:08                7373
locale.setdefault.php                              29-May-2024 02:08                5337
lua.assign.php                                     29-May-2024 02:08                4578
lua.call.php                                       29-May-2024 02:08                7433
lua.configuration.php                              29-May-2024 02:08                1208
lua.construct.php                                  29-May-2024 02:08                2375
lua.eval.php                                       29-May-2024 02:08                3713
lua.getversion.php                                 29-May-2024 02:08                2231
lua.include.php                                    29-May-2024 02:08                2674
lua.installation.php                               29-May-2024 02:08                1901
lua.registercallback.php                           29-May-2024 02:08                4547
lua.requirements.php                               29-May-2024 02:08                1233
lua.resources.php                                  29-May-2024 02:08                1175
lua.setup.php                                      29-May-2024 02:08                1506
luaclosure.invoke.php                              29-May-2024 02:08                4078
luasandbox.callfunction.php                        29-May-2024 02:08                5064
luasandbox.configuration.php                       29-May-2024 02:08                1257
luasandbox.disableprofiler.php                     29-May-2024 02:08                2853
luasandbox.enableprofiler.php                      29-May-2024 02:08                3509
luasandbox.examples-basic.php                      29-May-2024 02:08                6645
luasandbox.examples.php                            29-May-2024 02:08                1489
luasandbox.getcpuusage.php                         29-May-2024 02:08                3611
luasandbox.getmemoryusage.php                      29-May-2024 02:08                3189
luasandbox.getpeakmemoryusage.php                  29-May-2024 02:08                3239
luasandbox.getprofilerfunctionreport.php           29-May-2024 02:08                6009
luasandbox.getversioninfo.php                      29-May-2024 02:08                3106
luasandbox.installation.php                        29-May-2024 02:08                2041
luasandbox.loadbinary.php                          29-May-2024 02:08                3638
luasandbox.loadstring.php                          29-May-2024 02:08                5616
luasandbox.pauseusagetimer.php                     29-May-2024 02:08                9399
luasandbox.registerlibrary.php                     29-May-2024 02:08                6628
luasandbox.requirements.php                        29-May-2024 02:08                1749
luasandbox.resources.php                           29-May-2024 02:08                1240
luasandbox.setcpulimit.php                         29-May-2024 02:08                6120
luasandbox.setmemorylimit.php                      29-May-2024 02:08                5523
luasandbox.setup.php                               29-May-2024 02:08                1597
luasandbox.unpauseusagetimer.php                   29-May-2024 02:08                3149
luasandbox.wrapphpfunction.php                     29-May-2024 02:08                4376
luasandboxfunction.call.php                        29-May-2024 02:08                8044
luasandboxfunction.construct.php                   29-May-2024 02:08                2691
luasandboxfunction.dump.php                        29-May-2024 02:08                2447
lzf.configuration.php                              29-May-2024 02:08                1208
lzf.constants.php                                  29-May-2024 02:08                1138
lzf.installation.php                               29-May-2024 02:08                2349
lzf.requirements.php                               29-May-2024 02:08                1145
lzf.resources.php                                  29-May-2024 02:08                1165
lzf.setup.php                                      29-May-2024 02:08                1527
mail.configuration.php                             29-May-2024 02:08                7542
mail.constants.php                                 29-May-2024 02:08                1147
mail.installation.php                              29-May-2024 02:08                1194
mail.requirements.php                              29-May-2024 02:08                1828
mail.resources.php                                 29-May-2024 02:08                1172
mail.setup.php                                     29-May-2024 02:08                1542
mailparse.configuration.php                        29-May-2024 02:08                2431
mailparse.constants.php                            29-May-2024 02:08                2314
mailparse.installation.php                         29-May-2024 02:08                2416
mailparse.requirements.php                         29-May-2024 02:08                1187
mailparse.resources.php                            29-May-2024 02:08                1544
mailparse.setup.php                                29-May-2024 02:08                1605
manual.php                                         29-May-2024 02:08                1285
math.configuration.php                             29-May-2024 02:08                1215
math.constants.php                                 29-May-2024 02:08                7195
math.installation.php                              29-May-2024 02:08                1194
math.requirements.php                              29-May-2024 02:08                1152
math.resources.php                                 29-May-2024 02:08                1172
math.setup.php                                     29-May-2024 02:08                1535
mbstring.configuration.php                         29-May-2024 02:08               15657
mbstring.constants.php                             29-May-2024 02:08                6773
mbstring.encodings.php                             29-May-2024 02:08               14798
mbstring.http.php                                  29-May-2024 02:08                4925
mbstring.installation.php                          29-May-2024 02:08                3173
mbstring.ja-basic.php                              29-May-2024 02:08                3481
mbstring.overload.php                              29-May-2024 02:08                6898
mbstring.php4.req.php                              29-May-2024 02:08                3749
mbstring.requirements.php                          29-May-2024 02:08                1180
mbstring.resources.php                             29-May-2024 02:08                1200
mbstring.setup.php                                 29-May-2024 02:08                1611
mbstring.supported-encodings.php                   29-May-2024 02:08                8177
mcrypt.ciphers.php                                 29-May-2024 02:08                6446
mcrypt.configuration.php                           29-May-2024 02:08                3504
mcrypt.constants.php                               29-May-2024 02:08                6288
mcrypt.installation.php                            29-May-2024 02:08                1695
mcrypt.requirements.php                            29-May-2024 02:08                2105
mcrypt.resources.php                               29-May-2024 02:08                1295
mcrypt.setup.php                                   29-May-2024 02:08                1577
memcache.add.php                                   29-May-2024 02:08                7329
memcache.addserver.php                             29-May-2024 02:08               13371
memcache.close.php                                 29-May-2024 02:08                5164
memcache.connect.php                               29-May-2024 02:08                7188
memcache.constants.php                             29-May-2024 02:08                5142
memcache.decrement.php                             29-May-2024 02:08                7232
memcache.delete.php                                29-May-2024 02:08                6448
memcache.examples-overview.php                     29-May-2024 02:08                6395
memcache.examples.php                              29-May-2024 02:08                1415
memcache.flush.php                                 29-May-2024 02:08                4621
memcache.get.php                                   29-May-2024 02:08                9128
memcache.getextendedstats.php                      29-May-2024 02:08                8405
memcache.getserverstatus.php                       29-May-2024 02:08                6136
memcache.getstats.php                              29-May-2024 02:08                4688
memcache.getversion.php                            29-May-2024 02:08                5027
memcache.increment.php                             29-May-2024 02:08                7053
memcache.ini.php                                   29-May-2024 02:08               10475
memcache.installation.php                          29-May-2024 02:08                2009
memcache.pconnect.php                              29-May-2024 02:08                6159
memcache.replace.php                               29-May-2024 02:08                7346
memcache.requirements.php                          29-May-2024 02:08                1310
memcache.resources.php                             29-May-2024 02:08                1257
memcache.set.php                                   29-May-2024 02:08                9547
memcache.setcompressthreshold.php                  29-May-2024 02:08                5876
memcache.setserverparams.php                       29-May-2024 02:08               10971
memcache.setup.php                                 29-May-2024 02:08                1590
memcached.add.php                                  29-May-2024 02:08                4609
memcached.addbykey.php                             29-May-2024 02:08                5744
memcached.addserver.php                            29-May-2024 02:08                7447
memcached.addservers.php                           29-May-2024 02:08                5367
memcached.append.php                               29-May-2024 02:08                7357
memcached.appendbykey.php                          29-May-2024 02:08                5101
memcached.callbacks.php                            29-May-2024 02:08                1508
memcached.callbacks.read-through.php               29-May-2024 02:08                4378
memcached.callbacks.result.php                     29-May-2024 02:08                4822
memcached.cas.php                                  29-May-2024 02:08                9601
memcached.casbykey.php                             29-May-2024 02:08                5854
memcached.configuration.php                        29-May-2024 02:08               27991
memcached.constants.php                            29-May-2024 02:08               28562
memcached.construct.php                            29-May-2024 02:08                5590
memcached.decrement.php                            29-May-2024 02:08                9029
memcached.decrementbykey.php                       29-May-2024 02:08                5937
memcached.delete.php                               29-May-2024 02:08                5624
memcached.deletebykey.php                          29-May-2024 02:08                5505
memcached.deletemulti.php                          29-May-2024 02:08                4820
memcached.deletemultibykey.php                     29-May-2024 02:08                5739
memcached.expiration.php                           29-May-2024 02:08                1930
memcached.fetch.php                                29-May-2024 02:08                6713
memcached.fetchall.php                             29-May-2024 02:08                6506
memcached.flush.php                                29-May-2024 02:08                4624
memcached.get.php                                  29-May-2024 02:08               10267
memcached.getallkeys.php                           29-May-2024 02:08                3058
memcached.getbykey.php                             29-May-2024 02:08                6470
memcached.getdelayed.php                           29-May-2024 02:08                8827
memcached.getdelayedbykey.php                      29-May-2024 02:08                5837
memcached.getmulti.php                             29-May-2024 02:08               20599
memcached.getmultibykey.php                        29-May-2024 02:08                5644
memcached.getoption.php                            29-May-2024 02:08                5171
memcached.getresultcode.php                        29-May-2024 02:08                4244
memcached.getresultmessage.php                     29-May-2024 02:08                4641
memcached.getserverbykey.php                       29-May-2024 02:08                7638
memcached.getserverlist.php                        29-May-2024 02:08                4568
memcached.getstats.php                             29-May-2024 02:08                5816
memcached.getversion.php                           29-May-2024 02:08                4084
memcached.increment.php                            29-May-2024 02:08                8348
memcached.incrementbykey.php                       29-May-2024 02:08                5870
memcached.installation.php                         29-May-2024 02:08                2564
memcached.ispersistent.php                         29-May-2024 02:08                3004
memcached.ispristine.php                           29-May-2024 02:08                2931
memcached.prepend.php                              29-May-2024 02:08                7333
memcached.prependbykey.php                         29-May-2024 02:08                5243
memcached.quit.php                                 29-May-2024 02:08                2444
memcached.replace.php                              29-May-2024 02:08                4670
memcached.replacebykey.php                         29-May-2024 02:08                5612
memcached.requirements.php                         29-May-2024 02:08                1512
memcached.resetserverlist.php                      29-May-2024 02:08                3161
memcached.resources.php                            29-May-2024 02:08                1207
memcached.sessions.php                             29-May-2024 02:08                2703
memcached.set.php                                  29-May-2024 02:08                9055
memcached.setbykey.php                             29-May-2024 02:08                6993
memcached.setmulti.php                             29-May-2024 02:08                6262
memcached.setmultibykey.php                        29-May-2024 02:08                4893
memcached.setoption.php                            29-May-2024 02:08                7296
memcached.setoptions.php                           29-May-2024 02:08                6943
memcached.setsaslauthdata.php                      29-May-2024 02:08                3531
memcached.setup.php                                29-May-2024 02:08                1605
memcached.touch.php                                29-May-2024 02:08                3747
memcached.touchbykey.php                           29-May-2024 02:08                4610
messageformatter.create.php                        29-May-2024 02:08               10999
messageformatter.format.php                        29-May-2024 02:08                9681
messageformatter.formatmessage.php                 29-May-2024 02:08               14415
messageformatter.geterrorcode.php                  29-May-2024 02:08                3978
messageformatter.geterrormessage.php               29-May-2024 02:08                7600
messageformatter.getlocale.php                     29-May-2024 02:08                5457
messageformatter.getpattern.php                    29-May-2024 02:08               10055
messageformatter.parse.php                         29-May-2024 02:08                9794
messageformatter.parsemessage.php                  29-May-2024 02:08                9991
messageformatter.setpattern.php                    29-May-2024 02:08               10589
mhash.configuration.php                            29-May-2024 02:08                1222
mhash.constants.php                                29-May-2024 02:08                7138
mhash.examples.php                                 29-May-2024 02:08                3308
mhash.installation.php                             29-May-2024 02:08                1594
mhash.requirements.php                             29-May-2024 02:08                1320
mhash.resources.php                                29-May-2024 02:08                1179
mhash.setup.php                                    29-May-2024 02:08                1553
migration56.changed-functions.php                  29-May-2024 02:08                6799
migration56.constants.php                          29-May-2024 02:08                6791
migration56.deprecated.php                         29-May-2024 02:08                6229
migration56.extensions.php                         29-May-2024 02:08                4333
migration56.incompatible.php                       29-May-2024 02:08                8444
migration56.new-features.php                       29-May-2024 02:08               28535
migration56.new-functions.php                      29-May-2024 02:08                7552
migration56.openssl.php                            29-May-2024 02:08               26756
migration56.php                                    29-May-2024 02:08                2328
migration70.changed-functions.php                  29-May-2024 02:08                4981
migration70.classes.php                            29-May-2024 02:08                3918
migration70.constants.php                          29-May-2024 02:08                9505
migration70.deprecated.php                         29-May-2024 02:08                5512
migration70.incompatible.php                       29-May-2024 02:08               61161
migration70.new-features.php                       29-May-2024 02:08               40129
migration70.new-functions.php                      29-May-2024 02:08                7358
migration70.other-changes.php                      29-May-2024 02:08                3280
migration70.php                                    29-May-2024 02:08                2685
migration70.removed-exts-sapis.php                 29-May-2024 02:08                3169
migration70.sapi-changes.php                       29-May-2024 02:08                1988
migration71.changed-functions.php                  29-May-2024 02:08                7648
migration71.constants.php                          29-May-2024 02:08                8797
migration71.deprecated.php                         29-May-2024 02:08                2235
migration71.incompatible.php                       29-May-2024 02:08               28960
migration71.new-features.php                       29-May-2024 02:08               26596
migration71.new-functions.php                      29-May-2024 02:08                5086
migration71.other-changes.php                      29-May-2024 02:08                8214
migration71.php                                    29-May-2024 02:08                2386
migration71.windows-support.php                    29-May-2024 02:08                6723
migration72.constants.php                          29-May-2024 02:08               31969
migration72.deprecated.php                         29-May-2024 02:08                9888
migration72.incompatible.php                       29-May-2024 02:08               19173
migration72.new-features.php                       29-May-2024 02:08               18381
migration72.new-functions.php                      29-May-2024 02:08               24418
migration72.other-changes.php                      29-May-2024 02:08                5735
migration72.php                                    29-May-2024 02:08                2282
migration73.constants.php                          29-May-2024 02:08               26170
migration73.deprecated.php                         29-May-2024 02:08                8675
migration73.incompatible.php                       29-May-2024 02:08               17263
migration73.new-features.php                       29-May-2024 02:08               16074
migration73.new-functions.php                      29-May-2024 02:08                7420
migration73.other-changes.php                      29-May-2024 02:08               15880
migration73.php                                    29-May-2024 02:08                2408
migration73.windows-support.php                    29-May-2024 02:08                1805
migration74.constants.php                          29-May-2024 02:08                7803
migration74.deprecated.php                         29-May-2024 02:08               15059
migration74.incompatible.php                       29-May-2024 02:08               17728
migration74.new-classes.php                        29-May-2024 02:08                1514
migration74.new-features.php                       29-May-2024 02:08               21377
migration74.new-functions.php                      29-May-2024 02:08                3754
migration74.other-changes.php                      29-May-2024 02:08               20349
migration74.php                                    29-May-2024 02:08                2616
migration74.removed-extensions.php                 29-May-2024 02:08                1906
migration74.windows-support.php                    29-May-2024 02:08                3643
migration80.deprecated.php                         29-May-2024 02:08               18400
migration80.incompatible.php                       29-May-2024 02:08               94255
migration80.new-features.php                       29-May-2024 02:08               31220
migration80.other-changes.php                      29-May-2024 02:08               14899
migration80.php                                    29-May-2024 02:08                2255
migration81.constants.php                          29-May-2024 02:08                8231
migration81.deprecated.php                         29-May-2024 02:08               18795
migration81.incompatible.php                       29-May-2024 02:08               22410
migration81.new-classes.php                        29-May-2024 02:08                2150
migration81.new-features.php                       29-May-2024 02:08               23177
migration81.new-functions.php                      29-May-2024 02:08                8489
migration81.other-changes.php                      29-May-2024 02:08                9716
migration81.php                                    29-May-2024 02:08                2481
migration82.constants.php                          29-May-2024 02:08               22160
migration82.deprecated.php                         29-May-2024 02:08                5642
migration82.incompatible.php                       29-May-2024 02:08                9182
migration82.new-features.php                       29-May-2024 02:08                6798
migration82.new-functions.php                      29-May-2024 02:08                4311
migration82.other-changes.php                      29-May-2024 02:08               25039
migration82.php                                    29-May-2024 02:08                2508
migration82.windows-support.php                    29-May-2024 02:08                2217
migration83.constants.php                          29-May-2024 02:08               14841
migration83.deprecated.php                         29-May-2024 02:08                7405
migration83.incompatible.php                       29-May-2024 02:08               13858
migration83.new-classes.php                        29-May-2024 02:08                3402
migration83.new-features.php                       29-May-2024 02:08                6960
migration83.new-functions.php                      29-May-2024 02:08                7323
migration83.other-changes.php                      29-May-2024 02:08               30303
migration83.php                                    29-May-2024 02:08                2641
migration83.windows-support.php                    29-May-2024 02:08                1410
misc.configuration.php                             29-May-2024 02:08                5900
misc.constants.php                                 29-May-2024 02:08                2532
misc.installation.php                              29-May-2024 02:08                1194
misc.requirements.php                              29-May-2024 02:08                1152
misc.resources.php                                 29-May-2024 02:08                1172
misc.setup.php                                     29-May-2024 02:08                1528
mongodb-bson-binary.construct.php                  29-May-2024 02:08                7942
mongodb-bson-binary.getdata.php                    29-May-2024 02:08                4404
mongodb-bson-binary.gettype.php                    29-May-2024 02:08                4386
mongodb-bson-binary.jsonserialize.php              29-May-2024 02:08                5370
mongodb-bson-binary.serialize.php                  29-May-2024 02:08                3464
mongodb-bson-binary.tostring.php                   29-May-2024 02:08                4194
mongodb-bson-binary.unserialize.php                29-May-2024 02:08                4309
mongodb-bson-binaryinterface.getdata.php           29-May-2024 02:08                2842
mongodb-bson-binaryinterface.gettype.php           29-May-2024 02:08                2852
mongodb-bson-binaryinterface.tostring.php          29-May-2024 02:08                3310
mongodb-bson-dbpointer.construct.php               29-May-2024 02:08                2673
mongodb-bson-dbpointer.jsonserialize.php           29-May-2024 02:08                5439
mongodb-bson-dbpointer.serialize.php               29-May-2024 02:08                3539
mongodb-bson-dbpointer.tostring.php                29-May-2024 02:08                2684
mongodb-bson-dbpointer.unserialize.php             29-May-2024 02:08                3808
mongodb-bson-decimal128.construct.php              29-May-2024 02:08                5782
mongodb-bson-decimal128.jsonserialize.php          29-May-2024 02:08                5460
mongodb-bson-decimal128.serialize.php              29-May-2024 02:08                3564
mongodb-bson-decimal128.tostring.php               29-May-2024 02:08                4532
mongodb-bson-decimal128.unserialize.php            29-May-2024 02:08                4401
mongodb-bson-decimal128interface.tostring.php      29-May-2024 02:08                3005
mongodb-bson-document.construct.php                29-May-2024 02:08                3287
mongodb-bson-document.frombson.php                 29-May-2024 02:08                4068
mongodb-bson-document.fromjson.php                 29-May-2024 02:08                4581
mongodb-bson-document.fromphp.php                  29-May-2024 02:08                4303
mongodb-bson-document.get.php                      29-May-2024 02:08                4269
mongodb-bson-document.getiterator.php              29-May-2024 02:08                3521
mongodb-bson-document.has.php                      29-May-2024 02:08                3799
mongodb-bson-document.offsetexists.php             29-May-2024 02:08                3528
mongodb-bson-document.offsetget.php                29-May-2024 02:08                4358
mongodb-bson-document.offsetset.php                29-May-2024 02:08                3595
mongodb-bson-document.offsetunset.php              29-May-2024 02:08                3204
mongodb-bson-document.serialize.php                29-May-2024 02:08                3544
mongodb-bson-document.tocanonicalextendedjson.php  29-May-2024 02:08               12721
mongodb-bson-document.tophp.php                    29-May-2024 02:08                5482
mongodb-bson-document.torelaxedextendedjson.php    29-May-2024 02:08               12438
mongodb-bson-document.tostring.php                 29-May-2024 02:08                2758
mongodb-bson-document.unserialize.php              29-May-2024 02:08                4357
mongodb-bson-int64.construct.php                   29-May-2024 02:08                4775
mongodb-bson-int64.jsonserialize.php               29-May-2024 02:08                5114
mongodb-bson-int64.serialize.php                   29-May-2024 02:08                3441
mongodb-bson-int64.tostring.php                    29-May-2024 02:08                3850
mongodb-bson-int64.unserialize.php                 29-May-2024 02:08                4280
mongodb-bson-iterator.construct.php                29-May-2024 02:08                3375
mongodb-bson-iterator.current.php                  29-May-2024 02:08                3608
mongodb-bson-iterator.key.php                      29-May-2024 02:08                3598
mongodb-bson-iterator.next.php                     29-May-2024 02:08                2408
mongodb-bson-iterator.rewind.php                   29-May-2024 02:08                2442
mongodb-bson-iterator.valid.php                    29-May-2024 02:08                2816
mongodb-bson-javascript.construct.php              29-May-2024 02:08                7253
mongodb-bson-javascript.getcode.php                29-May-2024 02:08                4376
mongodb-bson-javascript.getscope.php               29-May-2024 02:08                5352
mongodb-bson-javascript.jsonserialize.php          29-May-2024 02:08                5456
mongodb-bson-javascript.serialize.php              29-May-2024 02:08                3564
mongodb-bson-javascript.tostring.php               29-May-2024 02:08                4188
mongodb-bson-javascript.unserialize.php            29-May-2024 02:08                4393
mongodb-bson-javascriptinterface.getcode.php       29-May-2024 02:08                2936
mongodb-bson-javascriptinterface.getscope.php      29-May-2024 02:08                3101
mongodb-bson-javascriptinterface.tostring.php      29-May-2024 02:08                3408
mongodb-bson-maxkey.construct.php                  29-May-2024 02:08                3637
mongodb-bson-maxkey.jsonserialize.php              29-May-2024 02:08                5376
mongodb-bson-maxkey.serialize.php                  29-May-2024 02:08                3468
mongodb-bson-maxkey.unserialize.php                29-May-2024 02:08                3741
mongodb-bson-minkey.construct.php                  29-May-2024 02:08                3637
mongodb-bson-minkey.jsonserialize.php              29-May-2024 02:08                5376
mongodb-bson-minkey.serialize.php                  29-May-2024 02:08                3468
mongodb-bson-minkey.unserialize.php                29-May-2024 02:08                3745
mongodb-bson-objectid.construct.php                29-May-2024 02:08                5270
mongodb-bson-objectid.gettimestamp.php             29-May-2024 02:08                5473
mongodb-bson-objectid.jsonserialize.php            29-May-2024 02:08                5422
mongodb-bson-objectid.serialize.php                29-May-2024 02:08                3516
mongodb-bson-objectid.tostring.php                 29-May-2024 02:08                4178
mongodb-bson-objectid.unserialize.php              29-May-2024 02:08                4347
mongodb-bson-objectidinterface.gettimestamp.php    29-May-2024 02:08                3005
mongodb-bson-objectidinterface.tostring.php        29-May-2024 02:08                2989
mongodb-bson-packedarray.construct.php             29-May-2024 02:08                2907
mongodb-bson-packedarray.fromphp.php               29-May-2024 02:08                3984
mongodb-bson-packedarray.get.php                   29-May-2024 02:08                4317
mongodb-bson-packedarray.getiterator.php           29-May-2024 02:08                3575
mongodb-bson-packedarray.has.php                   29-May-2024 02:08                3853
mongodb-bson-packedarray.offsetexists.php          29-May-2024 02:08                3584
mongodb-bson-packedarray.offsetget.php             29-May-2024 02:08                4524
mongodb-bson-packedarray.offsetset.php             29-May-2024 02:08                3649
mongodb-bson-packedarray.offsetunset.php           29-May-2024 02:08                3258
mongodb-bson-packedarray.serialize.php             29-May-2024 02:08                3576
mongodb-bson-packedarray.tophp.php                 29-May-2024 02:08                4666
mongodb-bson-packedarray.tostring.php              29-May-2024 02:08                2774
mongodb-bson-packedarray.unserialize.php           29-May-2024 02:08                4413
mongodb-bson-persistable.bsonserialize.php         29-May-2024 02:08                6138
mongodb-bson-regex.construct.php                   29-May-2024 02:08                7016
mongodb-bson-regex.getflags.php                    29-May-2024 02:08                4486
mongodb-bson-regex.getpattern.php                  29-May-2024 02:08                4348
mongodb-bson-regex.jsonserialize.php               29-May-2024 02:08                5355
mongodb-bson-regex.serialize.php                   29-May-2024 02:08                3439
mongodb-bson-regex.tostring.php                    29-May-2024 02:08                3886
mongodb-bson-regex.unserialize.php                 29-May-2024 02:08                4284
mongodb-bson-regexinterface.getflags.php           29-May-2024 02:08                2841
mongodb-bson-regexinterface.getpattern.php         29-May-2024 02:08                2884
mongodb-bson-regexinterface.tostring.php           29-May-2024 02:08                2915
mongodb-bson-serializable.bsonserialize.php        29-May-2024 02:08               16536
mongodb-bson-symbol.construct.php                  29-May-2024 02:08                2613
mongodb-bson-symbol.jsonserialize.php              29-May-2024 02:08                5376
mongodb-bson-symbol.serialize.php                  29-May-2024 02:08                3464
mongodb-bson-symbol.tostring.php                   29-May-2024 02:08                2662
mongodb-bson-symbol.unserialize.php                29-May-2024 02:08                3747
mongodb-bson-timestamp.construct.php               29-May-2024 02:08                4829
mongodb-bson-timestamp.getincrement.php            29-May-2024 02:08                4305
mongodb-bson-timestamp.gettimestamp.php            29-May-2024 02:08                4290
mongodb-bson-timestamp.jsonserialize.php           29-May-2024 02:08                5443
mongodb-bson-timestamp.serialize.php               29-May-2024 02:08                3539
mongodb-bson-timestamp.tostring.php                29-May-2024 02:08                4020
mongodb-bson-timestamp.unserialize.php             29-May-2024 02:08                4380
mongodb-bson-timestampinterface.getincrement.php   29-May-2024 02:08                3368
mongodb-bson-timestampinterface.gettimestamp.php   29-May-2024 02:08                3383
mongodb-bson-timestampinterface.tostring.php       29-May-2024 02:08                3007
mongodb-bson-undefined.construct.php               29-May-2024 02:08                2673
mongodb-bson-undefined.jsonserialize.php           29-May-2024 02:08                5439
mongodb-bson-undefined.serialize.php               29-May-2024 02:08                3539
mongodb-bson-undefined.tostring.php                29-May-2024 02:08                2684
mongodb-bson-undefined.unserialize.php             29-May-2024 02:08                3809
mongodb-bson-unserializable.bsonunserialize.php    29-May-2024 02:08                7075
mongodb-bson-utcdatetime.construct.php             29-May-2024 02:08                8156
mongodb-bson-utcdatetime.jsonserialize.php         29-May-2024 02:08                5481
mongodb-bson-utcdatetime.serialize.php             29-May-2024 02:08                3591
mongodb-bson-utcdatetime.todatetime.php            29-May-2024 02:08                5817
mongodb-bson-utcdatetime.tostring.php              29-May-2024 02:08                3984
mongodb-bson-utcdatetime.unserialize.php           29-May-2024 02:08                4412
mongodb-bson-utcdatetimeinterface.todatetime.php   29-May-2024 02:08                3284
mongodb-bson-utcdatetimeinterface.tostring.php     29-May-2024 02:08                3023
mongodb-driver-bulkwrite.construct.php             29-May-2024 02:08               18656
mongodb-driver-bulkwrite.count.php                 29-May-2024 02:08                6923
mongodb-driver-bulkwrite.delete.php                29-May-2024 02:08               12035
mongodb-driver-bulkwrite.insert.php                29-May-2024 02:08                9597
mongodb-driver-bulkwrite.update.php                29-May-2024 02:08               15645
mongodb-driver-clientencryption.addkeyaltname.php  29-May-2024 02:08                5571
mongodb-driver-clientencryption.construct.php      29-May-2024 02:08               11314
mongodb-driver-clientencryption.createdatakey.php  29-May-2024 02:08               11002
mongodb-driver-clientencryption.decrypt.php        29-May-2024 02:08                4212
mongodb-driver-clientencryption.deletekey.php      29-May-2024 02:08                4319
mongodb-driver-clientencryption.encrypt.php        29-May-2024 02:08               12823
mongodb-driver-clientencryption.encryptexpressi..> 29-May-2024 02:08               14539
mongodb-driver-clientencryption.getkey.php         29-May-2024 02:08                4452
mongodb-driver-clientencryption.getkeybyaltname..> 29-May-2024 02:08                5041
mongodb-driver-clientencryption.getkeys.php        29-May-2024 02:08                3860
mongodb-driver-clientencryption.removekeyaltnam..> 29-May-2024 02:08                5636
mongodb-driver-clientencryption.rewrapmanydatak..> 29-May-2024 02:08               12187
mongodb-driver-command.construct.php               29-May-2024 02:08               14212
mongodb-driver-commandexception.getresultdocume..> 29-May-2024 02:08                3257
mongodb-driver-cursor.construct.php                29-May-2024 02:08                3347
mongodb-driver-cursor.current.php                  29-May-2024 02:08                3095
mongodb-driver-cursor.getid.php                    29-May-2024 02:08                7588
mongodb-driver-cursor.getserver.php                29-May-2024 02:08                7481
mongodb-driver-cursor.isdead.php                   29-May-2024 02:08               10613
mongodb-driver-cursor.key.php                      29-May-2024 02:08                2645
mongodb-driver-cursor.next.php                     29-May-2024 02:08                3507
mongodb-driver-cursor.rewind.php                   29-May-2024 02:08                3957
mongodb-driver-cursor.settypemap.php               29-May-2024 02:08                7957
mongodb-driver-cursor.toarray.php                  29-May-2024 02:08                7674
mongodb-driver-cursor.valid.php                    29-May-2024 02:08                2841
mongodb-driver-cursorid.construct.php              29-May-2024 02:08                2835
mongodb-driver-cursorid.serialize.php              29-May-2024 02:08                3562
mongodb-driver-cursorid.tostring.php               29-May-2024 02:08                6974
mongodb-driver-cursorid.unserialize.php            29-May-2024 02:08                4419
mongodb-driver-cursorinterface.getid.php           29-May-2024 02:08                4015
mongodb-driver-cursorinterface.getserver.php       29-May-2024 02:08                4116
mongodb-driver-cursorinterface.isdead.php          29-May-2024 02:08                4079
mongodb-driver-cursorinterface.settypemap.php      29-May-2024 02:08                4118
mongodb-driver-cursorinterface.toarray.php         29-May-2024 02:08                3978
mongodb-driver-manager.addsubscriber.php           29-May-2024 02:08                5547
mongodb-driver-manager.construct.php               29-May-2024 02:08               80129
mongodb-driver-manager.createclientencryption.php  29-May-2024 02:08               12640
mongodb-driver-manager.executebulkwrite.php        29-May-2024 02:08               23198
mongodb-driver-manager.executecommand.php          29-May-2024 02:08               25006
mongodb-driver-manager.executequery.php            29-May-2024 02:08               16542
mongodb-driver-manager.executereadcommand.php      29-May-2024 02:08               10187
mongodb-driver-manager.executereadwritecommand.php 29-May-2024 02:08               11264
mongodb-driver-manager.executewritecommand.php     29-May-2024 02:08               11353
mongodb-driver-manager.getencryptedfieldsmap.php   29-May-2024 02:08                3913
mongodb-driver-manager.getreadconcern.php          29-May-2024 02:08                5885
mongodb-driver-manager.getreadpreference.php       29-May-2024 02:08                6480
mongodb-driver-manager.getservers.php              29-May-2024 02:08                7923
mongodb-driver-manager.getwriteconcern.php         29-May-2024 02:08                5938
mongodb-driver-manager.removesubscriber.php        29-May-2024 02:08                4939
mongodb-driver-manager.selectserver.php            29-May-2024 02:08                7211
mongodb-driver-manager.startsession.php            29-May-2024 02:08               12608
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                3713
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                3640
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                3812
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                3641
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                4841
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                4032
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                4268
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                4194
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                4041
mongodb-driver-monitoring-commandfailedevent.ge..> 29-May-2024 02:08                3825
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 02:08                4039
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 02:08                3749
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 02:08                3651
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 02:08                5150
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 02:08                4729
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 02:08                4485
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 02:08                4061
mongodb-driver-monitoring-commandstartedevent.g..> 29-May-2024 02:08                3845
mongodb-driver-monitoring-commandsubscriber.com..> 29-May-2024 02:08                4919
mongodb-driver-monitoring-commandsubscriber.com..> 29-May-2024 02:08                4969
mongodb-driver-monitoring-commandsubscriber.com..> 29-May-2024 02:08                4982
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 02:08                3770
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 02:08                3697
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 02:08                3881
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 02:08                4928
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 02:08                4089
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 02:08                4331
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 02:08                4699
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 02:08                4101
mongodb-driver-monitoring-commandsucceededevent..> 29-May-2024 02:08                3871
mongodb-driver-monitoring-logsubscriber.log.php    29-May-2024 02:08                4649
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 02:08                4802
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 02:08                4772
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 02:08                5339
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 02:08                5384
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 02:08                5415
mongodb-driver-monitoring-sdamsubscriber.server..> 29-May-2024 02:08                4802
mongodb-driver-monitoring-sdamsubscriber.topolo..> 29-May-2024 02:08                4877
mongodb-driver-monitoring-sdamsubscriber.topolo..> 29-May-2024 02:08                4814
mongodb-driver-monitoring-sdamsubscriber.topolo..> 29-May-2024 02:08                4797
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 02:08                3190
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 02:08                3506
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 02:08                3258
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 02:08                3583
mongodb-driver-monitoring-serverchangedevent.ge..> 29-May-2024 02:08                3306
mongodb-driver-monitoring-serverclosedevent.get..> 29-May-2024 02:08                3152
mongodb-driver-monitoring-serverclosedevent.get..> 29-May-2024 02:08                3202
mongodb-driver-monitoring-serverclosedevent.get..> 29-May-2024 02:08                3262
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 02:08                3638
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 02:08                3490
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 02:08                3327
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 02:08                3356
mongodb-driver-monitoring-serverheartbeatfailed..> 29-May-2024 02:08                3712
mongodb-driver-monitoring-serverheartbeatstarte..> 29-May-2024 02:08                3332
mongodb-driver-monitoring-serverheartbeatstarte..> 29-May-2024 02:08                3374
mongodb-driver-monitoring-serverheartbeatstarte..> 29-May-2024 02:08                3732
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 02:08                3690
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 02:08                3399
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 02:08                3408
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 02:08                4226
mongodb-driver-monitoring-serverheartbeatsuccee..> 29-May-2024 02:08                3748
mongodb-driver-monitoring-serveropeningevent.ge..> 29-May-2024 02:08                3170
mongodb-driver-monitoring-serveropeningevent.ge..> 29-May-2024 02:08                3220
mongodb-driver-monitoring-serveropeningevent.ge..> 29-May-2024 02:08                3294
mongodb-driver-monitoring-topologychangedevent...> 29-May-2024 02:08                3575
mongodb-driver-monitoring-topologychangedevent...> 29-May-2024 02:08                3653
mongodb-driver-monitoring-topologychangedevent...> 29-May-2024 02:08                3314
mongodb-driver-monitoring-topologyclosedevent.g..> 29-May-2024 02:08                3259
mongodb-driver-monitoring-topologyopeningevent...> 29-May-2024 02:08                3269
mongodb-driver-query.construct.php                 29-May-2024 02:08               32849
mongodb-driver-readconcern.bsonserialize.php       29-May-2024 02:08                6744
mongodb-driver-readconcern.construct.php           29-May-2024 02:08                5737
mongodb-driver-readconcern.getlevel.php            29-May-2024 02:08                5781
mongodb-driver-readconcern.isdefault.php           29-May-2024 02:08                8055
mongodb-driver-readconcern.serialize.php           29-May-2024 02:08                3639
mongodb-driver-readconcern.unserialize.php         29-May-2024 02:08                4470
mongodb-driver-readpreference.bsonserialize.php    29-May-2024 02:08               10364
mongodb-driver-readpreference.construct.php        29-May-2024 02:08               18439
mongodb-driver-readpreference.gethedge.php         29-May-2024 02:08                3425
mongodb-driver-readpreference.getmaxstalenessse..> 29-May-2024 02:08                8153
mongodb-driver-readpreference.getmode.php          29-May-2024 02:08                7477
mongodb-driver-readpreference.getmodestring.php    29-May-2024 02:08                7683
mongodb-driver-readpreference.gettagsets.php       29-May-2024 02:08                8038
mongodb-driver-readpreference.serialize.php        29-May-2024 02:08                3716
mongodb-driver-readpreference.unserialize.php      29-May-2024 02:08                4549
mongodb-driver-runtimeexception.haserrorlabel.php  29-May-2024 02:08                4291
mongodb-driver-server.construct.php                29-May-2024 02:08                3379
mongodb-driver-server.executebulkwrite.php         29-May-2024 02:08               11507
mongodb-driver-server.executecommand.php           29-May-2024 02:08               13341
mongodb-driver-server.executequery.php             29-May-2024 02:08                8943
mongodb-driver-server.executereadcommand.php       29-May-2024 02:08               10783
mongodb-driver-server.executereadwritecommand.php  29-May-2024 02:08               11778
mongodb-driver-server.executewritecommand.php      29-May-2024 02:08               11833
mongodb-driver-server.gethost.php                  29-May-2024 02:08                5444
mongodb-driver-server.getinfo.php                  29-May-2024 02:08               10584
mongodb-driver-server.getlatency.php               29-May-2024 02:08                7097
mongodb-driver-server.getport.php                  29-May-2024 02:08                5486
mongodb-driver-server.getserverdescription.php     29-May-2024 02:08                3430
mongodb-driver-server.gettags.php                  29-May-2024 02:08                3786
mongodb-driver-server.gettype.php                  29-May-2024 02:08                3822
mongodb-driver-server.isarbiter.php                29-May-2024 02:08                3639
mongodb-driver-server.ishidden.php                 29-May-2024 02:08                3633
mongodb-driver-server.ispassive.php                29-May-2024 02:08                3701
mongodb-driver-server.isprimary.php                29-May-2024 02:08                3646
mongodb-driver-server.issecondary.php              29-May-2024 02:08                3681
mongodb-driver-serverapi.bsonserialize.php         29-May-2024 02:08                3308
mongodb-driver-serverapi.construct.php             29-May-2024 02:08                5239
mongodb-driver-serverapi.serialize.php             29-May-2024 02:08                3592
mongodb-driver-serverapi.unserialize.php           29-May-2024 02:08                4437
mongodb-driver-serverdescription.gethellorespon..> 29-May-2024 02:08                5199
mongodb-driver-serverdescription.gethost.php       29-May-2024 02:08                3448
mongodb-driver-serverdescription.getlastupdatet..> 29-May-2024 02:08                3607
mongodb-driver-serverdescription.getport.php       29-May-2024 02:08                3503
mongodb-driver-serverdescription.getroundtripti..> 29-May-2024 02:08                3902
mongodb-driver-serverdescription.gettype.php       29-May-2024 02:08                3838
mongodb-driver-session.aborttransaction.php        29-May-2024 02:08                4197
mongodb-driver-session.advanceclustertime.php      29-May-2024 02:08                4886
mongodb-driver-session.advanceoperationtime.php    29-May-2024 02:08                4826
mongodb-driver-session.committransaction.php       29-May-2024 02:08                5553
mongodb-driver-session.construct.php               29-May-2024 02:08                2902
mongodb-driver-session.endsession.php              29-May-2024 02:08                4331
mongodb-driver-session.getclustertime.php          29-May-2024 02:08                3976
mongodb-driver-session.getlogicalsessionid.php     29-May-2024 02:08                3140
mongodb-driver-session.getoperationtime.php        29-May-2024 02:08                4056
mongodb-driver-session.getserver.php               29-May-2024 02:08                3955
mongodb-driver-session.gettransactionoptions.php   29-May-2024 02:08                3831
mongodb-driver-session.gettransactionstate.php     29-May-2024 02:08                3735
mongodb-driver-session.isdirty.php                 29-May-2024 02:08                3025
mongodb-driver-session.isintransaction.php         29-May-2024 02:08                3797
mongodb-driver-session.starttransaction.php        29-May-2024 02:08                9082
mongodb-driver-topologydescription.getservers.php  29-May-2024 02:08                3467
mongodb-driver-topologydescription.gettype.php     29-May-2024 02:08                3515
mongodb-driver-topologydescription.hasreadables..> 29-May-2024 02:08                3954
mongodb-driver-topologydescription.haswritables..> 29-May-2024 02:08                3235
mongodb-driver-writeconcern.bsonserialize.php      29-May-2024 02:08                7189
mongodb-driver-writeconcern.construct.php          29-May-2024 02:08               10530
mongodb-driver-writeconcern.getjournal.php         29-May-2024 02:08                5967
mongodb-driver-writeconcern.getw.php               29-May-2024 02:08                5257
mongodb-driver-writeconcern.getwtimeout.php        29-May-2024 02:08                5875
mongodb-driver-writeconcern.isdefault.php          29-May-2024 02:08                7842
mongodb-driver-writeconcern.serialize.php          29-May-2024 02:08                3664
mongodb-driver-writeconcern.unserialize.php        29-May-2024 02:08                4509
mongodb-driver-writeconcernerror.getcode.php       29-May-2024 02:08                6295
mongodb-driver-writeconcernerror.getinfo.php       29-May-2024 02:08                6621
mongodb-driver-writeconcernerror.getmessage.php    29-May-2024 02:08                6386
mongodb-driver-writeerror.getcode.php              29-May-2024 02:08                5644
mongodb-driver-writeerror.getindex.php             29-May-2024 02:08                6166
mongodb-driver-writeerror.getinfo.php              29-May-2024 02:08                3137
mongodb-driver-writeerror.getmessage.php           29-May-2024 02:08                5780
mongodb-driver-writeexception.getwriteresult.php   29-May-2024 02:08                7899
mongodb-driver-writeresult.getdeletedcount.php     29-May-2024 02:08                8136
mongodb-driver-writeresult.getinsertedcount.php    29-May-2024 02:08                8218
mongodb-driver-writeresult.getmatchedcount.php     29-May-2024 02:08                8781
mongodb-driver-writeresult.getmodifiedcount.php    29-May-2024 02:08                9079
mongodb-driver-writeresult.getserver.php           29-May-2024 02:08                6511
mongodb-driver-writeresult.getupsertedcount.php    29-May-2024 02:08                8307
mongodb-driver-writeresult.getupsertedids.php      29-May-2024 02:08                8783
mongodb-driver-writeresult.getwriteconcernerror..> 29-May-2024 02:08                7173
mongodb-driver-writeresult.getwriteerrors.php      29-May-2024 02:08               12972
mongodb-driver-writeresult.isacknowledged.php      29-May-2024 02:08                8148
mongodb.architecture.php                           29-May-2024 02:08                1982
mongodb.configuration.php                          29-May-2024 02:08                3930
mongodb.connection-handling.php                    29-May-2024 02:08                8740
mongodb.constants.php                              29-May-2024 02:08                2063
mongodb.exceptions.php                             29-May-2024 02:08                5205
mongodb.exceptions.tree.php                        29-May-2024 02:08                5633
mongodb.installation.homebrew.php                  29-May-2024 02:08                2029
mongodb.installation.manual.php                    29-May-2024 02:08                6152
mongodb.installation.pecl.php                      29-May-2024 02:08                4922
mongodb.installation.php                           29-May-2024 02:08                1804
mongodb.installation.windows.php                   29-May-2024 02:08                4219
mongodb.monitoring.php                             29-May-2024 02:08               19440
mongodb.overview.php                               29-May-2024 02:08                4673
mongodb.persistence.deserialization.php            29-May-2024 02:08               21840
mongodb.persistence.php                            29-May-2024 02:08                1871
mongodb.persistence.serialization.php              29-May-2024 02:08               20134
mongod