Index of /pub/php/manual/it/


../
feeds/                                             24-May-2024 16:04                   -
images/                                            24-May-2024 16:04                   -
styles/                                            24-May-2024 16:03                   -
toc/                                               24-May-2024 16:04                   -
about.formats.php                                  24-May-2024 16:04                4368
about.generate.php                                 24-May-2024 16:04                2854
about.howtohelp.php                                24-May-2024 16:04                3463
about.more.php                                     24-May-2024 16:04                1924
about.notes.php                                    24-May-2024 16:04                2512
about.php                                          24-May-2024 16:04                1956
about.phpversions.php                              24-May-2024 16:04                3564
about.prototypes.php                               24-May-2024 16:04                7823
about.translations.php                             24-May-2024 16:04                3266
aliases.php                                        24-May-2024 16:04               29284
allowdynamicproperties.construct.php               24-May-2024 16:03                2275
apache.configuration.php                           24-May-2024 16:04                5382
apache.constants.php                               24-May-2024 16:04                1198
apache.installation.php                            24-May-2024 16:04                1310
apache.requirements.php                            24-May-2024 16:04                1236
apache.resources.php                               24-May-2024 16:04                1239
apache.setup.php                                   24-May-2024 16:04                1642
apcu.configuration.php                             24-May-2024 16:03               15920
apcu.constants.php                                 24-May-2024 16:03                7427
apcu.installation.php                              24-May-2024 16:03                3297
apcu.requirements.php                              24-May-2024 16:03                1222
apcu.resources.php                                 24-May-2024 16:03                1225
apcu.setup.php                                     24-May-2024 16:03                1600
apcuiterator.construct.php                         24-May-2024 16:03                7142
apcuiterator.current.php                           24-May-2024 16:03                3024
apcuiterator.gettotalcount.php                     24-May-2024 16:03                3215
apcuiterator.gettotalhits.php                      24-May-2024 16:03                3351
apcuiterator.gettotalsize.php                      24-May-2024 16:03                3092
apcuiterator.key.php                               24-May-2024 16:03                2823
apcuiterator.next.php                              24-May-2024 16:03                3095
apcuiterator.rewind.php                            24-May-2024 16:03                2748
apcuiterator.valid.php                             24-May-2024 16:03                2961
appendices.php                                     24-May-2024 16:04               12249
appenditerator.append.php                          24-May-2024 16:04                5469
appenditerator.construct.php                       24-May-2024 16:04               10140
appenditerator.current.php                         24-May-2024 16:04                3485
appenditerator.getarrayiterator.php                24-May-2024 16:04                3111
appenditerator.getiteratorindex.php                24-May-2024 16:04                6641
appenditerator.key.php                             24-May-2024 16:04                7895
appenditerator.next.php                            24-May-2024 16:04                3387
appenditerator.rewind.php                          24-May-2024 16:04                3383
appenditerator.valid.php                           24-May-2024 16:04                3372
array.configuration.php                            24-May-2024 16:04                1293
array.constants.php                                24-May-2024 16:04               10460
array.installation.php                             24-May-2024 16:04                1272
array.requirements.php                             24-May-2024 16:04                1229
array.resources.php                                24-May-2024 16:04                1232
array.setup.php                                    24-May-2024 16:04                1609
array.sorting.php                                  24-May-2024 16:04                6776
arrayaccess.offsetexists.php                       24-May-2024 16:03                9111
arrayaccess.offsetget.php                          24-May-2024 16:03                4881
arrayaccess.offsetset.php                          24-May-2024 16:03                5162
arrayaccess.offsetunset.php                        24-May-2024 16:03                2841
arrayiterator.append.php                           24-May-2024 16:04                3564
arrayiterator.asort.php                            24-May-2024 16:04                7121
arrayiterator.construct.php                        24-May-2024 16:04                3815
arrayiterator.count.php                            24-May-2024 16:04                3280
arrayiterator.current.php                          24-May-2024 16:04                5220
arrayiterator.getarraycopy.php                     24-May-2024 16:04                3127
arrayiterator.getflags.php                         24-May-2024 16:04                3107
arrayiterator.key.php                              24-May-2024 16:04                4029
arrayiterator.ksort.php                            24-May-2024 16:04                7099
arrayiterator.natcasesort.php                      24-May-2024 16:04                4748
arrayiterator.natsort.php                          24-May-2024 16:04                4650
arrayiterator.next.php                             24-May-2024 16:04                4660
arrayiterator.offsetexists.php                     24-May-2024 16:04                3366
arrayiterator.offsetget.php                        24-May-2024 16:04                3394
arrayiterator.offsetset.php                        24-May-2024 16:04                3667
arrayiterator.offsetunset.php                      24-May-2024 16:04                3794
arrayiterator.rewind.php                           24-May-2024 16:04                4647
arrayiterator.seek.php                             24-May-2024 16:04                2659
arrayiterator.serialize.php                        24-May-2024 16:04                2922
arrayiterator.setflags.php                         24-May-2024 16:04                4159
arrayiterator.uasort.php                           24-May-2024 16:04                6354
arrayiterator.uksort.php                           24-May-2024 16:04                6271
arrayiterator.unserialize.php                      24-May-2024 16:04                3170
arrayiterator.valid.php                            24-May-2024 16:04                4709
arrayobject.append.php                             24-May-2024 16:04                5505
arrayobject.asort.php                              24-May-2024 16:04               10010
arrayobject.construct.php                          24-May-2024 16:04                6281
arrayobject.count.php                              24-May-2024 16:04                5416
arrayobject.exchangearray.php                      24-May-2024 16:04                6515
arrayobject.getarraycopy.php                       24-May-2024 16:04                5310
arrayobject.getflags.php                           24-May-2024 16:04                6138
arrayobject.getiterator.php                        24-May-2024 16:04                5304
arrayobject.getiteratorclass.php                   24-May-2024 16:04                6599
arrayobject.ksort.php                              24-May-2024 16:04                9694
arrayobject.natcasesort.php                        24-May-2024 16:04                8238
arrayobject.natsort.php                            24-May-2024 16:04                7943
arrayobject.offsetexists.php                       24-May-2024 16:04                4981
arrayobject.offsetget.php                          24-May-2024 16:04                5183
arrayobject.offsetset.php                          24-May-2024 16:04                6795
arrayobject.offsetunset.php                        24-May-2024 16:04                4292
arrayobject.serialize.php                          24-May-2024 16:04                5126
arrayobject.setflags.php                           24-May-2024 16:04                6733
arrayobject.setiteratorclass.php                   24-May-2024 16:04                5878
arrayobject.uasort.php                             24-May-2024 16:04               10856
arrayobject.uksort.php                             24-May-2024 16:04               10286
arrayobject.unserialize.php                        24-May-2024 16:04                3600
attribute.construct.php                            24-May-2024 16:03                2366
backedenum.from.php                                24-May-2024 16:03                6156
backedenum.tryfrom.php                             24-May-2024 16:03                6565
bc.configuration.php                               24-May-2024 16:04                2538
bc.constants.php                                   24-May-2024 16:04                1172
bc.installation.php                                24-May-2024 16:04                1477
bc.requirements.php                                24-May-2024 16:04                1208
bc.resources.php                                   24-May-2024 16:04                1211
bc.setup.php                                       24-May-2024 16:04                1601
book.apache.php                                    24-May-2024 16:04                3318
book.apcu.php                                      24-May-2024 16:03                4398
book.array.php                                     24-May-2024 16:04               12056
book.bc.php                                        24-May-2024 16:04                2970
book.bson.php                                      24-May-2024 16:03               24566
book.bzip2.php                                     24-May-2024 16:03                2998
book.calendar.php                                  24-May-2024 16:04                4148
book.classobj.php                                  24-May-2024 16:04                4452
book.cmark.php                                     24-May-2024 16:04                8791
book.com.php                                       24-May-2024 16:04                8039
book.componere.php                                 24-May-2024 16:03                6184
book.ctype.php                                     24-May-2024 16:04                3136
book.cubrid.php                                    24-May-2024 16:03               13876
book.curl.php                                      24-May-2024 16:04                7010
book.datetime.php                                  24-May-2024 16:04               17016
book.dba.php                                       24-May-2024 16:03                3425
book.dbase.php                                     24-May-2024 16:03                3346
book.dio.php                                       24-May-2024 16:04                3066
book.dir.php                                       24-May-2024 16:04                3123
book.dom.php                                       24-May-2024 16:04               20984
book.ds.php                                        24-May-2024 16:04               25143
book.eio.php                                       24-May-2024 16:04                7955
book.enchant.php                                   24-May-2024 16:04                5359
book.errorfunc.php                                 24-May-2024 16:03                3528
book.ev.php                                        24-May-2024 16:04               13385
book.event.php                                     24-May-2024 16:04               23139
book.exec.php                                      24-May-2024 16:04                3247
book.exif.php                                      24-May-2024 16:04                2505
book.expect.php                                    24-May-2024 16:04                2497
book.fann.php                                      24-May-2024 16:04               23110
book.fdf.php                                       24-May-2024 16:04                5615
book.ffi.php                                       24-May-2024 16:03                5655
book.fileinfo.php                                  24-May-2024 16:04                3055
book.filesystem.php                                24-May-2024 16:04                9981
book.filter.php                                    24-May-2024 16:04                3422
book.fpm.php                                       24-May-2024 16:04                1984
book.ftp.php                                       24-May-2024 16:04                6002
book.funchand.php                                  24-May-2024 16:04                3643
book.gearman.php                                   24-May-2024 16:04               14809
book.gender.php                                    24-May-2024 16:04                2597
book.geoip.php                                     24-May-2024 16:04                4379
book.gettext.php                                   24-May-2024 16:04                2943
book.gmagick.php                                   24-May-2024 16:04               22594
book.gmp.php                                       24-May-2024 16:04                6390
book.gnupg.php                                     24-May-2024 16:04                4871
book.hash.php                                      24-May-2024 16:03                4182
book.hrtime.php                                    24-May-2024 16:04                3538
book.ibase.php                                     24-May-2024 16:03               12053
book.ibm-db2.php                                   24-May-2024 16:03                8657
book.iconv.php                                     24-May-2024 16:04                3305
book.igbinary.php                                  24-May-2024 16:04                2153
book.image.php                                     24-May-2024 16:04               15307
book.imagick.php                                   24-May-2024 16:04               63772
book.imap.php                                      24-May-2024 16:04               10247
book.info.php                                      24-May-2024 16:03                8414
book.inotify.php                                   24-May-2024 16:04                2565
book.intl.php                                      24-May-2024 16:04               45039
book.json.php                                      24-May-2024 16:04                2914
book.ldap.php                                      24-May-2024 16:04                9139
book.libxml.php                                    24-May-2024 16:04                3124
book.lua.php                                       24-May-2024 16:04                2665
book.luasandbox.php                                24-May-2024 16:04                5580
book.lzf.php                                       24-May-2024 16:03                2190
book.mail.php                                      24-May-2024 16:04                2096
book.mailparse.php                                 24-May-2024 16:04                3926
book.math.php                                      24-May-2024 16:04                5570
book.mbstring.php                                  24-May-2024 16:04                9757
book.mcrypt.php                                    24-May-2024 16:03                6400
book.memcache.php                                  24-May-2024 16:04                4224
book.memcached.php                                 24-May-2024 16:04                8081
book.mhash.php                                     24-May-2024 16:03                2480
book.misc.php                                      24-May-2024 16:04                5312
book.mongodb.php                                   24-May-2024 16:03               26860
book.mqseries.php                                  24-May-2024 16:04                3184
book.mysql-xdevapi.php                             24-May-2024 16:04               29026
book.mysql.php                                     24-May-2024 16:04                7617
book.mysqli.php                                    24-May-2024 16:03               18069
book.mysqlnd.php                                   24-May-2024 16:04                2474
book.network.php                                   24-May-2024 16:04                6140
book.oauth.php                                     24-May-2024 16:04                7184
book.oci8.php                                      24-May-2024 16:04               16800
book.opcache.php                                   24-May-2024 16:03                2702
book.openal.php                                    24-May-2024 16:03                4446
book.openssl.php                                   24-May-2024 16:03               10887
book.outcontrol.php                                24-May-2024 16:03                5179
book.parallel.php                                  24-May-2024 16:04                5739
book.parle.php                                     24-May-2024 16:04                8804
book.password.php                                  24-May-2024 16:03                2574
book.pcntl.php                                     24-May-2024 16:04                5062
book.pcre.php                                      24-May-2024 16:04                3985
book.pdo.php                                       24-May-2024 16:03                7965
book.pgsql.php                                     24-May-2024 16:04               13059
book.phar.php                                      24-May-2024 16:03               15704
book.phpdbg.php                                    24-May-2024 16:03                2923
book.posix.php                                     24-May-2024 16:04                7037
book.ps.php                                        24-May-2024 16:04                9187
book.pspell.php                                    24-May-2024 16:04                4447
book.pthreads.php                                  24-May-2024 16:04                5467
book.quickhash.php                                 24-May-2024 16:04                8911
book.radius.php                                    24-May-2024 16:03                5539
book.random.php                                    24-May-2024 16:04                9092
book.rar.php                                       24-May-2024 16:03                5249
book.readline.php                                  24-May-2024 16:03                3686
book.recode.php                                    24-May-2024 16:04                2293
book.reflection.php                                24-May-2024 16:04               37106
book.rnp.php                                       24-May-2024 16:03                6054
book.rpminfo.php                                   24-May-2024 16:04                2504
book.rrd.php                                       24-May-2024 16:04                5103
book.runkit7.php                                   24-May-2024 16:03                4234
book.scoutapm.php                                  24-May-2024 16:04                2198
book.seaslog.php                                   24-May-2024 16:04                5198
book.sem.php                                       24-May-2024 16:04                4296
book.session.php                                   24-May-2024 16:04                7913
book.shmop.php                                     24-May-2024 16:04                2906
book.simdjson.php                                  24-May-2024 16:04                2666
book.simplexml.php                                 24-May-2024 16:04                5457
book.snmp.php                                      24-May-2024 16:04                5823
book.soap.php                                      24-May-2024 16:04                6091
book.sockets.php                                   24-May-2024 16:04                7187
book.sodium.php                                    24-May-2024 16:03               17315
book.solr.php                                      24-May-2024 16:04               53145
book.spl.php                                       24-May-2024 16:04               10010
book.sqlite3.php                                   24-May-2024 16:04                7129
book.sqlsrv.php                                    24-May-2024 16:04                5348
book.ssdeep.php                                    24-May-2024 16:04                2327
book.ssh2.php                                      24-May-2024 16:04                5455
book.stats.php                                     24-May-2024 16:04               11814
book.stomp.php                                     24-May-2024 16:04                4141
book.stream.php                                    24-May-2024 16:04               11716
book.strings.php                                   24-May-2024 16:04               13794
book.svm.php                                       24-May-2024 16:04                3677
book.svn.php                                       24-May-2024 16:04                7600
book.swoole.php                                    24-May-2024 16:04               37323
book.sync.php                                      24-May-2024 16:04                4779
book.taint.php                                     24-May-2024 16:04                2553
book.tcpwrap.php                                   24-May-2024 16:04                2047
book.tidy.php                                      24-May-2024 16:04                6586
book.tokenizer.php                                 24-May-2024 16:04                3108
book.trader.php                                    24-May-2024 16:04               17511
book.ui.php                                        24-May-2024 16:04               27921
book.uodbc.php                                     24-May-2024 16:03                7804
book.uopz.php                                      24-May-2024 16:03                5102
book.url.php                                       24-May-2024 16:04                2937
book.v8js.php                                      24-May-2024 16:04                3102
book.var.php                                       24-May-2024 16:04                5978
book.var_representation.php                        24-May-2024 16:04                2145
book.varnish.php                                   24-May-2024 16:04                5364
book.wddx.php                                      24-May-2024 16:04                2798
book.win32service.php                              24-May-2024 16:04                4012
book.wincache.php                                  24-May-2024 16:03                5606
book.wkhtmltox.php                                 24-May-2024 16:04                3308
book.xattr.php                                     24-May-2024 16:04                2443
book.xdiff.php                                     24-May-2024 16:04                4094
book.xhprof.php                                    24-May-2024 16:03                2449
book.xlswriter.php                                 24-May-2024 16:04                4417
book.xml.php                                       24-May-2024 16:04                5631
book.xmldiff.php                                   24-May-2024 16:04                3125
book.xmlreader.php                                 24-May-2024 16:04                4821
book.xmlrpc.php                                    24-May-2024 16:04                3833
book.xmlwriter.php                                 24-May-2024 16:04                6521
book.xsl.php                                       24-May-2024 16:04                3750
book.yac.php                                       24-May-2024 16:03                2595
book.yaconf.php                                    24-May-2024 16:04                2146
book.yaf.php                                       24-May-2024 16:04               34654
book.yaml.php                                      24-May-2024 16:04                2777
book.yar.php                                       24-May-2024 16:04                3679
book.yaz.php                                       24-May-2024 16:04                4347
book.zip.php                                       24-May-2024 16:03               10133
book.zlib.php                                      24-May-2024 16:03                4882
book.zmq.php                                       24-May-2024 16:04                5498
book.zookeeper.php                                 24-May-2024 16:04                6649
bzip2.configuration.php                            24-May-2024 16:03                1293
bzip2.constants.php                                24-May-2024 16:03                1186
bzip2.examples.php                                 24-May-2024 16:03                4054
bzip2.installation.php                             24-May-2024 16:03                1418
bzip2.requirements.php                             24-May-2024 16:03                1386
bzip2.resources.php                                24-May-2024 16:03                1281
bzip2.setup.php                                    24-May-2024 16:03                1630
cachingiterator.construct.php                      24-May-2024 16:04                2857
cachingiterator.count.php                          24-May-2024 16:04                2546
cachingiterator.current.php                        24-May-2024 16:04                2855
cachingiterator.getcache.php                       24-May-2024 16:04                5892
cachingiterator.getflags.php                       24-May-2024 16:04                2540
cachingiterator.hasnext.php                        24-May-2024 16:04                2669
cachingiterator.key.php                            24-May-2024 16:04                2243
cachingiterator.next.php                           24-May-2024 16:04                2470
cachingiterator.offsetexists.php                   24-May-2024 16:04                3002
cachingiterator.offsetget.php                      24-May-2024 16:04                2750
cachingiterator.offsetset.php                      24-May-2024 16:04                3126
cachingiterator.offsetunset.php                    24-May-2024 16:04                2799
cachingiterator.rewind.php                         24-May-2024 16:04                2486
cachingiterator.setflags.php                       24-May-2024 16:04                2831
cachingiterator.tostring.php                       24-May-2024 16:04                2678
cachingiterator.valid.php                          24-May-2024 16:04                2716
calendar.configuration.php                         24-May-2024 16:04                1314
calendar.constants.php                             24-May-2024 16:04               12991
calendar.installation.php                          24-May-2024 16:04                1537
calendar.requirements.php                          24-May-2024 16:04                1250
calendar.resources.php                             24-May-2024 16:04                1253
calendar.setup.php                                 24-May-2024 16:04                1667
callbackfilteriterator.accept.php                  24-May-2024 16:04                3617
callbackfilteriterator.construct.php               24-May-2024 16:04                3968
cc.license.php                                     24-May-2024 16:04               20759
changelog.misc.php                                 24-May-2024 16:04                1354
changelog.mysql.php                                24-May-2024 16:04                2566
changelog.mysql_xdevapi.php                        24-May-2024 16:03                2375
changelog.mysqli.php                               24-May-2024 16:03                1396
changelog.strings.php                              24-May-2024 16:04                1415
class.addressinfo.php                              24-May-2024 16:04                1776
class.allowdynamicproperties.php                   24-May-2024 16:03                5001
class.apcuiterator.php                             24-May-2024 16:03                7363
class.appenditerator.php                           24-May-2024 16:04                7903
class.argumentcounterror.php                       24-May-2024 16:03                8633
class.arithmeticerror.php                          24-May-2024 16:03                8800
class.arrayaccess.php                              24-May-2024 16:03               11734
class.arrayiterator.php                            24-May-2024 16:04               16856
class.arrayobject.php                              24-May-2024 16:04               16783
class.assertionerror.php                           24-May-2024 16:03                8510
class.attribute.php                                24-May-2024 16:03                8592
class.backedenum.php                               24-May-2024 16:03                4315
class.badfunctioncallexception.php                 24-May-2024 16:04                8599
class.badmethodcallexception.php                   24-May-2024 16:04                8617
class.cachingiterator.php                          24-May-2024 16:04               17263
class.callbackfilteriterator.php                   24-May-2024 16:04               11495
class.closedgeneratorexception.php                 24-May-2024 16:03                8746
class.closure.php                                  24-May-2024 16:03                7061
class.collator.php                                 24-May-2024 16:04               36471
class.collectable.php                              24-May-2024 16:04                2582
class.com-exception.php                            24-May-2024 16:04                8428
class.com-safearray-proxy.php                      24-May-2024 16:04                1933
class.com.php                                      24-May-2024 16:04               12545
class.commonmark-cql.php                           24-May-2024 16:04                7370
class.commonmark-interfaces-ivisitable.php         24-May-2024 16:04                3019
class.commonmark-interfaces-ivisitor.php           24-May-2024 16:04                4610
class.commonmark-node-blockquote.php               24-May-2024 16:04                8465
class.commonmark-node-bulletlist.php               24-May-2024 16:04               10644
class.commonmark-node-code.php                     24-May-2024 16:04                9459
class.commonmark-node-codeblock.php                24-May-2024 16:04               10848
class.commonmark-node-customblock.php              24-May-2024 16:04                9214
class.commonmark-node-custominline.php             24-May-2024 16:04                9194
class.commonmark-node-document.php                 24-May-2024 16:04                8422
class.commonmark-node-heading.php                  24-May-2024 16:04                9825
class.commonmark-node-htmlblock.php                24-May-2024 16:04                9517
class.commonmark-node-htmlinline.php               24-May-2024 16:04                9493
class.commonmark-node-image.php                    24-May-2024 16:04               10733
class.commonmark-node-item.php                     24-May-2024 16:04                8432
class.commonmark-node-linebreak.php                24-May-2024 16:04                8446
class.commonmark-node-link.php                     24-May-2024 16:04               10726
class.commonmark-node-orderedlist.php              24-May-2024 16:04               11610
class.commonmark-node-paragraph.php                24-May-2024 16:04                8471
class.commonmark-node-softbreak.php                24-May-2024 16:04                8464
class.commonmark-node-text-emphasis.php            24-May-2024 16:04                8493
class.commonmark-node-text-strong.php              24-May-2024 16:04                8482
class.commonmark-node-text.php                     24-May-2024 16:04                9863
class.commonmark-node-thematicbreak.php            24-May-2024 16:04                8493
class.commonmark-node.php                          24-May-2024 16:04                9388
class.commonmark-parser.php                        24-May-2024 16:04                3870
class.compersisthelper.php                         24-May-2024 16:04                7502
class.compileerror.php                             24-May-2024 16:03                8429
class.componere-abstract-definition.php            24-May-2024 16:03                4771
class.componere-definition.php                     24-May-2024 16:03               10279
class.componere-method.php                         24-May-2024 16:03                4362
class.componere-patch.php                          24-May-2024 16:03                8374
class.componere-value.php                          24-May-2024 16:03                5465
class.countable.php                                24-May-2024 16:04                2600
class.curlfile.php                                 24-May-2024 16:04                8266
class.curlhandle.php                               24-May-2024 16:04                1787
class.curlmultihandle.php                          24-May-2024 16:04                1826
class.curlsharehandle.php                          24-May-2024 16:04                1822
class.curlstringfile.php                           24-May-2024 16:04                5641
class.dateerror.php                                24-May-2024 16:04                9055
class.dateexception.php                            24-May-2024 16:04                9701
class.dateinterval.php                             24-May-2024 16:04               13950
class.dateinvalidoperationexception.php            24-May-2024 16:04                9164
class.dateinvalidtimezoneexception.php             24-May-2024 16:04                8742
class.datemalformedintervalstringexception.php     24-May-2024 16:04                8841
class.datemalformedperiodstringexception.php       24-May-2024 16:04                8823
class.datemalformedstringexception.php             24-May-2024 16:04                9122
class.dateobjecterror.php                          24-May-2024 16:04                8882
class.dateperiod.php                               24-May-2024 16:04               22222
class.daterangeerror.php                           24-May-2024 16:04                9070
class.datetime.php                                 24-May-2024 16:04               23331
class.datetimeimmutable.php                        24-May-2024 16:04               23421
class.datetimeinterface.php                        24-May-2024 16:04               20104
class.datetimezone.php                             24-May-2024 16:04               15593
class.directory.php                                24-May-2024 16:04                5550
class.directoryiterator.php                        24-May-2024 16:04               20036
class.divisionbyzeroerror.php                      24-May-2024 16:03                8487
class.domainexception.php                          24-May-2024 16:04                8532
class.domattr.php                                  24-May-2024 16:04               28297
class.domcdatasection.php                          24-May-2024 16:04               32143
class.domcharacterdata.php                         24-May-2024 16:04               33417
class.domchildnode.php                             24-May-2024 16:04                4259
class.domcomment.php                               24-May-2024 16:04               30817
class.domdocument.php                              24-May-2024 16:04               67513
class.domdocumentfragment.php                      24-May-2024 16:04               29168
class.domdocumenttype.php                          24-May-2024 16:04               27277
class.domelement.php                               24-May-2024 16:04               53123
class.domentity.php                                24-May-2024 16:04               27917
class.domentityreference.php                       24-May-2024 16:04               23413
class.domexception.php                             24-May-2024 16:04                9350
class.domimplementation.php                        24-May-2024 16:04                6059
class.domnamednodemap.php                          24-May-2024 16:04                7411
class.domnamespacenode.php                         24-May-2024 16:04                9439
class.domnode.php                                  24-May-2024 16:04               32519
class.domnodelist.php                              24-May-2024 16:04                6034
class.domnotation.php                              24-May-2024 16:04               23682
class.domparentnode.php                            24-May-2024 16:04                3929
class.domprocessinginstruction.php                 24-May-2024 16:04               24942
class.domtext.php                                  24-May-2024 16:04               33754
class.domxpath.php                                 24-May-2024 16:04                8735
class.dotnet.php                                   24-May-2024 16:04                6948
class.ds-collection.php                            24-May-2024 16:04                6041
class.ds-deque.php                                 24-May-2024 16:04               22140
class.ds-hashable.php                              24-May-2024 16:04                4147
class.ds-map.php                                   24-May-2024 16:04               23080
class.ds-pair.php                                  24-May-2024 16:04                4614
class.ds-priorityqueue.php                         24-May-2024 16:04                8383
class.ds-queue.php                                 24-May-2024 16:04                7883
class.ds-sequence.php                              24-May-2024 16:04               23652
class.ds-set.php                                   24-May-2024 16:04               18611
class.ds-stack.php                                 24-May-2024 16:04                7216
class.ds-vector.php                                24-May-2024 16:04               21676
class.emptyiterator.php                            24-May-2024 16:04                4097
class.enchantbroker.php                            24-May-2024 16:04                1853
class.enchantdictionary.php                        24-May-2024 16:04                1843
class.error.php                                    24-May-2024 16:03               10812
class.errorexception.php                           24-May-2024 16:03               14513
class.ev.php                                       24-May-2024 16:04               42358
class.evcheck.php                                  24-May-2024 16:04               10865
class.evchild.php                                  24-May-2024 16:04               12537
class.evembed.php                                  24-May-2024 16:04               10034
class.event.php                                    24-May-2024 16:04               18452
class.eventbase.php                                24-May-2024 16:04               14924
class.eventbuffer.php                              24-May-2024 16:04               23411
class.eventbufferevent.php                         24-May-2024 16:04               37908
class.eventconfig.php                              24-May-2024 16:04                7859
class.eventdnsbase.php                             24-May-2024 16:04               14294
class.eventexception.php                           24-May-2024 16:04                8555
class.eventhttp.php                                24-May-2024 16:04                9728
class.eventhttpconnection.php                      24-May-2024 16:04               10544
class.eventhttprequest.php                         24-May-2024 16:04               22880
class.eventlistener.php                            24-May-2024 16:04               12812
class.eventsslcontext.php                          24-May-2024 16:04               19177
class.eventutil.php                                24-May-2024 16:04               25579
class.evfork.php                                   24-May-2024 16:04                9031
class.evidle.php                                   24-May-2024 16:04                9858
class.evio.php                                     24-May-2024 16:04               12644
class.evloop.php                                   24-May-2024 16:04               31549
class.evperiodic.php                               24-May-2024 16:04               14959
class.evprepare.php                                24-May-2024 16:04               11004
class.evsignal.php                                 24-May-2024 16:04               11948
class.evstat.php                                   24-May-2024 16:04               14424
class.evtimer.php                                  24-May-2024 16:04               14337
class.evwatcher.php                                24-May-2024 16:04               10010
class.exception.php                                24-May-2024 16:03               11032
class.fannconnection.php                           24-May-2024 16:04                6581
class.ffi-cdata.php                                24-May-2024 16:03                6187
class.ffi-ctype.php                                24-May-2024 16:03               31277
class.ffi-exception.php                            24-May-2024 16:03                8241
class.ffi-parserexception.php                      24-May-2024 16:03                8296
class.ffi.php                                      24-May-2024 16:03               18411
class.fiber.php                                    24-May-2024 16:03                7720
class.fibererror.php                               24-May-2024 16:03                8165
class.filesystemiterator.php                       24-May-2024 16:04               31793
class.filteriterator.php                           24-May-2024 16:04                7341
class.finfo.php                                    24-May-2024 16:04                6266
class.ftp-connection.php                           24-May-2024 16:04                1815
class.gdfont.php                                   24-May-2024 16:04                1740
class.gdimage.php                                  24-May-2024 16:04                1736
class.gearmanclient.php                            24-May-2024 16:04               37804
class.gearmanexception.php                         24-May-2024 16:04                7239
class.gearmanjob.php                               24-May-2024 16:04                9266
class.gearmantask.php                              24-May-2024 16:04                8909
class.gearmanworker.php                            24-May-2024 16:04               13480
class.gender.php                                   24-May-2024 16:04               42250
class.generator.php                                24-May-2024 16:03                6526
class.globiterator.php                             24-May-2024 16:04               26524
class.gmagick.php                                  24-May-2024 16:04               87082
class.gmagickdraw.php                              24-May-2024 16:04               24484
class.gmagickpixel.php                             24-May-2024 16:04                5961
class.gmp.php                                      24-May-2024 16:04                2435
class.hashcontext.php                              24-May-2024 16:03                3373
class.hrtime-performancecounter.php                24-May-2024 16:04                3864
class.hrtime-stopwatch.php                         24-May-2024 16:04                7078
class.hrtime-unit.php                              24-May-2024 16:04                4444
class.imagick.php                                  24-May-2024 16:04              286429
class.imagickdraw.php                              24-May-2024 16:04               82922
class.imagickkernel.php                            24-May-2024 16:04                6576
class.imagickpixel.php                             24-May-2024 16:04               13887
class.imagickpixeliterator.php                     24-May-2024 16:04                9662
class.imap-connection.php                          24-May-2024 16:04                1818
class.infiniteiterator.php                         24-May-2024 16:04                5326
class.internaliterator.php                         24-May-2024 16:03                4779
class.intlbreakiterator.php                        24-May-2024 16:04               30541
class.intlcalendar.php                             24-May-2024 16:04               72251
class.intlchar.php                                 24-May-2024 16:04              473361
class.intlcodepointbreakiterator.php               24-May-2024 16:04               21558
class.intldateformatter.php                        24-May-2024 16:04               32418
class.intldatepatterngenerator.php                 24-May-2024 16:04                4780
class.intlexception.php                            24-May-2024 16:04                8652
class.intlgregoriancalendar.php                    24-May-2024 16:04               53277
class.intliterator.php                             24-May-2024 16:04                5085
class.intlpartsiterator.php                        24-May-2024 16:04                7164
class.intlrulebasedbreakiterator.php               24-May-2024 16:04               24473
class.intltimezone.php                             24-May-2024 16:04               28368
class.invalidargumentexception.php                 24-May-2024 16:04                8555
class.iterator.php                                 24-May-2024 16:03               11373
class.iteratoraggregate.php                        24-May-2024 16:03                6273
class.iteratoriterator.php                         24-May-2024 16:04                6323
class.jsonexception.php                            24-May-2024 16:04                8932
class.jsonserializable.php                         24-May-2024 16:04                2820
class.ldap-connection.php                          24-May-2024 16:04                1838
class.ldap-result-entry.php                        24-May-2024 16:04                1853
class.ldap-result.php                              24-May-2024 16:04                1830
class.lengthexception.php                          24-May-2024 16:04                8481
class.libxmlerror.php                              24-May-2024 16:04                5657
class.limititerator.php                            24-May-2024 16:04               11275
class.locale.php                                   24-May-2024 16:04               28563
class.logicexception.php                           24-May-2024 16:04                8541
class.lua.php                                      24-May-2024 16:04                7789
class.luaclosure.php                               24-May-2024 16:04                2714
class.luasandbox.php                               24-May-2024 16:04               14186
class.luasandboxerror.php                          24-May-2024 16:04               10115
class.luasandboxerrorerror.php                     24-May-2024 16:04                7654
class.luasandboxfatalerror.php                     24-May-2024 16:04                7776
class.luasandboxfunction.php                       24-May-2024 16:04                3973
class.luasandboxmemoryerror.php                    24-May-2024 16:04                7968
class.luasandboxruntimeerror.php                   24-May-2024 16:04                7796
class.luasandboxsyntaxerror.php                    24-May-2024 16:04                7658
class.luasandboxtimeouterror.php                   24-May-2024 16:04                7952
class.memcache.php                                 24-May-2024 16:04               19201
class.memcached.php                                24-May-2024 16:04               47532
class.memcachedexception.php                       24-May-2024 16:04                7537
class.messageformatter.php                         24-May-2024 16:04               12173
class.mongodb-bson-binary.php                      24-May-2024 16:03               16940
class.mongodb-bson-binaryinterface.php             24-May-2024 16:03                4769
class.mongodb-bson-dbpointer.php                   24-May-2024 16:03                6090
class.mongodb-bson-decimal128.php                  24-May-2024 16:03                7869
class.mongodb-bson-decimal128interface.php         24-May-2024 16:03                3896
class.mongodb-bson-document.php                    24-May-2024 16:03               11365
class.mongodb-bson-int64.php                       24-May-2024 16:03                7560
class.mongodb-bson-iterator.php                    24-May-2024 16:03                5038
class.mongodb-bson-javascript.php                  24-May-2024 16:03                8817
class.mongodb-bson-javascriptinterface.php         24-May-2024 16:03                4999
class.mongodb-bson-maxkey.php                      24-May-2024 16:03                5916
class.mongodb-bson-maxkeyinterface.php             24-May-2024 16:03                2250
class.mongodb-bson-minkey.php                      24-May-2024 16:03                5907
class.mongodb-bson-minkeyinterface.php             24-May-2024 16:03                2231
class.mongodb-bson-objectid.php                    24-May-2024 16:03                9281
class.mongodb-bson-objectidinterface.php           24-May-2024 16:03                4386
class.mongodb-bson-packedarray.php                 24-May-2024 16:03                9151
class.mongodb-bson-persistable.php                 24-May-2024 16:03                6197
class.mongodb-bson-regex.php                       24-May-2024 16:03                8248
class.mongodb-bson-regexinterface.php              24-May-2024 16:03                4788
class.mongodb-bson-serializable.php                24-May-2024 16:03                4292
class.mongodb-bson-symbol.php                      24-May-2024 16:03                5978
class.mongodb-bson-timestamp.php                   24-May-2024 16:03                8495
class.mongodb-bson-timestampinterface.php          24-May-2024 16:03                4946
class.mongodb-bson-type.php                        24-May-2024 16:03                2085
class.mongodb-bson-undefined.php                   24-May-2024 16:03                6066
class.mongodb-bson-unserializable.php              24-May-2024 16:03                4035
class.mongodb-bson-utcdatetime.php                 24-May-2024 16:03                8100
class.mongodb-bson-utcdatetimeinterface.php        24-May-2024 16:03                4459
class.mongodb-driver-bulkwrite.php                 24-May-2024 16:03               24176
class.mongodb-driver-clientencryption.php          24-May-2024 16:03               23512
class.mongodb-driver-command.php                   24-May-2024 16:03               14281
class.mongodb-driver-cursor.php                    24-May-2024 16:03               25864
class.mongodb-driver-cursorid.php                  24-May-2024 16:03                5609
class.mongodb-driver-cursorinterface.php           24-May-2024 16:03                6247
class.mongodb-driver-exception-authenticationex..> 24-May-2024 16:03                9208
class.mongodb-driver-exception-bulkwriteexcepti..> 24-May-2024 16:03               10062
class.mongodb-driver-exception-commandexception..> 24-May-2024 16:03               10966
class.mongodb-driver-exception-connectionexcept..> 24-May-2024 16:03                9277
class.mongodb-driver-exception-connectiontimeou..> 24-May-2024 16:03                9665
class.mongodb-driver-exception-encryptionexcept..> 24-May-2024 16:03                9211
class.mongodb-driver-exception-exception.php       24-May-2024 16:03                2245
class.mongodb-driver-exception-executiontimeout..> 24-May-2024 16:03               10326
class.mongodb-driver-exception-invalidargumente..> 24-May-2024 16:03                8237
class.mongodb-driver-exception-logicexception.php  24-May-2024 16:03                8121
class.mongodb-driver-exception-runtimeexception..> 24-May-2024 16:03               11725
class.mongodb-driver-exception-serverexception.php 24-May-2024 16:03                9288
class.mongodb-driver-exception-sslconnectionexc..> 24-May-2024 16:03                9554
class.mongodb-driver-exception-unexpectedvaluee..> 24-May-2024 16:03                8254
class.mongodb-driver-exception-writeexception.php  24-May-2024 16:03               12243
class.mongodb-driver-manager.php                   24-May-2024 16:03               21866
class.mongodb-driver-monitoring-commandfailedev..> 24-May-2024 16:03                8692
class.mongodb-driver-monitoring-commandstartede..> 24-May-2024 16:03                7615
class.mongodb-driver-monitoring-commandsubscrib..> 24-May-2024 16:03                6341
class.mongodb-driver-monitoring-commandsucceede..> 24-May-2024 16:03                8283
class.mongodb-driver-monitoring-logsubscriber.php  24-May-2024 16:03               10178
class.mongodb-driver-monitoring-sdamsubscriber.php 24-May-2024 16:03               11691
class.mongodb-driver-monitoring-serverchangedev..> 24-May-2024 16:03                5805
class.mongodb-driver-monitoring-serverclosedeve..> 24-May-2024 16:03                4452
class.mongodb-driver-monitoring-serverheartbeat..> 24-May-2024 16:03                5803
class.mongodb-driver-monitoring-serverheartbeat..> 24-May-2024 16:03                4630
class.mongodb-driver-monitoring-serverheartbeat..> 24-May-2024 16:03                5875
class.mongodb-driver-monitoring-serveropeningev..> 24-May-2024 16:03                4472
class.mongodb-driver-monitoring-subscriber.php     24-May-2024 16:03                2700
class.mongodb-driver-monitoring-topologychanged..> 24-May-2024 16:03                4800
class.mongodb-driver-monitoring-topologyclosede..> 24-May-2024 16:03                3411
class.mongodb-driver-monitoring-topologyopening..> 24-May-2024 16:03                3425
class.mongodb-driver-query.php                     24-May-2024 16:03                3484
class.mongodb-driver-readconcern.php               24-May-2024 16:03               17771
class.mongodb-driver-readpreference.php            24-May-2024 16:03               21971
class.mongodb-driver-server.php                    24-May-2024 16:03               27241
class.mongodb-driver-serverapi.php                 24-May-2024 16:03               14144
class.mongodb-driver-serverdescription.php         24-May-2024 16:03               16935
class.mongodb-driver-session.php                   24-May-2024 16:03               15594
class.mongodb-driver-topologydescription.php       24-May-2024 16:03               11699
class.mongodb-driver-writeconcern.php              24-May-2024 16:03               10356
class.mongodb-driver-writeconcernerror.php         24-May-2024 16:03                4443
class.mongodb-driver-writeerror.php                24-May-2024 16:03                4767
class.mongodb-driver-writeresult.php               24-May-2024 16:03                8745
class.multipleiterator.php                         24-May-2024 16:04               11578
class.mysql-xdevapi-baseresult.php                 24-May-2024 16:03                3108
class.mysql-xdevapi-client.php                     24-May-2024 16:04                3190
class.mysql-xdevapi-collection.php                 24-May-2024 16:04               10867
class.mysql-xdevapi-collectionadd.php              24-May-2024 16:04                3009
class.mysql-xdevapi-collectionfind.php             24-May-2024 16:04                8889
class.mysql-xdevapi-collectionmodify.php           24-May-2024 16:04               10346
class.mysql-xdevapi-collectionremove.php           24-May-2024 16:04                5283
class.mysql-xdevapi-columnresult.php               24-May-2024 16:04                6833
class.mysql-xdevapi-crudoperationbindable.php      24-May-2024 16:04                3045
class.mysql-xdevapi-crudoperationlimitable.php     24-May-2024 16:04                3051
class.mysql-xdevapi-crudoperationskippable.php     24-May-2024 16:04                3062
class.mysql-xdevapi-crudoperationsortable.php      24-May-2024 16:04                3038
class.mysql-xdevapi-databaseobject.php             24-May-2024 16:04                3609
class.mysql-xdevapi-docresult.php                  24-May-2024 16:04                4111
class.mysql-xdevapi-exception.php                  24-May-2024 16:04                2261
class.mysql-xdevapi-executable.php                 24-May-2024 16:04                2687
class.mysql-xdevapi-executionstatus.php            24-May-2024 16:04                4928
class.mysql-xdevapi-expression.php                 24-May-2024 16:04                3321
class.mysql-xdevapi-result.php                     24-May-2024 16:04                4495
class.mysql-xdevapi-rowresult.php                  24-May-2024 16:04                5208
class.mysql-xdevapi-schema.php                     24-May-2024 16:04                7921
class.mysql-xdevapi-schemaobject.php               24-May-2024 16:04                2872
class.mysql-xdevapi-session.php                    24-May-2024 16:04                9772
class.mysql-xdevapi-sqlstatement.php               24-May-2024 16:04                6728
class.mysql-xdevapi-sqlstatementresult.php         24-May-2024 16:04                7390
class.mysql-xdevapi-statement.php                  24-May-2024 16:04                5089
class.mysql-xdevapi-table.php                      24-May-2024 16:04                7490
class.mysql-xdevapi-tabledelete.php                24-May-2024 16:04                5248
class.mysql-xdevapi-tableinsert.php                24-May-2024 16:04                3569
class.mysql-xdevapi-tableselect.php                24-May-2024 16:04                8393
class.mysql-xdevapi-tableupdate.php                24-May-2024 16:04                6183
class.mysql-xdevapi-warning.php                    24-May-2024 16:04                3818
class.mysqli-driver.php                            24-May-2024 16:03                8076
class.mysqli-result.php                            24-May-2024 16:03               16128
class.mysqli-sql-exception.php                     24-May-2024 16:03               10091
class.mysqli-stmt.php                              24-May-2024 16:03               18814
class.mysqli-warning.php                           24-May-2024 16:03                4448
class.mysqli.php                                   24-May-2024 16:03               45336
class.norewinditerator.php                         24-May-2024 16:04                6763
class.normalizer.php                               24-May-2024 16:04               13664
class.numberformatter.php                          24-May-2024 16:04               74570
class.oauth.php                                    24-May-2024 16:04               20061
class.oauthexception.php                           24-May-2024 16:04                8583
class.oauthprovider.php                            24-May-2024 16:04               12986
class.ocicollection.php                            24-May-2024 16:04                7164
class.ocilob.php                                   24-May-2024 16:04               15387
class.opensslasymmetrickey.php                     24-May-2024 16:03                1916
class.opensslcertificate.php                       24-May-2024 16:03                1920
class.opensslcertificatesigningrequest.php         24-May-2024 16:03                2007
class.outeriterator.php                            24-May-2024 16:04                4383
class.outofboundsexception.php                     24-May-2024 16:04                8590
class.outofrangeexception.php                      24-May-2024 16:04                8592
class.overflowexception.php                        24-May-2024 16:04                8511
class.override.php                                 24-May-2024 16:03                4052
class.parallel-channel.php                         24-May-2024 16:04                8265
class.parallel-events-event-type.php               24-May-2024 16:04                3421
class.parallel-events-event.php                    24-May-2024 16:04                3574
class.parallel-events-input.php                    24-May-2024 16:04                4811
class.parallel-events.php                          24-May-2024 16:04                7185
class.parallel-future.php                          24-May-2024 16:04                7858
class.parallel-runtime.php                         24-May-2024 16:04                6460
class.parallel-sync.php                            24-May-2024 16:04                5286
class.parentiterator.php                           24-May-2024 16:04                9651
class.parle-errorinfo.php                          24-May-2024 16:04                3906
class.parle-lexer.php                              24-May-2024 16:04               13241
class.parle-lexerexception.php                     24-May-2024 16:04                7789
class.parle-parser.php                             24-May-2024 16:04               18169
class.parle-parserexception.php                    24-May-2024 16:04                7771
class.parle-rlexer.php                             24-May-2024 16:04               15476
class.parle-rparser.php                            24-May-2024 16:04               18342
class.parle-stack.php                              24-May-2024 16:04                4877
class.parle-token.php                              24-May-2024 16:04                4968
class.parseerror.php                               24-May-2024 16:03                8945
class.pdo.php                                      24-May-2024 16:03               42792
class.pdoexception.php                             24-May-2024 16:03               10407
class.pdorow.php                                   24-May-2024 16:03                4097
class.pdostatement.php                             24-May-2024 16:03               23074
class.pgsql-connection.php                         24-May-2024 16:04                1861
class.pgsql-lob.php                                24-May-2024 16:04                1803
class.pgsql-result.php                             24-May-2024 16:04                1835
class.phar.php                                     24-May-2024 16:03               74240
class.phardata.php                                 24-May-2024 16:03               49646
class.pharexception.php                            24-May-2024 16:03                8481
class.pharfileinfo.php                             24-May-2024 16:03               21707
class.php-user-filter.php                          24-May-2024 16:04                6487
class.phptoken.php                                 24-May-2024 16:04                8796
class.pool.php                                     24-May-2024 16:04                7763
class.pspell-config.php                            24-May-2024 16:04                1837
class.pspell-dictionary.php                        24-May-2024 16:04                1874
class.quickhashinthash.php                         24-May-2024 16:04               15151
class.quickhashintset.php                          24-May-2024 16:04               12927
class.quickhashintstringhash.php                   24-May-2024 16:04               16047
class.quickhashstringinthash.php                   24-May-2024 16:04               13716
class.random-brokenrandomengineerror.php           24-May-2024 16:04                8579
class.random-cryptosafeengine.php                  24-May-2024 16:04                2525
class.random-engine-mt19937.php                    24-May-2024 16:04                5419
class.random-engine-pcgoneseq128xslrr64.php        24-May-2024 16:04                6233
class.random-engine-secure.php                     24-May-2024 16:04                3460
class.random-engine-xoshiro256starstar.php         24-May-2024 16:04                6418
class.random-engine.php                            24-May-2024 16:04                3822
class.random-randomerror.php                       24-May-2024 16:04                8503
class.random-randomexception.php                   24-May-2024 16:04                8617
class.random-randomizer.php                        24-May-2024 16:04               10622
class.rangeexception.php                           24-May-2024 16:04                8720
class.rararchive.php                               24-May-2024 16:03                7780
class.rarentry.php                                 24-May-2024 16:03               49838
class.rarexception.php                             24-May-2024 16:03                8341
class.recursivearrayiterator.php                   24-May-2024 16:04               15954
class.recursivecachingiterator.php                 24-May-2024 16:04               14163
class.recursivecallbackfilteriterator.php          24-May-2024 16:04               13237
class.recursivedirectoryiterator.php               24-May-2024 16:04               29857
class.recursivefilteriterator.php                  24-May-2024 16:04                8282
class.recursiveiterator.php                        24-May-2024 16:04                4921
class.recursiveiteratoriterator.php                24-May-2024 16:04               14680
class.recursiveregexiterator.php                   24-May-2024 16:04               14797
class.recursivetreeiterator.php                    24-May-2024 16:04               25690
class.reflection.php                               24-May-2024 16:04                3485
class.reflectionattribute.php                      24-May-2024 16:04                6433
class.reflectionclass.php                          24-May-2024 16:04               37541
class.reflectionclassconstant.php                  24-May-2024 16:04               16297
class.reflectionenum.php                           24-May-2024 16:04               31545
class.reflectionenumbackedcase.php                 24-May-2024 16:04               12989
class.reflectionenumunitcase.php                   24-May-2024 16:04               12610
class.reflectionexception.php                      24-May-2024 16:04                8453
class.reflectionextension.php                      24-May-2024 16:04               10632
class.reflectionfiber.php                          24-May-2024 16:04                5229
class.reflectionfunction.php                       24-May-2024 16:04               21283
class.reflectionfunctionabstract.php               24-May-2024 16:04               19902
class.reflectiongenerator.php                      24-May-2024 16:04                6395
class.reflectionintersectiontype.php               24-May-2024 16:04                3489
class.reflectionmethod.php                         24-May-2024 16:04               32870
class.reflectionnamedtype.php                      24-May-2024 16:04                3801
class.reflectionobject.php                         24-May-2024 16:04               29330
class.reflectionparameter.php                      24-May-2024 16:04               16557
class.reflectionproperty.php                       24-May-2024 16:04               22215
class.reflectionreference.php                      24-May-2024 16:04                4185
class.reflectiontype.php                           24-May-2024 16:04                4536
class.reflectionuniontype.php                      24-May-2024 16:04                3373
class.reflectionzendextension.php                  24-May-2024 16:04                7921
class.reflector.php                                24-May-2024 16:04                3955
class.regexiterator.php                            24-May-2024 16:04               17647
class.resourcebundle.php                           24-May-2024 16:04               10484
class.returntypewillchange.php                     24-May-2024 16:03                3189
class.rnpffi.php                                   24-May-2024 16:03                1694
class.rrdcreator.php                               24-May-2024 16:04                4541
class.rrdgraph.php                                 24-May-2024 16:04                3963
class.rrdupdater.php                               24-May-2024 16:04                3349
class.runtimeexception.php                         24-May-2024 16:04                8498
class.seaslog.php                                  24-May-2024 16:04               21999
class.seekableiterator.php                         24-May-2024 16:04               11377
class.sensitiveparameter.php                       24-May-2024 16:03                6347
class.sensitiveparametervalue.php                  24-May-2024 16:03                4982
class.serializable.php                             24-May-2024 16:03                8136
class.sessionhandler.php                           24-May-2024 16:04               25291
class.sessionhandlerinterface.php                  24-May-2024 16:04               15534
class.sessionidinterface.php                       24-May-2024 16:04                3215
class.sessionupdatetimestamphandlerinterface.php   24-May-2024 16:04                4454
class.shmop.php                                    24-May-2024 16:04                1735
class.simdjsonexception.php                        24-May-2024 16:04                5069
class.simdjsonvalueerror.php                       24-May-2024 16:04                8380
class.simplexmlelement.php                         24-May-2024 16:04               18658
class.simplexmliterator.php                        24-May-2024 16:04               16670
class.snmp.php                                     24-May-2024 16:04               28332
class.snmpexception.php                            24-May-2024 16:04                9084
class.soapclient.php                               24-May-2024 16:04               34302
class.soapfault.php                                24-May-2024 16:04               14354
class.soapheader.php                               24-May-2024 16:04                6083
class.soapparam.php                                24-May-2024 16:04                3761
class.soapserver.php                               24-May-2024 16:04                9957
class.soapvar.php                                  24-May-2024 16:04                7895
class.socket.php                                   24-May-2024 16:04                1799
class.sodiumexception.php                          24-May-2024 16:03                8430
class.solrclient.php                               24-May-2024 16:04               24761
class.solrclientexception.php                      24-May-2024 16:04                9738
class.solrcollapsefunction.php                     24-May-2024 16:04               11821
class.solrdismaxquery.php                          24-May-2024 16:04              111921
class.solrdocument.php                             24-May-2024 16:04               23476
class.solrdocumentfield.php                        24-May-2024 16:04                4688
class.solrexception.php                            24-May-2024 16:04               10125
class.solrgenericresponse.php                      24-May-2024 16:04               12685
class.solrillegalargumentexception.php             24-May-2024 16:04                9862
class.solrillegaloperationexception.php            24-May-2024 16:04                9900
class.solrinputdocument.php                        24-May-2024 16:04               19515
class.solrmissingmandatoryparameterexception.php   24-May-2024 16:04                9025
class.solrmodifiableparams.php                     24-May-2024 16:04                9008
class.solrobject.php                               24-May-2024 16:04                5879
class.solrparams.php                               24-May-2024 16:04                9164
class.solrpingresponse.php                         24-May-2024 16:04               11157
class.solrquery.php                                24-May-2024 16:04              119023
class.solrqueryresponse.php                        24-May-2024 16:04               12604
class.solrresponse.php                             24-May-2024 16:04               14354
class.solrserverexception.php                      24-May-2024 16:04                9744
class.solrupdateresponse.php                       24-May-2024 16:04               12652
class.solrutils.php                                24-May-2024 16:04                4977
class.spldoublylinkedlist.php                      24-May-2024 16:04               17484
class.splfileinfo.php                              24-May-2024 16:04               18068
class.splfileobject.php                            24-May-2024 16:04               37273
class.splfixedarray.php                            24-May-2024 16:04               19906
class.splheap.php                                  24-May-2024 16:04                7791
class.splmaxheap.php                               24-May-2024 16:04                7227
class.splminheap.php                               24-May-2024 16:04                7237
class.splobjectstorage.php                         24-May-2024 16:04               21124
class.splobserver.php                              24-May-2024 16:04                2869
class.splpriorityqueue.php                         24-May-2024 16:04               11822
class.splqueue.php                                 24-May-2024 16:04               17189
class.splstack.php                                 24-May-2024 16:04               14403
class.splsubject.php                               24-May-2024 16:04                3738
class.spltempfileobject.php                        24-May-2024 16:04               31837
class.spoofchecker.php                             24-May-2024 16:04               17632
class.sqlite3.php                                  24-May-2024 16:04               39742
class.sqlite3exception.php                         24-May-2024 16:04                8422
class.sqlite3result.php                            24-May-2024 16:04                5845
class.sqlite3stmt.php                              24-May-2024 16:04                8325
class.stdclass.php                                 24-May-2024 16:03                6644
class.stomp.php                                    24-May-2024 16:04               21705
class.stompexception.php                           24-May-2024 16:04                5897
class.stompframe.php                               24-May-2024 16:04                4387
class.streamwrapper.php                            24-May-2024 16:04               20272
class.stringable.php                               24-May-2024 16:03                8200
class.svm.php                                      24-May-2024 16:04               18488
class.svmmodel.php                                 24-May-2024 16:04                6961
class.swoole-async.php                             24-May-2024 16:04                8053
class.swoole-atomic.php                            24-May-2024 16:04                5082
class.swoole-buffer.php                            24-May-2024 16:04                7537
class.swoole-channel.php                           24-May-2024 16:04                3980
class.swoole-client.php                            24-May-2024 16:04               16544
class.swoole-connection-iterator.php               24-May-2024 16:04                7533
class.swoole-coroutine.php                         24-May-2024 16:04               18669
class.swoole-event.php                             24-May-2024 16:04                7476
class.swoole-exception.php                         24-May-2024 16:04                4584
class.swoole-http-client.php                       24-May-2024 16:04               14796
class.swoole-http-request.php                      24-May-2024 16:04                3045
class.swoole-http-response.php                     24-May-2024 16:04               10921
class.swoole-http-server.php                       24-May-2024 16:04               26447
class.swoole-lock.php                              24-May-2024 16:04                4690
class.swoole-mmap.php                              24-May-2024 16:04                3091
class.swoole-mysql-exception.php                   24-May-2024 16:04                4625
class.swoole-mysql.php                             24-May-2024 16:04                5429
class.swoole-process.php                           24-May-2024 16:04               13677
class.swoole-redis-server.php                      24-May-2024 16:04               32078
class.swoole-serialize.php                         24-May-2024 16:04                3623
class.swoole-server.php                            24-May-2024 16:04               29588
class.swoole-table.php                             24-May-2024 16:04               12727
class.swoole-timer.php                             24-May-2024 16:04                5011
class.swoole-websocket-frame.php                   24-May-2024 16:04                1957
class.swoole-websocket-server.php                  24-May-2024 16:04                7840
class.syncevent.php                                24-May-2024 16:04                4909
class.syncmutex.php                                24-May-2024 16:04                4230
class.syncreaderwriter.php                         24-May-2024 16:04                5218
class.syncsemaphore.php                            24-May-2024 16:04                4666
class.syncsharedmemory.php                         24-May-2024 16:04                5516
class.sysvmessagequeue.php                         24-May-2024 16:04                1845
class.sysvsemaphore.php                            24-May-2024 16:04                1830
class.sysvsharedmemory.php                         24-May-2024 16:04                1833
class.thread.php                                   24-May-2024 16:04               11431
class.threaded.php                                 24-May-2024 16:04                8852
class.throwable.php                                24-May-2024 16:03                7192
class.tidy.php                                     24-May-2024 16:04               18883
class.tidynode.php                                 24-May-2024 16:04               11609
class.transliterator.php                           24-May-2024 16:04               10196
class.traversable.php                              24-May-2024 16:03                4330
class.typeerror.php                                24-May-2024 16:03                9456
class.uconverter.php                               24-May-2024 16:04               41036
class.ui-area.php                                  24-May-2024 16:04               12259
class.ui-control.php                               24-May-2024 16:04                5488
class.ui-controls-box.php                          24-May-2024 16:04               10125
class.ui-controls-button.php                       24-May-2024 16:04                6688
class.ui-controls-check.php                        24-May-2024 16:04                7532
class.ui-controls-colorbutton.php                  24-May-2024 16:04                6567
class.ui-controls-combo.php                        24-May-2024 16:04                6656
class.ui-controls-editablecombo.php                24-May-2024 16:04                6768
class.ui-controls-entry.php                        24-May-2024 16:04                9649
class.ui-controls-form.php                         24-May-2024 16:04                8055
class.ui-controls-grid.php                         24-May-2024 16:04               13156
class.ui-controls-group.php                        24-May-2024 16:04                8363
class.ui-controls-label.php                        24-May-2024 16:04                6439
class.ui-controls-multilineentry.php               24-May-2024 16:04                9892
class.ui-controls-picker.php                       24-May-2024 16:04                7581
class.ui-controls-progress.php                     24-May-2024 16:04                5940
class.ui-controls-radio.php                        24-May-2024 16:04                6635
class.ui-controls-separator.php                    24-May-2024 16:04                7085
class.ui-controls-slider.php                       24-May-2024 16:04                7023
class.ui-controls-spin.php                         24-May-2024 16:04                6893
class.ui-controls-tab.php                          24-May-2024 16:04                9161
class.ui-draw-brush-gradient.php                   24-May-2024 16:04                7348
class.ui-draw-brush-lineargradient.php             24-May-2024 16:04                6602
class.ui-draw-brush-radialgradient.php             24-May-2024 16:04                6788
class.ui-draw-brush.php                            24-May-2024 16:04                4448
class.ui-draw-color.php                            24-May-2024 16:04                8594
class.ui-draw-line-cap.php                         24-May-2024 16:04                3748
class.ui-draw-line-join.php                        24-May-2024 16:04                3732
class.ui-draw-matrix.php                           24-May-2024 16:04                5638
class.ui-draw-path.php                             24-May-2024 16:04               10773
class.ui-draw-pen.php                              24-May-2024 16:04                8145
class.ui-draw-stroke.php                           24-May-2024 16:04                6896
class.ui-draw-text-font-descriptor.php             24-May-2024 16:04                6058
class.ui-draw-text-font-italic.php                 24-May-2024 16:04                4107
class.ui-draw-text-font-stretch.php                24-May-2024 16:04                8303
class.ui-draw-text-font-weight.php                 24-May-2024 16:04                8905
class.ui-draw-text-font.php                        24-May-2024 16:04                4887
class.ui-draw-text-layout.php                      24-May-2024 16:04                5297
class.ui-exception-invalidargumentexception.php    24-May-2024 16:04                7807
class.ui-exception-runtimeexception.php            24-May-2024 16:04                7730
class.ui-executor.php                              24-May-2024 16:04                5448
class.ui-key.php                                   24-May-2024 16:04               21347
class.ui-menu.php                                  24-May-2024 16:04                6306
class.ui-menuitem.php                              24-May-2024 16:04                3776
class.ui-point.php                                 24-May-2024 16:04                6321
class.ui-size.php                                  24-May-2024 16:04                6416
class.ui-window.php                                24-May-2024 16:04               13105
class.underflowexception.php                       24-May-2024 16:04                8582
class.unexpectedvalueexception.php                 24-May-2024 16:04                8741
class.unhandledmatcherror.php                      24-May-2024 16:03                8605
class.unitenum.php                                 24-May-2024 16:03                2801
class.v8js.php                                     24-May-2024 16:04                9061
class.v8jsexception.php                            24-May-2024 16:04               11367
class.valueerror.php                               24-May-2024 16:03                8542
class.variant.php                                  24-May-2024 16:04                5686
class.varnishadmin.php                             24-May-2024 16:04               11548
class.varnishlog.php                               24-May-2024 16:04               34807
class.varnishstat.php                              24-May-2024 16:04                3025
class.volatile.php                                 24-May-2024 16:04               11750
class.vtiful-kernel-excel.php                      24-May-2024 16:04               12053
class.vtiful-kernel-format.php                     24-May-2024 16:04               16090
class.weakmap.php                                  24-May-2024 16:03                9358
class.weakreference.php                            24-May-2024 16:03                5631
class.win32serviceexception.php                    24-May-2024 16:04                7834
class.wkhtmltox-image-converter.php                24-May-2024 16:04                4175
class.wkhtmltox-pdf-converter.php                  24-May-2024 16:04                4503
class.wkhtmltox-pdf-object.php                     24-May-2024 16:04                3015
class.worker.php                                   24-May-2024 16:04                8562
class.xmldiff-base.php                             24-May-2024 16:04                4138
class.xmldiff-dom.php                              24-May-2024 16:04                5091
class.xmldiff-file.php                             24-May-2024 16:04                5067
class.xmldiff-memory.php                           24-May-2024 16:04                5099
class.xmlparser.php                                24-May-2024 16:04                1816
class.xmlreader.php                                24-May-2024 16:04               40822
class.xmlwriter.php                                24-May-2024 16:04               32393
class.xsltprocessor.php                            24-May-2024 16:04               11545
class.yac.php                                      24-May-2024 16:03                9572
class.yaconf.php                                   24-May-2024 16:04                3502
class.yaf-action-abstract.php                      24-May-2024 16:04               12747
class.yaf-application.php                          24-May-2024 16:04               12683
class.yaf-bootstrap-abstract.php                   24-May-2024 16:04                5568
class.yaf-config-abstract.php                      24-May-2024 16:04                5241
class.yaf-config-ini.php                           24-May-2024 16:04               17818
class.yaf-config-simple.php                        24-May-2024 16:04               13249
class.yaf-controller-abstract.php                  24-May-2024 16:04               19218
class.yaf-dispatcher.php                           24-May-2024 16:04               20277
class.yaf-exception-dispatchfailed.php             24-May-2024 16:04                2666
class.yaf-exception-loadfailed-action.php          24-May-2024 16:04                2737
class.yaf-exception-loadfailed-controller.php      24-May-2024 16:04                2762
class.yaf-exception-loadfailed-module.php          24-May-2024 16:04                2726
class.yaf-exception-loadfailed-view.php            24-May-2024 16:04                2666
class.yaf-exception-loadfailed.php                 24-May-2024 16:04                2640
class.yaf-exception-routerfailed.php               24-May-2024 16:04                2651
class.yaf-exception-startuperror.php               24-May-2024 16:04                2649
class.yaf-exception-typeerror.php                  24-May-2024 16:04                2620
class.yaf-exception.php                            24-May-2024 16:04                8511
class.yaf-loader.php                               24-May-2024 16:04               18776
class.yaf-plugin-abstract.php                      24-May-2024 16:04               16069
class.yaf-registry.php                             24-May-2024 16:04                6053
class.yaf-request-abstract.php                     24-May-2024 16:04               23764
class.yaf-request-http.php                         24-May-2024 16:04               23234
class.yaf-request-simple.php                       24-May-2024 16:04               22714
class.yaf-response-abstract.php                    24-May-2024 16:04               11835
class.yaf-route-interface.php                      24-May-2024 16:04                3759
class.yaf-route-map.php                            24-May-2024 16:04                6529
class.yaf-route-regex.php                          24-May-2024 16:04                8421
class.yaf-route-rewrite.php                        24-May-2024 16:04                7525
class.yaf-route-simple.php                         24-May-2024 16:04                6602
class.yaf-route-static.php                         24-May-2024 16:04                5079
class.yaf-route-supervar.php                       24-May-2024 16:04                4767
class.yaf-router.php                               24-May-2024 16:04               12012
class.yaf-session.php                              24-May-2024 16:04               12668
class.yaf-view-interface.php                       24-May-2024 16:04                6088
class.yaf-view-simple.php                          24-May-2024 16:04               11303
class.yar-client-exception.php                     24-May-2024 16:04                6651
class.yar-client.php                               24-May-2024 16:04                5856
class.yar-concurrent-client.php                    24-May-2024 16:04                6656
class.yar-server-exception.php                     24-May-2024 16:04                7108
class.yar-server.php                               24-May-2024 16:04                3504
class.ziparchive.php                               24-May-2024 16:03               90008
class.zmq.php                                      24-May-2024 16:04               41115
class.zmqcontext.php                               24-May-2024 16:04                5635
class.zmqdevice.php                                24-May-2024 16:04                7084
class.zmqpoll.php                                  24-May-2024 16:04                5220
class.zmqsocket.php                                24-May-2024 16:04               11497
class.zookeeper.php                                24-May-2024 16:04               56128
class.zookeeperauthenticationexception.php         24-May-2024 16:04                7737
class.zookeeperconfig.php                          24-May-2024 16:04                6468
class.zookeeperconnectionexception.php             24-May-2024 16:04                7732
class.zookeeperexception.php                       24-May-2024 16:04                7598
class.zookeepermarshallingexception.php            24-May-2024 16:04                7753
class.zookeepernonodeexception.php                 24-May-2024 16:04                7720
class.zookeeperoperationtimeoutexception.php       24-May-2024 16:04                7763
class.zookeepersessionexception.php                24-May-2024 16:04                7690
classobj.configuration.php                         24-May-2024 16:04                1314
classobj.constants.php                             24-May-2024 16:04                1216
classobj.examples.php                              24-May-2024 16:04               13367
classobj.installation.php                          24-May-2024 16:04                1293
classobj.requirements.php                          24-May-2024 16:04                1250
classobj.resources.php                             24-May-2024 16:04                1253
classobj.setup.php                                 24-May-2024 16:04                1653
closure.bind.php                                   24-May-2024 16:03                7989
closure.bindto.php                                 24-May-2024 16:03                9623
closure.call.php                                   24-May-2024 16:03                6364
closure.construct.php                              24-May-2024 16:03                2508
closure.fromcallable.php                           24-May-2024 16:03                3810
cmark.constants.php                                24-May-2024 16:04                4267
cmark.installation.php                             24-May-2024 16:04                1984
cmark.requirements.php                             24-May-2024 16:04                1330
cmark.setup.php                                    24-May-2024 16:04                1477
collator.asort.php                                 24-May-2024 16:04                9548
collator.compare.php                               24-May-2024 16:04               10577
collator.construct.php                             24-May-2024 16:04                5668
collator.create.php                                24-May-2024 16:04                5608
collator.getattribute.php                          24-May-2024 16:04                6106
collator.geterrorcode.php                          24-May-2024 16:04                5300
collator.geterrormessage.php                       24-May-2024 16:04                5371
collator.getlocale.php                             24-May-2024 16:04                6888
collator.getsortkey.php                            24-May-2024 16:04                7015
collator.getstrength.php                           24-May-2024 16:04                4912
collator.setattribute.php                          24-May-2024 16:04                6717
collator.setstrength.php                           24-May-2024 16:04               13293
collator.sort.php                                  24-May-2024 16:04                8358
collator.sortwithsortkeys.php                      24-May-2024 16:04                6573
collectable.isgarbage.php                          24-May-2024 16:04                3471
com.configuration.php                              24-May-2024 16:04                8346
com.constants.php                                  24-May-2024 16:04               26283
com.construct.php                                  24-May-2024 16:04                9520
com.error-handling.php                             24-May-2024 16:04                1624
com.examples.arrays.php                            24-May-2024 16:04                2111
com.examples.foreach.php                           24-May-2024 16:04                2892
com.examples.php                                   24-May-2024 16:04                1473
com.installation.php                               24-May-2024 16:04                1538
com.requirements.php                               24-May-2024 16:04                1290
com.resources.php                                  24-May-2024 16:04                1218
com.setup.php                                      24-May-2024 16:04                1605
commonmark-cql.construct.php                       24-May-2024 16:04                2246
commonmark-cql.invoke.php                          24-May-2024 16:04                3924
commonmark-interfaces-ivisitable.accept.php        24-May-2024 16:04                3165
commonmark-interfaces-ivisitor.enter.php           24-May-2024 16:04                4198
commonmark-interfaces-ivisitor.leave.php           24-May-2024 16:04                4200
commonmark-node-bulletlist.construct.php           24-May-2024 16:04                3239
commonmark-node-codeblock.construct.php            24-May-2024 16:04                2887
commonmark-node-heading.construct.php              24-May-2024 16:04                2680
commonmark-node-image.construct.php                24-May-2024 16:04                3330
commonmark-node-link.construct.php                 24-May-2024 16:04                3327
commonmark-node-orderedlist.construct.php          24-May-2024 16:04                4215
commonmark-node-text.construct.php                 24-May-2024 16:04                2715
commonmark-node.accept.php                         24-May-2024 16:04                2905
commonmark-node.appendchild.php                    24-May-2024 16:04                2759
commonmark-node.insertafter.php                    24-May-2024 16:04                2784
commonmark-node.insertbefore.php                   24-May-2024 16:04                2782
commonmark-node.prependchild.php                   24-May-2024 16:04                2786
commonmark-node.replace.php                        24-May-2024 16:04                2730
commonmark-node.unlink.php                         24-May-2024 16:04                2434
commonmark-parser.construct.php                    24-May-2024 16:04                3860
commonmark-parser.finish.php                       24-May-2024 16:04                2464
commonmark-parser.parse.php                        24-May-2024 16:04                2689
compersisthelper.construct.php                     24-May-2024 16:04                3653
compersisthelper.getcurfilename.php                24-May-2024 16:04                3177
compersisthelper.getmaxstreamsize.php              24-May-2024 16:04                3183
compersisthelper.initnew.php                       24-May-2024 16:04                3141
compersisthelper.loadfromfile.php                  24-May-2024 16:04                4351
compersisthelper.loadfromstream.php                24-May-2024 16:04                3568
compersisthelper.savetofile.php                    24-May-2024 16:04                6351
compersisthelper.savetostream.php                  24-May-2024 16:04                3595
componere-abstract-definition.addinterface.php     24-May-2024 16:03                3298
componere-abstract-definition.addmethod.php        24-May-2024 16:03                4024
componere-abstract-definition.addtrait.php         24-May-2024 16:03                3250
componere-abstract-definition.getreflector.php     24-May-2024 16:03                2422
componere-definition.addconstant.php               24-May-2024 16:03                4347
componere-definition.addproperty.php               24-May-2024 16:03                3756
componere-definition.construct.php                 24-May-2024 16:03                5985
componere-definition.getclosure.php                24-May-2024 16:03                3462
componere-definition.getclosures.php               24-May-2024 16:03                2704
componere-definition.isregistered.php              24-May-2024 16:03                2304
componere-definition.register.php                  24-May-2024 16:03                2449
componere-method.construct.php                     24-May-2024 16:03                2242
componere-method.getreflector.php                  24-May-2024 16:03                2225
componere-method.setprivate.php                    24-May-2024 16:03                2453
componere-method.setprotected.php                  24-May-2024 16:03                2468
componere-method.setstatic.php                     24-May-2024 16:03                2050
componere-patch.apply.php                          24-May-2024 16:03                1907
componere-patch.construct.php                      24-May-2024 16:03                3654
componere-patch.derive.php                         24-May-2024 16:03                3155
componere-patch.getclosure.php                     24-May-2024 16:03                3092
componere-patch.getclosures.php                    24-May-2024 16:03                2225
componere-patch.isapplied.php                      24-May-2024 16:03                1861
componere-patch.revert.php                         24-May-2024 16:03                1904
componere-value.construct.php                      24-May-2024 16:03                2675
componere-value.hasdefault.php                     24-May-2024 16:03                1907
componere-value.isprivate.php                      24-May-2024 16:03                1926
componere-value.isprotected.php                    24-May-2024 16:03                1936
componere-value.isstatic.php                       24-May-2024 16:03                1920
componere-value.setprivate.php                     24-May-2024 16:03                2476
componere-value.setprotected.php                   24-May-2024 16:03                2490
componere-value.setstatic.php                      24-May-2024 16:03                2067
componere.cast.php                                 24-May-2024 16:03                4922
componere.cast_by_ref.php                          24-May-2024 16:03                5095
componere.installation.php                         24-May-2024 16:03                1373
componere.requirements.php                         24-May-2024 16:03                1220
componere.setup.php                                24-May-2024 16:03                1516
configuration.changes.modes.php                    24-May-2024 16:03                3904
configuration.changes.php                          24-May-2024 16:03                8477
configuration.file.per-user.php                    24-May-2024 16:03                2986
configuration.file.php                             24-May-2024 16:03                9772
configuration.php                                  24-May-2024 16:03                1710
configure.about.php                                24-May-2024 16:04               12158
configure.php                                      24-May-2024 16:04                1431
context.ftp.php                                    24-May-2024 16:03                4191
context.http.php                                   24-May-2024 16:03               15663
context.params.php                                 24-May-2024 16:03                2583
context.phar.php                                   24-May-2024 16:03                2771
context.php                                        24-May-2024 16:03                2852
context.socket.php                                 24-May-2024 16:03                9367
context.ssl.php                                    24-May-2024 16:03               12384
context.zip.php                                    24-May-2024 16:03                4197
context.zlib.php                                   24-May-2024 16:03                2460
control-structures.alternative-syntax.php          24-May-2024 16:03                7039
control-structures.break.php                       24-May-2024 16:03                4679
control-structures.continue.php                    24-May-2024 16:03                7048
control-structures.declare.php                     24-May-2024 16:03               10006
control-structures.do.while.php                    24-May-2024 16:03                5040
control-structures.else.php                        24-May-2024 16:03                4794
control-structures.elseif.php                      24-May-2024 16:03                7613
control-structures.for.php                         24-May-2024 16:03               11615
control-structures.foreach.php                     24-May-2024 16:03               20667
control-structures.goto.php                        24-May-2024 16:03                7208
control-structures.if.php                          24-May-2024 16:03                4823
control-structures.intro.php                       24-May-2024 16:03                2578
control-structures.match.php                       24-May-2024 16:03               16494
control-structures.switch.php                      24-May-2024 16:03               18483
control-structures.while.php                       24-May-2024 16:03                4641
copyright.php                                      24-May-2024 16:03                2053
countable.count.php                                24-May-2024 16:04                5429
ctype.configuration.php                            24-May-2024 16:04                1293
ctype.constants.php                                24-May-2024 16:04                1189
ctype.installation.php                             24-May-2024 16:04                1558
ctype.requirements.php                             24-May-2024 16:04                1255
ctype.resources.php                                24-May-2024 16:04                1232
ctype.setup.php                                    24-May-2024 16:04                1613
cubrid.configuration.php                           24-May-2024 16:03                1241
cubrid.constants.php                               24-May-2024 16:03               13825
cubrid.examples.php                                24-May-2024 16:03               13852
cubrid.installation.php                            24-May-2024 16:03                2150
cubrid.requirements.php                            24-May-2024 16:03                1296
cubrid.resources.php                               24-May-2024 16:03                3124
cubrid.setup.php                                   24-May-2024 16:03                1627
cubridmysql.cubrid.php                             24-May-2024 16:03                4969
curl.configuration.php                             24-May-2024 16:04                2574
curl.constants.php                                 24-May-2024 16:04              195534
curl.examples-basic.php                            24-May-2024 16:04                4584
curl.examples.php                                  24-May-2024 16:04                1401
curl.installation.php                              24-May-2024 16:04                2425
curl.requirements.php                              24-May-2024 16:04                1595
curl.resources.php                                 24-May-2024 16:04                1270
curl.setup.php                                     24-May-2024 16:04                1622
curlfile.construct.php                             24-May-2024 16:04               21231
curlfile.getfilename.php                           24-May-2024 16:04                2178
curlfile.getmimetype.php                           24-May-2024 16:04                2184
curlfile.getpostfilename.php                       24-May-2024 16:04                2234
curlfile.setmimetype.php                           24-May-2024 16:04                2473
curlfile.setpostfilename.php                       24-May-2024 16:04                2514
curlstringfile.construct.php                       24-May-2024 16:04                7005
dateinterval.construct.php                         24-May-2024 16:04               13444
dateinterval.createfromdatestring.php              24-May-2024 16:04               15556
dateinterval.format.php                            24-May-2024 16:04               14598
dateperiod.construct.php                           24-May-2024 16:04               19775
dateperiod.createfromiso8601string.php             24-May-2024 16:04                7889
dateperiod.getdateinterval.php                     24-May-2024 16:04                4800
dateperiod.getenddate.php                          24-May-2024 16:04                7745
dateperiod.getrecurrences.php                      24-May-2024 16:04                8897
dateperiod.getstartdate.php                        24-May-2024 16:04                5267
datetime.add.php                                   24-May-2024 16:04                4900
datetime.configuration.php                         24-May-2024 16:04                5951
datetime.constants.php                             24-May-2024 16:04                2919
datetime.construct.php                             24-May-2024 16:04                6229
datetime.createfromformat.php                      24-May-2024 16:04                7346
datetime.createfromimmutable.php                   24-May-2024 16:04                4880
datetime.createfrominterface.php                   24-May-2024 16:04                4859
datetime.diff.php                                  24-May-2024 16:04               17201
datetime.error.tree.php                            24-May-2024 16:04                3325
datetime.examples-arithmetic.php                   24-May-2024 16:04               15137
datetime.examples.php                              24-May-2024 16:04                1457
datetime.format.php                                24-May-2024 16:04               26772
datetime.formats.php                               24-May-2024 16:04               55212
datetime.getlasterrors.php                         24-May-2024 16:04                1889
datetime.getoffset.php                             24-May-2024 16:04                7902
datetime.gettimestamp.php                          24-May-2024 16:04               10247
datetime.gettimezone.php                           24-May-2024 16:04                7817
datetime.installation.php                          24-May-2024 16:04                1650
datetime.modify.php                                24-May-2024 16:04               14261
datetime.requirements.php                          24-May-2024 16:04                1250
datetime.resources.php                             24-May-2024 16:04                1253
datetime.set-state.php                             24-May-2024 16:04                2885
datetime.setdate.php                               24-May-2024 16:04                5558
datetime.setisodate.php                            24-May-2024 16:04                5727
datetime.settime.php                               24-May-2024 16:04                7063
datetime.settimestamp.php                          24-May-2024 16:04                5022
datetime.settimezone.php                           24-May-2024 16:04                9325
datetime.setup.php                                 24-May-2024 16:04                1677
datetime.sub.php                                   24-May-2024 16:04                6263
datetime.wakeup.php                                24-May-2024 16:04                3062
datetimeimmutable.add.php                          24-May-2024 16:04               10523
datetimeimmutable.construct.php                    24-May-2024 16:04               18438
datetimeimmutable.createfromformat.php             24-May-2024 16:04               47008
datetimeimmutable.createfrominterface.php          24-May-2024 16:04                5123
datetimeimmutable.createfrommutable.php            24-May-2024 16:04                5037
datetimeimmutable.getlasterrors.php                24-May-2024 16:04                5636
datetimeimmutable.modify.php                       24-May-2024 16:04                9304
datetimeimmutable.set-state.php                    24-May-2024 16:04                2800
datetimeimmutable.setdate.php                      24-May-2024 16:04                9161
datetimeimmutable.setisodate.php                   24-May-2024 16:04               12751
datetimeimmutable.settime.php                      24-May-2024 16:04               11973
datetimeimmutable.settimestamp.php                 24-May-2024 16:04                5794
datetimeimmutable.settimezone.php                  24-May-2024 16:04                5981
datetimeimmutable.sub.php                          24-May-2024 16:04               11973
datetimezone.construct.php                         24-May-2024 16:04               10634
datetimezone.getlocation.php                       24-May-2024 16:04                5940
datetimezone.getname.php                           24-May-2024 16:04                3646
datetimezone.getoffset.php                         24-May-2024 16:04                7036
datetimezone.gettransitions.php                    24-May-2024 16:04               12153
datetimezone.listabbreviations.php                 24-May-2024 16:04                6060
datetimezone.listidentifiers.php                   24-May-2024 16:04               14603
dba.configuration.php                              24-May-2024 16:03                2334
dba.constants.php                                  24-May-2024 16:03                2179
dba.example.php                                    24-May-2024 16:03                6222
dba.examples.php                                   24-May-2024 16:03                1362
dba.installation.php                               24-May-2024 16:03                9438
dba.requirements.php                               24-May-2024 16:03                7296
dba.resources.php                                  24-May-2024 16:03                1488
dba.setup.php                                      24-May-2024 16:03                1608
dbase.configuration.php                            24-May-2024 16:03                1293
dbase.constants.php                                24-May-2024 16:03                3671
dbase.installation.php                             24-May-2024 16:03                1645
dbase.requirements.php                             24-May-2024 16:03                1229
dbase.resources.php                                24-May-2024 16:03                1500
dbase.setup.php                                    24-May-2024 16:03                1629
debugger-about.php                                 24-May-2024 16:04                1748
debugger.php                                       24-May-2024 16:04                1400
dio.configuration.php                              24-May-2024 16:04                1279
dio.constants.php                                  24-May-2024 16:04               11032
dio.installation.php                               24-May-2024 16:04                2078
dio.requirements.php                               24-May-2024 16:04                1215
dio.resources.php                                  24-May-2024 16:04                1346
dio.setup.php                                      24-May-2024 16:04                1610
dir.configuration.php                              24-May-2024 16:04                1279
dir.constants.php                                  24-May-2024 16:04                2811
dir.installation.php                               24-May-2024 16:04                1258
dir.requirements.php                               24-May-2024 16:04                1215
dir.resources.php                                  24-May-2024 16:04                1218
dir.setup.php                                      24-May-2024 16:04                1604
directory.close.php                                24-May-2024 16:04                2213
directory.read.php                                 24-May-2024 16:04                2347
directory.rewind.php                               24-May-2024 16:04                2224
directoryiterator.construct.php                    24-May-2024 16:04                5819
directoryiterator.current.php                      24-May-2024 16:04                6107
directoryiterator.getbasename.php                  24-May-2024 16:04                6405
directoryiterator.getextension.php                 24-May-2024 16:04                6148
directoryiterator.getfilename.php                  24-May-2024 16:04                5140
directoryiterator.isdot.php                        24-May-2024 16:04                5333
directoryiterator.key.php                          24-May-2024 16:04                6567
directoryiterator.next.php                         24-May-2024 16:04                5461
directoryiterator.rewind.php                       24-May-2024 16:04                5379
directoryiterator.seek.php                         24-May-2024 16:04                5322
directoryiterator.tostring.php                     24-May-2024 16:04                4652
directoryiterator.valid.php                        24-May-2024 16:04                5773
doc.changelog.php                                  24-May-2024 16:04                1352
dom.configuration.php                              24-May-2024 16:04                1279
dom.constants.php                                  24-May-2024 16:04               19744
dom.examples.php                                   24-May-2024 16:04                2976
dom.installation.php                               24-May-2024 16:04                1358
dom.requirements.php                               24-May-2024 16:04                1510
dom.resources.php                                  24-May-2024 16:04                1218
dom.setup.php                                      24-May-2024 16:04                1598
domattr.construct.php                              24-May-2024 16:04                5595
domattr.isid.php                                   24-May-2024 16:04                5050
domcdatasection.construct.php                      24-May-2024 16:04                5174
domcharacterdata.after.php                         24-May-2024 16:04                7767
domcharacterdata.appenddata.php                    24-May-2024 16:04                4412
domcharacterdata.before.php                        24-May-2024 16:04                7395
domcharacterdata.deletedata.php                    24-May-2024 16:04                5097
domcharacterdata.insertdata.php                    24-May-2024 16:04                4821
domcharacterdata.remove.php                        24-May-2024 16:04                5420
domcharacterdata.replacedata.php                   24-May-2024 16:04                5489
domcharacterdata.replacewith.php                   24-May-2024 16:04                7851
domcharacterdata.substringdata.php                 24-May-2024 16:04                4935
domchildnode.after.php                             24-May-2024 16:04                5691
domchildnode.before.php                            24-May-2024 16:04                5117
domchildnode.remove.php                            24-May-2024 16:04                3133
domchildnode.replacewith.php                       24-May-2024 16:04                5309
domcomment.construct.php                           24-May-2024 16:04                5005
domdocument.adoptnode.php                          24-May-2024 16:04                6718
domdocument.append.php                             24-May-2024 16:04                6818
domdocument.construct.php                          24-May-2024 16:04                4393
domdocument.createattribute.php                    24-May-2024 16:04                5880
domdocument.createattributens.php                  24-May-2024 16:04                8201
domdocument.createcdatasection.php                 24-May-2024 16:04                5492
domdocument.createcomment.php                      24-May-2024 16:04                5877
domdocument.createdocumentfragment.php             24-May-2024 16:04                5712
domdocument.createelement.php                      24-May-2024 16:04               11313
domdocument.createelementns.php                    24-May-2024 16:04               14036
domdocument.createentityreference.php              24-May-2024 16:04                6197
domdocument.createprocessinginstruction.php        24-May-2024 16:04                6517
domdocument.createtextnode.php                     24-May-2024 16:04                5865
domdocument.getelementbyid.php                     24-May-2024 16:04                7679
domdocument.getelementsbytagname.php               24-May-2024 16:04                6052
domdocument.getelementsbytagnamens.php             24-May-2024 16:04                7697
domdocument.importnode.php                         24-May-2024 16:04                8941
domdocument.load.php                               24-May-2024 16:04                6628
domdocument.loadhtml.php                           24-May-2024 16:04                7821
domdocument.loadhtmlfile.php                       24-May-2024 16:04                7940
domdocument.loadxml.php                            24-May-2024 16:04                6343
domdocument.normalizedocument.php                  24-May-2024 16:04                2994
domdocument.prepend.php                            24-May-2024 16:04                6910
domdocument.registernodeclass.php                  24-May-2024 16:04               15261
domdocument.relaxngvalidate.php                    24-May-2024 16:04                4055
domdocument.relaxngvalidatesource.php              24-May-2024 16:04                4110
domdocument.replacechildren.php                    24-May-2024 16:04                7207
domdocument.save.php                               24-May-2024 16:04                7609
domdocument.savehtml.php                           24-May-2024 16:04                7544
domdocument.savehtmlfile.php                       24-May-2024 16:04                7985
domdocument.savexml.php                            24-May-2024 16:04                9737
domdocument.schemavalidate.php                     24-May-2024 16:04                4441
domdocument.schemavalidatesource.php               24-May-2024 16:04                4503
domdocument.validate.php                           24-May-2024 16:04                6079
domdocument.xinclude.php                           24-May-2024 16:04                7172
domdocumentfragment.append.php                     24-May-2024 16:04                7508
domdocumentfragment.appendxml.php                  24-May-2024 16:04                5583
domdocumentfragment.construct.php                  24-May-2024 16:04                2164
domdocumentfragment.prepend.php                    24-May-2024 16:04                7566
domdocumentfragment.replacechildren.php            24-May-2024 16:04                7951
domelement.after.php                               24-May-2024 16:04                7445
domelement.append.php                              24-May-2024 16:04                7130
domelement.before.php                              24-May-2024 16:04                7030
domelement.construct.php                           24-May-2024 16:04                6681
domelement.getattribute.php                        24-May-2024 16:04                3560
domelement.getattributenames.php                   24-May-2024 16:04                3985
domelement.getattributenode.php                    24-May-2024 16:04                4109
domelement.getattributenodens.php                  24-May-2024 16:04                4599
domelement.getattributens.php                      24-May-2024 16:04                4102
domelement.getelementsbytagname.php                24-May-2024 16:04                3667
domelement.getelementsbytagnamens.php              24-May-2024 16:04                4760
domelement.hasattribute.php                        24-May-2024 16:04                3859
domelement.hasattributens.php                      24-May-2024 16:04                4331
domelement.insertadjacentelement.php               24-May-2024 16:04                6662
domelement.insertadjacenttext.php                  24-May-2024 16:04                6482
domelement.prepend.php                             24-May-2024 16:04                7180
domelement.remove.php                              24-May-2024 16:04                5063
domelement.removeattribute.php                     24-May-2024 16:04                4074
domelement.removeattributenode.php                 24-May-2024 16:04                4428
domelement.removeattributens.php                   24-May-2024 16:04                4355
domelement.replacechildren.php                     24-May-2024 16:04                7771
domelement.replacewith.php                         24-May-2024 16:04                7835
domelement.setattribute.php                        24-May-2024 16:04                6217
domelement.setattributenode.php                    24-May-2024 16:04                4772
domelement.setattributenodens.php                  24-May-2024 16:04                4839
domelement.setattributens.php                      24-May-2024 16:04                5284
domelement.setidattribute.php                      24-May-2024 16:04                4810
domelement.setidattributenode.php                  24-May-2024 16:04                4804
domelement.setidattributens.php                    24-May-2024 16:04                5262
domelement.toggleattribute.php                     24-May-2024 16:04                6439
domentityreference.construct.php                   24-May-2024 16:04                4847
domimplementation.construct.php                    24-May-2024 16:04                2174
domimplementation.createdocument.php               24-May-2024 16:04                7382
domimplementation.createdocumenttype.php           24-May-2024 16:04                9892
domimplementation.hasfeature.php                   24-May-2024 16:04                9304
domnamednodemap.count.php                          24-May-2024 16:04                2452
domnamednodemap.getiterator.php                    24-May-2024 16:04                3217
domnamednodemap.getnameditem.php                   24-May-2024 16:04                3488
domnamednodemap.getnameditemns.php                 24-May-2024 16:04                3940
domnamednodemap.item.php                           24-May-2024 16:04                3088
domnode.appendchild.php                            24-May-2024 16:04                8723
domnode.c14n.php                                   24-May-2024 16:04                7973
domnode.c14nfile.php                               24-May-2024 16:04                5728
domnode.clonenode.php                              24-May-2024 16:04                2861
domnode.contains.php                               24-May-2024 16:04                5374
domnode.getlineno.php                              24-May-2024 16:04                4891
domnode.getnodepath.php                            24-May-2024 16:04                5245
domnode.getrootnode.php                            24-May-2024 16:04                4417
domnode.hasattributes.php                          24-May-2024 16:04                2995
domnode.haschildnodes.php                          24-May-2024 16:04                2859
domnode.insertbefore.php                           24-May-2024 16:04                5429
domnode.isdefaultnamespace.php                     24-May-2024 16:04                2949
domnode.isequalnode.php                            24-May-2024 16:04                4713
domnode.issamenode.php                             24-May-2024 16:04                2815
domnode.issupported.php                            24-May-2024 16:04                3843
domnode.lookupnamespaceuri.php                     24-May-2024 16:04                3605
domnode.lookupprefix.php                           24-May-2024 16:04                3243
domnode.normalize.php                              24-May-2024 16:04                2840
domnode.removechild.php                            24-May-2024 16:04                6987
domnode.replacechild.php                           24-May-2024 16:04                5677
domnodelist.count.php                              24-May-2024 16:04                2381
domnodelist.getiterator.php                        24-May-2024 16:04                3120
domnodelist.item.php                               24-May-2024 16:04                6997
domparentnode.append.php                           24-May-2024 16:04                4793
domparentnode.prepend.php                          24-May-2024 16:04                4833
domparentnode.replacechildren.php                  24-May-2024 16:04                6638
domprocessinginstruction.construct.php             24-May-2024 16:04                6698
domtext.construct.php                              24-May-2024 16:04                4803
domtext.iselementcontentwhitespace.php             24-May-2024 16:04                2673
domtext.iswhitespaceinelementcontent.php           24-May-2024 16:04                2867
domtext.splittext.php                              24-May-2024 16:04                3257
domxpath.construct.php                             24-May-2024 16:04                3516
domxpath.evaluate.php                              24-May-2024 16:04                7917
domxpath.query.php                                 24-May-2024 16:04               12382
domxpath.registernamespace.php                     24-May-2024 16:04                3333
domxpath.registerphpfunctions.php                  24-May-2024 16:04               13794
dotnet.construct.php                               24-May-2024 16:04                3137
ds-collection.clear.php                            24-May-2024 16:04                3943
ds-collection.copy.php                             24-May-2024 16:04                4343
ds-collection.isempty.php                          24-May-2024 16:04                4271
ds-collection.toarray.php                          24-May-2024 16:04                4260
ds-deque.allocate.php                              24-May-2024 16:04                4691
ds-deque.apply.php                                 24-May-2024 16:04                4991
ds-deque.capacity.php                              24-May-2024 16:04                3970
ds-deque.clear.php                                 24-May-2024 16:04                3860
ds-deque.construct.php                             24-May-2024 16:04                4333
ds-deque.contains.php                              24-May-2024 16:04                7104
ds-deque.copy.php                                  24-May-2024 16:04                4209
ds-deque.count.php                                 24-May-2024 16:04                1625
ds-deque.filter.php                                24-May-2024 16:04                7633
ds-deque.find.php                                  24-May-2024 16:04                5441
ds-deque.first.php                                 24-May-2024 16:04                3778
ds-deque.get.php                                   24-May-2024 16:04                6607
ds-deque.insert.php                                24-May-2024 16:04                6687
ds-deque.isempty.php                               24-May-2024 16:04                4157
ds-deque.join.php                                  24-May-2024 16:04                5758
ds-deque.jsonserialize.php                         24-May-2024 16:04                1879
ds-deque.last.php                                  24-May-2024 16:04                3766
ds-deque.map.php                                   24-May-2024 16:04                5337
ds-deque.merge.php                                 24-May-2024 16:04                4887
ds-deque.pop.php                                   24-May-2024 16:04                4263
ds-deque.push.php                                  24-May-2024 16:04                4695
ds-deque.reduce.php                                24-May-2024 16:04                8004
ds-deque.remove.php                                24-May-2024 16:04                4884
ds-deque.reverse.php                               24-May-2024 16:04                3696
ds-deque.reversed.php                              24-May-2024 16:04                4034
ds-deque.rotate.php                                24-May-2024 16:04                5081
ds-deque.set.php                                   24-May-2024 16:04                6087
ds-deque.shift.php                                 24-May-2024 16:04                4364
ds-deque.slice.php                                 24-May-2024 16:04                7165
ds-deque.sort.php                                  24-May-2024 16:04                7407
ds-deque.sorted.php                                24-May-2024 16:04                7421
ds-deque.sum.php                                   24-May-2024 16:04                5283
ds-deque.toarray.php                               24-May-2024 16:04                4146
ds-deque.unshift.php                               24-May-2024 16:04                4774
ds-hashable.equals.php                             24-May-2024 16:04                3718
ds-hashable.hash.php                               24-May-2024 16:04                7488
ds-map.allocate.php                                24-May-2024 16:04                4557
ds-map.apply.php                                   24-May-2024 16:04                5687
ds-map.capacity.php                                24-May-2024 16:04                3260
ds-map.clear.php                                   24-May-2024 16:04                4336
ds-map.construct.php                               24-May-2024 16:04                4835
ds-map.copy.php                                    24-May-2024 16:04                4069
ds-map.count.php                                   24-May-2024 16:04                1586
ds-map.diff.php                                    24-May-2024 16:04                5468
ds-map.filter.php                                  24-May-2024 16:04                8417
ds-map.first.php                                   24-May-2024 16:04                4077
ds-map.get.php                                     24-May-2024 16:04                8431
ds-map.haskey.php                                  24-May-2024 16:04                4700
ds-map.hasvalue.php                                24-May-2024 16:04                4744
ds-map.intersect.php                               24-May-2024 16:04                5989
ds-map.isempty.php                                 24-May-2024 16:04                4379
ds-map.jsonserialize.php                           24-May-2024 16:04                1857
ds-map.keys.php                                    24-May-2024 16:04                3970
ds-map.ksort.php                                   24-May-2024 16:04                8094
ds-map.ksorted.php                                 24-May-2024 16:04                8170
ds-map.last.php                                    24-May-2024 16:04                4062
ds-map.map.php                                     24-May-2024 16:04                6318
ds-map.merge.php                                   24-May-2024 16:04                5867
ds-map.pairs.php                                   24-May-2024 16:04                4385
ds-map.put.php                                     24-May-2024 16:04               13965
ds-map.putall.php                                  24-May-2024 16:04                5560
ds-map.reduce.php                                  24-May-2024 16:04                8939
ds-map.remove.php                                  24-May-2024 16:04                6983
ds-map.reverse.php                                 24-May-2024 16:04                4148
ds-map.reversed.php                                24-May-2024 16:04                4244
ds-map.skip.php                                    24-May-2024 16:04                4634
ds-map.slice.php                                   24-May-2024 16:04                8017
ds-map.sort.php                                    24-May-2024 16:04                8017
ds-map.sorted.php                                  24-May-2024 16:04                8149
ds-map.sum.php                                     24-May-2024 16:04                5750
ds-map.toarray.php                                 24-May-2024 16:04                5149
ds-map.union.php                                   24-May-2024 16:04                5973
ds-map.values.php                                  24-May-2024 16:04                3969
ds-map.xor.php                                     24-May-2024 16:04                5534
ds-pair.clear.php                                  24-May-2024 16:04                3765
ds-pair.construct.php                              24-May-2024 16:04                2613
ds-pair.copy.php                                   24-May-2024 16:04                4123
ds-pair.isempty.php                                24-May-2024 16:04                4107
ds-pair.jsonserialize.php                          24-May-2024 16:04                1877
ds-pair.toarray.php                                24-May-2024 16:04                4080
ds-priorityqueue.allocate.php                      24-May-2024 16:04                4857
ds-priorityqueue.capacity.php                      24-May-2024 16:04                3469
ds-priorityqueue.clear.php                         24-May-2024 16:04                4517
ds-priorityqueue.construct.php                     24-May-2024 16:04                2931
ds-priorityqueue.copy.php                          24-May-2024 16:04                4512
ds-priorityqueue.count.php                         24-May-2024 16:04                1734
ds-priorityqueue.isempty.php                       24-May-2024 16:04                5067
ds-priorityqueue.jsonserialize.php                 24-May-2024 16:04                1997
ds-priorityqueue.peek.php                          24-May-2024 16:04                4756
ds-priorityqueue.pop.php                           24-May-2024 16:04                5526
ds-priorityqueue.push.php                          24-May-2024 16:04                5621
ds-priorityqueue.toarray.php                       24-May-2024 16:04                5245
ds-queue.allocate.php                              24-May-2024 16:04                4884
ds-queue.capacity.php                              24-May-2024 16:04                3976
ds-queue.clear.php                                 24-May-2024 16:04                3845
ds-queue.construct.php                             24-May-2024 16:04                4331
ds-queue.copy.php                                  24-May-2024 16:04                4311
ds-queue.count.php                                 24-May-2024 16:04                1622
ds-queue.isempty.php                               24-May-2024 16:04                4173
ds-queue.jsonserialize.php                         24-May-2024 16:04                1885
ds-queue.peek.php                                  24-May-2024 16:04                4360
ds-queue.pop.php                                   24-May-2024 16:04                4894
ds-queue.push.php                                  24-May-2024 16:04                4730
ds-queue.toarray.php                               24-May-2024 16:04                4310
ds-sequence.allocate.php                           24-May-2024 16:04                4595
ds-sequence.apply.php                              24-May-2024 16:04                5106
ds-sequence.capacity.php                           24-May-2024 16:04                4525
ds-sequence.contains.php                           24-May-2024 16:04                7231
ds-sequence.filter.php                             24-May-2024 16:04                7772
ds-sequence.find.php                               24-May-2024 16:04                5553
ds-sequence.first.php                              24-May-2024 16:04                3893
ds-sequence.get.php                                24-May-2024 16:04                6735
ds-sequence.insert.php                             24-May-2024 16:04                6806
ds-sequence.join.php                               24-May-2024 16:04                5854
ds-sequence.last.php                               24-May-2024 16:04                3860
ds-sequence.map.php                                24-May-2024 16:04                5466
ds-sequence.merge.php                              24-May-2024 16:04                5013
ds-sequence.pop.php                                24-May-2024 16:04                4375
ds-sequence.push.php                               24-May-2024 16:04                4817
ds-sequence.reduce.php                             24-May-2024 16:04                8123
ds-sequence.remove.php                             24-May-2024 16:04                4996
ds-sequence.reverse.php                            24-May-2024 16:04                3809
ds-sequence.reversed.php                           24-May-2024 16:04                4157
ds-sequence.rotate.php                             24-May-2024 16:04                5218
ds-sequence.set.php                                24-May-2024 16:04                6211
ds-sequence.shift.php                              24-May-2024 16:04                4476
ds-sequence.slice.php                              24-May-2024 16:04                7330
ds-sequence.sort.php                               24-May-2024 16:04                7534
ds-sequence.sorted.php                             24-May-2024 16:04                7548
ds-sequence.sum.php                                24-May-2024 16:04                5408
ds-sequence.unshift.php                            24-May-2024 16:04                4885
ds-set.add.php                                     24-May-2024 16:04               12198
ds-set.allocate.php                                24-May-2024 16:04                4566
ds-set.capacity.php                                24-May-2024 16:04                3928
ds-set.clear.php                                   24-May-2024 16:04                3791
ds-set.construct.php                               24-May-2024 16:04                4285
ds-set.contains.php                                24-May-2024 16:04                7300
ds-set.copy.php                                    24-May-2024 16:04                4250
ds-set.count.php                                   24-May-2024 16:04                1586
ds-set.diff.php                                    24-May-2024 16:04                4758
ds-set.filter.php                                  24-May-2024 16:04                7581
ds-set.first.php                                   24-May-2024 16:04                3731
ds-set.get.php                                     24-May-2024 16:04                6551
ds-set.intersect.php                               24-May-2024 16:04                4989
ds-set.isempty.php                                 24-May-2024 16:04                4115
ds-set.join.php                                    24-May-2024 16:04                5704
ds-set.jsonserialize.php                           24-May-2024 16:04                1851
ds-set.last.php                                    24-May-2024 16:04                3732
ds-set.merge.php                                   24-May-2024 16:04                4813
ds-set.reduce.php                                  24-May-2024 16:04                7950
ds-set.remove.php                                  24-May-2024 16:04                5001
ds-set.reverse.php                                 24-May-2024 16:04                3644
ds-set.reversed.php                                24-May-2024 16:04                3972
ds-set.slice.php                                   24-May-2024 16:04                7079
ds-set.sort.php                                    24-May-2024 16:04                7343
ds-set.sorted.php                                  24-May-2024 16:04                7357
ds-set.sum.php                                     24-May-2024 16:04                5223
ds-set.toarray.php                                 24-May-2024 16:04                4092
ds-set.union.php                                   24-May-2024 16:04                4952
ds-set.xor.php                                     24-May-2024 16:04                4928
ds-stack.allocate.php                              24-May-2024 16:04                2878
ds-stack.capacity.php                              24-May-2024 16:04                2210
ds-stack.clear.php                                 24-May-2024 16:04                3841
ds-stack.construct.php                             24-May-2024 16:04                4297
ds-stack.copy.php                                  24-May-2024 16:04                4311
ds-stack.count.php                                 24-May-2024 16:04                1622
ds-stack.isempty.php                               24-May-2024 16:04                4173
ds-stack.jsonserialize.php                         24-May-2024 16:04                1885
ds-stack.peek.php                                  24-May-2024 16:04                4354
ds-stack.pop.php                                   24-May-2024 16:04                4888
ds-stack.push.php                                  24-May-2024 16:04                4730
ds-stack.toarray.php                               24-May-2024 16:04                4137
ds-vector.allocate.php                             24-May-2024 16:04                4512
ds-vector.apply.php                                24-May-2024 16:04                5017
ds-vector.capacity.php                             24-May-2024 16:04                4430
ds-vector.clear.php                                24-May-2024 16:04                3872
ds-vector.construct.php                            24-May-2024 16:04                4365
ds-vector.contains.php                             24-May-2024 16:04                7134
ds-vector.copy.php                                 24-May-2024 16:04                4335
ds-vector.count.php                                24-May-2024 16:04                1639
ds-vector.filter.php                               24-May-2024 16:04                7667
ds-vector.find.php                                 24-May-2024 16:04                5466
ds-vector.first.php                                24-May-2024 16:04                3804
ds-vector.get.php                                  24-May-2024 16:04                6638
ds-vector.insert.php                               24-May-2024 16:04                6717
ds-vector.isempty.php                              24-May-2024 16:04                4181
ds-vector.join.php                                 24-May-2024 16:04                5785
ds-vector.jsonserialize.php                        24-May-2024 16:04                1893
ds-vector.last.php                                 24-May-2024 16:04                3791
ds-vector.map.php                                  24-May-2024 16:04                5369
ds-vector.merge.php                                24-May-2024 16:04                4918
ds-vector.pop.php                                  24-May-2024 16:04                4288
ds-vector.push.php                                 24-May-2024 16:04                4724
ds-vector.reduce.php                               24-May-2024 16:04                8032
ds-vector.remove.php                               24-May-2024 16:04                4909
ds-vector.reverse.php                              24-May-2024 16:04                3722
ds-vector.reversed.php                             24-May-2024 16:04                4064
ds-vector.rotate.php                               24-May-2024 16:04                5115
ds-vector.set.php                                  24-May-2024 16:04                6118
ds-vector.shift.php                                24-May-2024 16:04                4389
ds-vector.slice.php                                24-May-2024 16:04                7211
ds-vector.sort.php                                 24-May-2024 16:04                7439
ds-vector.sorted.php                               24-May-2024 16:04                7453
ds-vector.sum.php                                  24-May-2024 16:04                5313
ds-vector.toarray.php                              24-May-2024 16:04                4171
ds-vector.unshift.php                              24-May-2024 16:04                4804
ds.constants.php                                   24-May-2024 16:04                1176
ds.examples.php                                    24-May-2024 16:04                4728
ds.installation.php                                24-May-2024 16:04                2526
ds.requirements.php                                24-May-2024 16:04                1221
ds.setup.php                                       24-May-2024 16:04                1453
eio.configuration.php                              24-May-2024 16:04                1277
eio.constants.php                                  24-May-2024 16:04               21843
eio.examples.php                                   24-May-2024 16:04               27081
eio.installation.php                               24-May-2024 16:04                1783
eio.requirements.php                               24-May-2024 16:04                1341
eio.resources.php                                  24-May-2024 16:04                1254
eio.setup.php                                      24-May-2024 16:04                1610
emptyiterator.current.php                          24-May-2024 16:04                2779
emptyiterator.key.php                              24-May-2024 16:04                2743
emptyiterator.next.php                             24-May-2024 16:04                2442
emptyiterator.rewind.php                           24-May-2024 16:04                2464
emptyiterator.valid.php                            24-May-2024 16:04                2763
enchant.configuration.php                          24-May-2024 16:04                1307
enchant.constants.php                              24-May-2024 16:04                2947
enchant.examples.php                               24-May-2024 16:04                5433
enchant.installation.php                           24-May-2024 16:04                3222
enchant.requirements.php                           24-May-2024 16:04                1824
enchant.resources.php                              24-May-2024 16:04                1361
enchant.setup.php                                  24-May-2024 16:04                1655
error.clone.php                                    24-May-2024 16:03                2846
error.construct.php                                24-May-2024 16:03                3445
error.getcode.php                                  24-May-2024 16:03                4062
error.getfile.php                                  24-May-2024 16:03                3795
error.getline.php                                  24-May-2024 16:03                4006
error.getmessage.php                               24-May-2024 16:03                3870
error.getprevious.php                              24-May-2024 16:03                6632
error.gettrace.php                                 24-May-2024 16:03                4340
error.gettraceasstring.php                         24-May-2024 16:03                4123
error.tostring.php                                 24-May-2024 16:03                4034
errorexception.construct.php                       24-May-2024 16:03                6211
errorexception.getseverity.php                     24-May-2024 16:03                4398
errorfunc.configuration.php                        24-May-2024 16:03               25990
errorfunc.constants.php                            24-May-2024 16:03               11454
errorfunc.examples.php                             24-May-2024 16:03               19288
errorfunc.installation.php                         24-May-2024 16:03                1300
errorfunc.requirements.php                         24-May-2024 16:03                1257
errorfunc.resources.php                            24-May-2024 16:03                1260
errorfunc.setup.php                                24-May-2024 16:03                1671
ev.backend.php                                     24-May-2024 16:04                3420
ev.configuration.php                               24-May-2024 16:04                1272
ev.depth.php                                       24-May-2024 16:04                3290
ev.embeddablebackends.php                          24-May-2024 16:04                6487
ev.examples.php                                    24-May-2024 16:04               41813
ev.feedsignal.php                                  24-May-2024 16:04                3416
ev.feedsignalevent.php                             24-May-2024 16:04                3203
ev.global.constants.php                            24-May-2024 16:04                1330
ev.installation.php                                24-May-2024 16:04                1779
ev.iteration.php                                   24-May-2024 16:04                2666
ev.now.php                                         24-May-2024 16:04                3137
ev.nowupdate.php                                   24-May-2024 16:04                3224
ev.periodic-modes.php                              24-May-2024 16:04                7686
ev.recommendedbackends.php                         24-May-2024 16:04                7179
ev.requirements.php                                24-May-2024 16:04                1276
ev.resources.php                                   24-May-2024 16:04                1218
ev.resume.php                                      24-May-2024 16:04                3746
ev.run.php                                         24-May-2024 16:04                5114
ev.setup.php                                       24-May-2024 16:04                1565
ev.sleep.php                                       24-May-2024 16:04                2474
ev.stop.php                                        24-May-2024 16:04                2915
ev.supportedbackends.php                           24-May-2024 16:04                6469
ev.suspend.php                                     24-May-2024 16:04                3513
ev.time.php                                        24-May-2024 16:04                2711
ev.verify.php                                      24-May-2024 16:04                2303
ev.watcher-callbacks.php                           24-May-2024 16:04                4559
ev.watchers.php                                    24-May-2024 16:04                3477
evcheck.construct.php                              24-May-2024 16:04                3683
evcheck.createstopped.php                          24-May-2024 16:04                3793
evchild.construct.php                              24-May-2024 16:04                6760
evchild.createstopped.php                          24-May-2024 16:04                5164
evchild.set.php                                    24-May-2024 16:04                3252
evembed.construct.php                              24-May-2024 16:04                7974
evembed.createstopped.php                          24-May-2024 16:04                4806
evembed.set.php                                    24-May-2024 16:04                2598
evembed.sweep.php                                  24-May-2024 16:04                3109
event.add.php                                      24-May-2024 16:04               10334
event.addsignal.php                                24-May-2024 16:04                1692
event.addtimer.php                                 24-May-2024 16:04                1701
event.callbacks.php                                24-May-2024 16:04                5714
event.configuration.php                            24-May-2024 16:04                1293
event.construct.php                                24-May-2024 16:04                4611
event.constructing.signal.events.php               24-May-2024 16:04                6075
event.del.php                                      24-May-2024 16:04                2680
event.delsignal.php                                24-May-2024 16:04                1692
event.deltimer.php                                 24-May-2024 16:04                1689
event.examples.php                                 24-May-2024 16:04              165072
event.flags.php                                    24-May-2024 16:04                2638
event.free.php                                     24-May-2024 16:04                3067
event.getsupportedmethods.php                      24-May-2024 16:04                2708
event.installation.php                             24-May-2024 16:04                1806
event.pending.php                                  24-May-2024 16:04                3154
event.persistence.php                              24-May-2024 16:04                2968
event.requirements.php                             24-May-2024 16:04                1494
event.resources.php                                24-May-2024 16:04                1217
event.set.php                                      24-May-2024 16:04                4739
event.setpriority.php                              24-May-2024 16:04                2655
event.settimer.php                                 24-May-2024 16:04                4169
event.setup.php                                    24-May-2024 16:04                1604
event.signal.php                                   24-May-2024 16:04                4346
event.timer.php                                    24-May-2024 16:04                3635
eventbase.construct.php                            24-May-2024 16:04                3084
eventbase.dispatch.php                             24-May-2024 16:04                3373
eventbase.exit.php                                 24-May-2024 16:04                3155
eventbase.free.php                                 24-May-2024 16:04                3422
eventbase.getfeatures.php                          24-May-2024 16:04                5809
eventbase.getmethod.php                            24-May-2024 16:04                4599
eventbase.gettimeofdaycached.php                   24-May-2024 16:04                2778
eventbase.gotexit.php                              24-May-2024 16:04                3399
eventbase.gotstop.php                              24-May-2024 16:04                3371
eventbase.loop.php                                 24-May-2024 16:04                3697
eventbase.priorityinit.php                         24-May-2024 16:04                3132
eventbase.reinit.php                               24-May-2024 16:04                2463
eventbase.stop.php                                 24-May-2024 16:04                2933
eventbuffer.add.php                                24-May-2024 16:04                3133
eventbuffer.addbuffer.php                          24-May-2024 16:04                3485
eventbuffer.appendfrom.php                         24-May-2024 16:04                4980
eventbuffer.construct.php                          24-May-2024 16:04                2013
eventbuffer.copyout.php                            24-May-2024 16:04                4020
eventbuffer.drain.php                              24-May-2024 16:04                3608
eventbuffer.enablelocking.php                      24-May-2024 16:04                2950
eventbuffer.expand.php                             24-May-2024 16:04                2928
eventbuffer.freeze.php                             24-May-2024 16:04                3181
eventbuffer.lock.php                               24-May-2024 16:04                3075
eventbuffer.prepend.php                            24-May-2024 16:04                3608
eventbuffer.prependbuffer.php                      24-May-2024 16:04                3770
eventbuffer.pullup.php                             24-May-2024 16:04                4727
eventbuffer.read.php                               24-May-2024 16:04                5005
eventbuffer.readfrom.php                           24-May-2024 16:04                4433
eventbuffer.readline.php                           24-May-2024 16:04                4354
eventbuffer.search.php                             24-May-2024 16:04                8458
eventbuffer.searcheol.php                          24-May-2024 16:04                4999
eventbuffer.substr.php                             24-May-2024 16:04                3640
eventbuffer.unfreeze.php                           24-May-2024 16:04                3195
eventbuffer.unlock.php                             24-May-2024 16:04                2908
eventbuffer.write.php                              24-May-2024 16:04                3546
eventbufferevent.about.callbacks.php               24-May-2024 16:04                6179
eventbufferevent.close.php                         24-May-2024 16:04                2638
eventbufferevent.connect.php                       24-May-2024 16:04               23982
eventbufferevent.connecthost.php                   24-May-2024 16:04               17871
eventbufferevent.construct.php                     24-May-2024 16:04                6933
eventbufferevent.createpair.php                    24-May-2024 16:04                4395
eventbufferevent.disable.php                       24-May-2024 16:04                3636
eventbufferevent.enable.php                        24-May-2024 16:04                4106
eventbufferevent.free.php                          24-May-2024 16:04                2859
eventbufferevent.getdnserrorstring.php             24-May-2024 16:04                3178
eventbufferevent.getenabled.php                    24-May-2024 16:04                3127
eventbufferevent.getinput.php                      24-May-2024 16:04                5067
eventbufferevent.getoutput.php                     24-May-2024 16:04                7948
eventbufferevent.read.php                          24-May-2024 16:04                3142
eventbufferevent.readbuffer.php                    24-May-2024 16:04                3322
eventbufferevent.setcallbacks.php                  24-May-2024 16:04                4639
eventbufferevent.setpriority.php                   24-May-2024 16:04                3037
eventbufferevent.settimeouts.php                   24-May-2024 16:04                3262
eventbufferevent.setwatermark.php                  24-May-2024 16:04                4170
eventbufferevent.sslerror.php                      24-May-2024 16:04                5949
eventbufferevent.sslfilter.php                     24-May-2024 16:04               34558
eventbufferevent.sslgetcipherinfo.php              24-May-2024 16:04                2988
eventbufferevent.sslgetciphername.php              24-May-2024 16:04                2891
eventbufferevent.sslgetcipherversion.php           24-May-2024 16:04                2920
eventbufferevent.sslgetprotocol.php                24-May-2024 16:04                2797
eventbufferevent.sslrenegotiate.php                24-May-2024 16:04                2894
eventbufferevent.sslsocket.php                     24-May-2024 16:04                5965
eventbufferevent.write.php                         24-May-2024 16:04                3318
eventbufferevent.writebuffer.php                   24-May-2024 16:04                3440
eventconfig.avoidmethod.php                        24-May-2024 16:04                4478
eventconfig.construct.php                          24-May-2024 16:04                4106
eventconfig.requirefeatures.php                    24-May-2024 16:04                6079
eventconfig.setflags.php                           24-May-2024 16:04                3435
eventconfig.setmaxdispatchinterval.php             24-May-2024 16:04                4630
eventdnsbase.addnameserverip.php                   24-May-2024 16:04                3064
eventdnsbase.addsearch.php                         24-May-2024 16:04                2628
eventdnsbase.clearsearch.php                       24-May-2024 16:04                2881
eventdnsbase.construct.php                         24-May-2024 16:04                7588
eventdnsbase.countnameservers.php                  24-May-2024 16:04                2604
eventdnsbase.loadhosts.php                         24-May-2024 16:04                2937
eventdnsbase.parseresolvconf.php                   24-May-2024 16:04                4313
eventdnsbase.setoption.php                         24-May-2024 16:04                3511
eventdnsbase.setsearchndots.php                    24-May-2024 16:04                3000
eventhttp.accept.php                               24-May-2024 16:04               12479
eventhttp.addserveralias.php                       24-May-2024 16:04                6520
eventhttp.bind.php                                 24-May-2024 16:04                7942
eventhttp.construct.php                            24-May-2024 16:04               17457
eventhttp.removeserveralias.php                    24-May-2024 16:04                3328
eventhttp.setallowedmethods.php                    24-May-2024 16:04                3467
eventhttp.setcallback.php                          24-May-2024 16:04               18141
eventhttp.setdefaultcallback.php                   24-May-2024 16:04                7938
eventhttp.setmaxbodysize.php                       24-May-2024 16:04                2983
eventhttp.setmaxheaderssize.php                    24-May-2024 16:04                2895
eventhttp.settimeout.php                           24-May-2024 16:04                2581
eventhttpconnection.construct.php                  24-May-2024 16:04                5179
eventhttpconnection.getbase.php                    24-May-2024 16:04                2679
eventhttpconnection.getpeer.php                    24-May-2024 16:04                3097
eventhttpconnection.makerequest.php                24-May-2024 16:04               11749
eventhttpconnection.setclosecallback.php           24-May-2024 16:04                9500
eventhttpconnection.setlocaladdress.php            24-May-2024 16:04                3282
eventhttpconnection.setlocalport.php               24-May-2024 16:04                3163
eventhttpconnection.setmaxbodysize.php             24-May-2024 16:04                3207
eventhttpconnection.setmaxheaderssize.php          24-May-2024 16:04                3228
eventhttpconnection.setretries.php                 24-May-2024 16:04                2811
eventhttpconnection.settimeout.php                 24-May-2024 16:04                2708
eventhttprequest.addheader.php                     24-May-2024 16:04                4050
eventhttprequest.cancel.php                        24-May-2024 16:04                2913
eventhttprequest.clearheaders.php                  24-May-2024 16:04                2866
eventhttprequest.closeconnection.php               24-May-2024 16:04                2468
eventhttprequest.construct.php                     24-May-2024 16:04               11465
eventhttprequest.findheader.php                    24-May-2024 16:04                3605
eventhttprequest.free.php                          24-May-2024 16:04                2376
eventhttprequest.getbufferevent.php                24-May-2024 16:04                3739
eventhttprequest.getcommand.php                    24-May-2024 16:04                2743
eventhttprequest.getconnection.php                 24-May-2024 16:04                4493
eventhttprequest.gethost.php                       24-May-2024 16:04                2921
eventhttprequest.getinputbuffer.php                24-May-2024 16:04                2823
eventhttprequest.getinputheaders.php               24-May-2024 16:04                2914
eventhttprequest.getoutputbuffer.php               24-May-2024 16:04                2882
eventhttprequest.getoutputheaders.php              24-May-2024 16:04                2865
eventhttprequest.getresponsecode.php               24-May-2024 16:04                3201
eventhttprequest.geturi.php                        24-May-2024 16:04                3114
eventhttprequest.removeheader.php                  24-May-2024 16:04                3565
eventhttprequest.senderror.php                     24-May-2024 16:04                5908
eventhttprequest.sendreply.php                     24-May-2024 16:04                4118
eventhttprequest.sendreplychunk.php                24-May-2024 16:04                3490
eventhttprequest.sendreplyend.php                  24-May-2024 16:04                3099
eventhttprequest.sendreplystart.php                24-May-2024 16:04                4377
eventlistener.construct.php                        24-May-2024 16:04               22469
eventlistener.disable.php                          24-May-2024 16:04                2884
eventlistener.enable.php                           24-May-2024 16:04                2870
eventlistener.getbase.php                          24-May-2024 16:04                2382
eventlistener.getsocketname.php                    24-May-2024 16:04                3432
eventlistener.setcallback.php                      24-May-2024 16:04                6089
eventlistener.seterrorcallback.php                 24-May-2024 16:04                4454
eventsslcontext.construct.php                      24-May-2024 16:04                5341
eventutil.construct.php                            24-May-2024 16:04                2207
eventutil.getlastsocketerrno.php                   24-May-2024 16:04                3354
eventutil.getlastsocketerror.php                   24-May-2024 16:04                3170
eventutil.getsocketfd.php                          24-May-2024 16:04                3271
eventutil.getsocketname.php                        24-May-2024 16:04                3835
eventutil.setsocketoption.php                      24-May-2024 16:04                5764
eventutil.sslrandpoll.php                          24-May-2024 16:04                2441
evfork.construct.php                               24-May-2024 16:04                3709
evfork.createstopped.php                           24-May-2024 16:04                3995
evidle.construct.php                               24-May-2024 16:04                3713
evidle.createstopped.php                           24-May-2024 16:04                4193
evio.construct.php                                 24-May-2024 16:04                4861
evio.createstopped.php                             24-May-2024 16:04                5199
evio.set.php                                       24-May-2024 16:04                2893
evloop.backend.php                                 24-May-2024 16:04                2767
evloop.check.php                                   24-May-2024 16:04                3350
evloop.child.php                                   24-May-2024 16:04                3832
evloop.construct.php                               24-May-2024 16:04                4080
evloop.defaultloop.php                             24-May-2024 16:04                4679
evloop.embed.php                                   24-May-2024 16:04                3875
evloop.fork.php                                    24-May-2024 16:04                3432
evloop.idle.php                                    24-May-2024 16:04                3452
evloop.invokepending.php                           24-May-2024 16:04                2283
evloop.io.php                                      24-May-2024 16:04                3888
evloop.loopfork.php                                24-May-2024 16:04                2621
evloop.now.php                                     24-May-2024 16:04                2881
evloop.nowupdate.php                               24-May-2024 16:04                3203
evloop.periodic.php                                24-May-2024 16:04                4026
evloop.prepare.php                                 24-May-2024 16:04                3450
evloop.resume.php                                  24-May-2024 16:04                2863
evloop.run.php                                     24-May-2024 16:04                5097
evloop.signal.php                                  24-May-2024 16:04                3755
evloop.stat.php                                    24-May-2024 16:04                3936
evloop.stop.php                                    24-May-2024 16:04                3027
evloop.suspend.php                                 24-May-2024 16:04                2855
evloop.timer.php                                   24-May-2024 16:04                3953
evloop.verify.php                                  24-May-2024 16:04                2628
evperiodic.again.php                               24-May-2024 16:04                2618
evperiodic.at.php                                  24-May-2024 16:04                2683
evperiodic.construct.php                           24-May-2024 16:04               10064
evperiodic.createstopped.php                       24-May-2024 16:04                5901
evperiodic.set.php                                 24-May-2024 16:04                3250
evprepare.construct.php                            24-May-2024 16:04                3616
evprepare.createstopped.php                        24-May-2024 16:04                4356
evsignal.construct.php                             24-May-2024 16:04                5536
evsignal.createstopped.php                         24-May-2024 16:04                4881
evsignal.set.php                                   24-May-2024 16:04                2550
evstat.attr.php                                    24-May-2024 16:04                8265
evstat.construct.php                               24-May-2024 16:04                7254
evstat.createstopped.php                           24-May-2024 16:04                5257
evstat.prev.php                                    24-May-2024 16:04                2979
evstat.set.php                                     24-May-2024 16:04                2909
evstat.stat.php                                    24-May-2024 16:04                3036
evtimer.again.php                                  24-May-2024 16:04                3113
evtimer.construct.php                              24-May-2024 16:04               12702
evtimer.createstopped.php                          24-May-2024 16:04                8395
evtimer.set.php                                    24-May-2024 16:04                3066
evwatcher.clear.php                                24-May-2024 16:04                2870
evwatcher.construct.php                            24-May-2024 16:04                2148
evwatcher.feed.php                                 24-May-2024 16:04                2663
evwatcher.getloop.php                              24-May-2024 16:04                2356
evwatcher.invoke.php                               24-May-2024 16:04                2670
evwatcher.keepalive.php                            24-May-2024 16:04                5375
evwatcher.setcallback.php                          24-May-2024 16:04                2625
evwatcher.start.php                                24-May-2024 16:04                2560
evwatcher.stop.php                                 24-May-2024 16:04                2529
example.xml-external-entity.php                    24-May-2024 16:04               21390
example.xml-map-tags.php                           24-May-2024 16:04                8164
example.xml-structure.php                          24-May-2024 16:04                6250
example.xmlwriter-namespace.php                    24-May-2024 16:04                5402
example.xmlwriter-oop.php                          24-May-2024 16:04                3410
example.xmlwriter-simple.php                       24-May-2024 16:04                8655
exception.clone.php                                24-May-2024 16:03                3100
exception.construct.php                            24-May-2024 16:03                3815
exception.getcode.php                              24-May-2024 16:03                4630
exception.getfile.php                              24-May-2024 16:03                3920
exception.getline.php                              24-May-2024 16:03                4130
exception.getmessage.php                           24-May-2024 16:03                4015
exception.getprevious.php                          24-May-2024 16:03                6886
exception.gettrace.php                             24-May-2024 16:03                4455
exception.gettraceasstring.php                     24-May-2024 16:03                4238
exception.tostring.php                             24-May-2024 16:03                4191
exec.configuration.php                             24-May-2024 16:04                1286
exec.constants.php                                 24-May-2024 16:04                1206
exec.installation.php                              24-May-2024 16:04                1265
exec.requirements.php                              24-May-2024 16:04                1222
exec.resources.php                                 24-May-2024 16:04                1361
exec.setup.php                                     24-May-2024 16:04                1624
exif.configuration.php                             24-May-2024 16:04                7293
exif.constants.php                                 24-May-2024 16:04                2064
exif.installation.php                              24-May-2024 16:04                1680
exif.requirements.php                              24-May-2024 16:04                1795
exif.resources.php                                 24-May-2024 16:04                1225
exif.setup.php                                     24-May-2024 16:04                1622
expect.configuration.php                           24-May-2024 16:04                5432
expect.constants.php                               24-May-2024 16:04                3901
expect.examples-usage.php                          24-May-2024 16:04               12212
expect.examples.php                                24-May-2024 16:04                1426
expect.installation.php                            24-May-2024 16:04                2430
expect.requirements.php                            24-May-2024 16:04                1347
expect.resources.php                               24-May-2024 16:04                1438
expect.setup.php                                   24-May-2024 16:04                1648
extensions.alphabetical.php                        24-May-2024 16:04               20833
extensions.membership.php                          24-May-2024 16:04               20556
extensions.php                                     24-May-2024 16:04                1706
extensions.state.php                               24-May-2024 16:04                2767
fann.configuration.php                             24-May-2024 16:04                1286
fann.constants.php                                 24-May-2024 16:04               23625
fann.examples-1.php                                24-May-2024 16:04                8522
fann.examples.php                                  24-May-2024 16:04                1380
fann.installation.php                              24-May-2024 16:04                4925
fann.requirements.php                              24-May-2024 16:04                1202
fann.resources.php                                 24-May-2024 16:04                1175
fann.setup.php                                     24-May-2024 16:04                1595
fannconnection.construct.php                       24-May-2024 16:04                3041
fannconnection.getfromneuron.php                   24-May-2024 16:04                2409
fannconnection.gettoneuron.php                     24-May-2024 16:04                2397
fannconnection.getweight.php                       24-May-2024 16:04                2332
fannconnection.setweight.php                       24-May-2024 16:04                2972
faq.build.php                                      24-May-2024 16:04               27261
faq.com.php                                        24-May-2024 16:04               12360
faq.databases.php                                  24-May-2024 16:04               12262
faq.general.php                                    24-May-2024 16:04                5017
faq.html.php                                       24-May-2024 16:04               19591
faq.installation.php                               24-May-2024 16:04               25660
faq.mailinglist.php                                24-May-2024 16:04               11328
faq.misc.php                                       24-May-2024 16:04                4670
faq.obtaining.php                                  24-May-2024 16:04               10844
faq.passwords.php                                  24-May-2024 16:04                9570
faq.php                                            24-May-2024 16:04                2055
faq.using.php                                      24-May-2024 16:04               21836
fdf.configuration.php                              24-May-2024 16:04                1279
fdf.constants.php                                  24-May-2024 16:04                9238
fdf.examples.php                                   24-May-2024 16:04                6025
fdf.installation.php                               24-May-2024 16:04                3467
fdf.requirements.php                               24-May-2024 16:04                1539
fdf.resources.php                                  24-May-2024 16:04                1735
fdf.setup.php                                      24-May-2024 16:04                1603
features.commandline.differences.php               24-May-2024 16:03               12537
features.commandline.ini.php                       24-May-2024 16:03                2355
features.commandline.interactive.php               24-May-2024 16:03                7740
features.commandline.introduction.php              24-May-2024 16:03                6870
features.commandline.io-streams.php                24-May-2024 16:03                6012
features.commandline.options.php                   24-May-2024 16:03               26854
features.commandline.php                           24-May-2024 16:03                2074
features.commandline.usage.php                     24-May-2024 16:03               14311
features.commandline.webserver.php                 24-May-2024 16:03               13024
features.connection-handling.php                   24-May-2024 16:03                5634
features.cookies.php                               24-May-2024 16:03                3078
features.dtrace.dtrace.php                         24-May-2024 16:03               13970
features.dtrace.introduction.php                   24-May-2024 16:03                3140
features.dtrace.php                                24-May-2024 16:03                1686
features.dtrace.systemtap.php                      24-May-2024 16:03                8062
features.file-upload.common-pitfalls.php           24-May-2024 16:03                5501
features.file-upload.errors.php                    24-May-2024 16:03                3932
features.file-upload.errors.seealso.php            24-May-2024 16:03                1377
features.file-upload.multiple.php                  24-May-2024 16:03                4647
features.file-upload.php                           24-May-2024 16:03                1972
features.file-upload.post-method.php               24-May-2024 16:03               15747
features.file-upload.put-method.php                24-May-2024 16:03                5873
features.gc.collecting-cycles.php                  24-May-2024 16:03                7969
features.gc.performance-considerations.php         24-May-2024 16:03               13849
features.gc.php                                    24-May-2024 16:03                1781
features.gc.refcounting-basics.php                 24-May-2024 16:03               21476
features.http-auth.php                             24-May-2024 16:03               23569
features.persistent-connections.php                24-May-2024 16:03                9896
features.php                                       24-May-2024 16:03                4106
features.remote-files.php                          24-May-2024 16:03                9067
features.session.security.management.php           24-May-2024 16:04               23636
features.sessions.php                              24-May-2024 16:03                1470
features.xforms.php                                24-May-2024 16:03                5293
ffi-ctype.getalignment.php                         24-May-2024 16:03                2397
ffi-ctype.getarrayelementtype.php                  24-May-2024 16:03                2483
ffi-ctype.getarraylength.php                       24-May-2024 16:03                2440
ffi-ctype.getattributes.php                        24-May-2024 16:03                2416
ffi-ctype.getenumkind.php                          24-May-2024 16:03                2392
ffi-ctype.getfuncabi.php                           24-May-2024 16:03                2400
ffi-ctype.getfuncparametercount.php                24-May-2024 16:03                2506
ffi-ctype.getfuncparametertype.php                 24-May-2024 16:03                2744
ffi-ctype.getfuncreturntype.php                    24-May-2024 16:03                2465
ffi-ctype.getkind.php                              24-May-2024 16:03                2354
ffi-ctype.getname.php                              24-May-2024 16:03                2360
ffi-ctype.getpointertype.php                       24-May-2024 16:03                2409
ffi-ctype.getsize.php                              24-May-2024 16:03                2372
ffi-ctype.getstructfieldnames.php                  24-May-2024 16:03                2482
ffi-ctype.getstructfieldoffset.php                 24-May-2024 16:03                2740
ffi-ctype.getstructfieldtype.php                   24-May-2024 16:03                2702
ffi.addr.php                                       24-May-2024 16:03                2817
ffi.alignof.php                                    24-May-2024 16:03                2947
ffi.arraytype.php                                  24-May-2024 16:03                4647
ffi.cast.php                                       24-May-2024 16:03                4865
ffi.cdef.php                                       24-May-2024 16:03                4483
ffi.configuration.php                              24-May-2024 16:03                4348
ffi.constants.php                                  24-May-2024 16:03                1170
ffi.examples-basic.php                             24-May-2024 16:03               15822
ffi.examples-callback.php                          24-May-2024 16:03                4955
ffi.examples-complete.php                          24-May-2024 16:03                5351
ffi.examples.php                                   24-May-2024 16:03                1537
ffi.free.php                                       24-May-2024 16:03                2464
ffi.installation.php                               24-May-2024 16:03                1449
ffi.isnull.php                                     24-May-2024 16:03                2560
ffi.load.php                                       24-May-2024 16:03                4331
ffi.memcmp.php                                     24-May-2024 16:03                4125
ffi.memcpy.php                                     24-May-2024 16:03                3316
ffi.memset.php                                     24-May-2024 16:03                3156
ffi.new.php                                        24-May-2024 16:03                5197
ffi.requirements.php                               24-May-2024 16:03                1298
ffi.resources.php                                  24-May-2024 16:03                1218
ffi.scope.php                                      24-May-2024 16:03                3170
ffi.setup.php                                      24-May-2024 16:03                1593
ffi.sizeof.php                                     24-May-2024 16:03                2788
ffi.string.php                                     24-May-2024 16:03                4234
ffi.type.php                                       24-May-2024 16:03                3611
ffi.typeof.php                                     24-May-2024 16:03                2881
fiber.construct.php                                24-May-2024 16:03                2383
fiber.getcurrent.php                               24-May-2024 16:03                2544
fiber.getreturn.php                                24-May-2024 16:03                2617
fiber.isrunning.php                                24-May-2024 16:03                2765
fiber.isstarted.php                                24-May-2024 16:03                2379
fiber.issuspended.php                              24-May-2024 16:03                2394
fiber.isterminated.php                             24-May-2024 16:03                2451
fiber.resume.php                                   24-May-2024 16:03                3367
fiber.start.php                                    24-May-2024 16:03                3044
fiber.suspend.php                                  24-May-2024 16:03                4083
fiber.throw.php                                    24-May-2024 16:03                3227
fibererror.construct.php                           24-May-2024 16:03                2206
fileinfo.configuration.php                         24-May-2024 16:04                1314
fileinfo.constants.php                             24-May-2024 16:04                6434
fileinfo.installation.php                          24-May-2024 16:04                1719
fileinfo.requirements.php                          24-May-2024 16:04                1250
fileinfo.resources.php                             24-May-2024 16:04                1422
fileinfo.setup.php                                 24-May-2024 16:04                1668
filesystem.configuration.php                       24-May-2024 16:04                7544
filesystem.constants.php                           24-May-2024 16:04               13348
filesystem.installation.php                        24-May-2024 16:04                1307
filesystem.requirements.php                        24-May-2024 16:04                1264
filesystem.resources.php                           24-May-2024 16:04                1410
filesystem.setup.php                               24-May-2024 16:04                1695
filesystemiterator.construct.php                   24-May-2024 16:04                7562
filesystemiterator.current.php                     24-May-2024 16:04                5411
filesystemiterator.getflags.php                    24-May-2024 16:04                3236
filesystemiterator.key.php                         24-May-2024 16:04                5129
filesystemiterator.next.php                        24-May-2024 16:04                4549
filesystemiterator.rewind.php                      24-May-2024 16:04                5178
filesystemiterator.setflags.php                    24-May-2024 16:04                6691
filter.configuration.php                           24-May-2024 16:04                5090
filter.constants.php                               24-May-2024 16:04               25020
filter.examples.php                                24-May-2024 16:04                1487
filter.examples.sanitization.php                   24-May-2024 16:04                5586
filter.examples.validation.php                     24-May-2024 16:04               10158
filter.filters.flags.php                           24-May-2024 16:04               16869
filter.filters.misc.php                            24-May-2024 16:04                1947
filter.filters.php                                 24-May-2024 16:04                1644
filter.filters.sanitize.php                        24-May-2024 16:04               13641
filter.filters.validate.php                        24-May-2024 16:04               13955
filter.installation.php                            24-May-2024 16:04                1376
filter.requirements.php                            24-May-2024 16:04                1236
filter.resources.php                               24-May-2024 16:04                1233
filter.setup.php                                   24-May-2024 16:04                1632
filteriterator.accept.php                          24-May-2024 16:04                5330
filteriterator.construct.php                       24-May-2024 16:04                3120
filteriterator.current.php                         24-May-2024 16:04                3013
filteriterator.key.php                             24-May-2024 16:04                2953
filteriterator.next.php                            24-May-2024 16:04                2976
filteriterator.rewind.php                          24-May-2024 16:04                3154
filteriterator.valid.php                           24-May-2024 16:04                2846
filters.compression.php                            24-May-2024 16:04               15298
filters.convert.php                                24-May-2024 16:04               11480
filters.encryption.php                             24-May-2024 16:04               40861
filters.php                                        24-May-2024 16:04                3290
filters.string.php                                 24-May-2024 16:04                9960
finfo.buffer.php                                   24-May-2024 16:04                2907
finfo.construct.php                                24-May-2024 16:04                3088
finfo.file.php                                     24-May-2024 16:04                2898
finfo.set-flags.php                                24-May-2024 16:04                2111
fpm.observability.php                              24-May-2024 16:04                1429
fpm.setup.php                                      24-May-2024 16:04                1327
fpm.status.php                                     24-May-2024 16:04               10130
ftp.configuration.php                              24-May-2024 16:04                1279
ftp.constants.php                                  24-May-2024 16:04                5341
ftp.examples-basic.php                             24-May-2024 16:04                4793
ftp.examples.php                                   24-May-2024 16:04                1376
ftp.installation.php                               24-May-2024 16:04                1488
ftp.requirements.php                               24-May-2024 16:04                1215
ftp.resources.php                                  24-May-2024 16:04                1511
ftp.setup.php                                      24-May-2024 16:04                1603
funchand.configuration.php                         24-May-2024 16:04                1314
funchand.constants.php                             24-May-2024 16:04                1234
funchand.installation.php                          24-May-2024 16:04                1293
funchand.requirements.php                          24-May-2024 16:04                1250
funchand.resources.php                             24-May-2024 16:04                1253
funchand.setup.php                                 24-May-2024 16:04                1656
funcref.php                                        24-May-2024 16:04               14138
function.abs.php                                   24-May-2024 16:04                3680
function.acos.php                                  24-May-2024 16:04                2579
function.acosh.php                                 24-May-2024 16:04                2544
function.addcslashes.php                           24-May-2024 16:04                8715
function.addslashes.php                            24-May-2024 16:04                7340
function.apache-child-terminate.php                24-May-2024 16:04                4413
function.apache-get-modules.php                    24-May-2024 16:04                3433
function.apache-get-version.php                    24-May-2024 16:04                3949
function.apache-getenv.php                         24-May-2024 16:04                5232
function.apache-lookup-uri.php                     24-May-2024 16:04                5980
function.apache-note.php                           24-May-2024 16:04                2794
function.apache-request-headers.php                24-May-2024 16:04                5604
function.apache-response-headers.php               24-May-2024 16:04                4235
function.apache-setenv.php                         24-May-2024 16:04                4003
function.apcu-add.php                              24-May-2024 16:03                8520
function.apcu-cache-info.php                       24-May-2024 16:03                6761
function.apcu-cas.php                              24-May-2024 16:03                8828
function.apcu-clear-cache.php                      24-May-2024 16:03                2643
function.apcu-dec.php                              24-May-2024 16:03                8287
function.apcu-delete.php                           24-May-2024 16:03                6118
function.apcu-enabled.php                          24-May-2024 16:03                2431
function.apcu-entry.php                            24-May-2024 16:03                8493
function.apcu-exists.php                           24-May-2024 16:03                6993
function.apcu-fetch.php                            24-May-2024 16:03                5830
function.apcu-inc.php                              24-May-2024 16:03                8271
function.apcu-key-info.php                         24-May-2024 16:03                5015
function.apcu-sma-info.php                         24-May-2024 16:03                4662
function.apcu-store.php                            24-May-2024 16:03                7403
function.array-change-key-case.php                 24-May-2024 16:04                5794
function.array-chunk.php                           24-May-2024 16:04                6890
function.array-column.php                          24-May-2024 16:04               17010
function.array-combine.php                         24-May-2024 16:04                6649
function.array-count-values.php                    24-May-2024 16:04                5783
function.array-diff-assoc.php                      24-May-2024 16:04               10672
function.array-diff-key.php                        24-May-2024 16:04               12848
function.array-diff-uassoc.php                     24-May-2024 16:04               11969
function.array-diff-ukey.php                       24-May-2024 16:04               12314
function.array-diff.php                            24-May-2024 16:04                6000
function.array-fill-keys.php                       24-May-2024 16:04                5380
function.array-fill.php                            24-May-2024 16:04                4284
function.array-filter.php                          24-May-2024 16:04                9755
function.array-flip.php                            24-May-2024 16:04                6055
function.array-intersect-assoc.php                 24-May-2024 16:04                6575
function.array-intersect-key.php                   24-May-2024 16:04               10148
function.array-intersect-uassoc.php                24-May-2024 16:04                9065
function.array-intersect-ukey.php                  24-May-2024 16:04               11998
function.array-intersect.php                       24-May-2024 16:04                5252
function.array-is-list.php                         24-May-2024 16:04                7148
function.array-key-exists.php                      24-May-2024 16:04                9004
function.array-key-first.php                       24-May-2024 16:04                7155
function.array-key-last.php                        24-May-2024 16:04                3401
function.array-keys.php                            24-May-2024 16:04                3997
function.array-map.php                             24-May-2024 16:04               22715
function.array-merge-recursive.php                 24-May-2024 16:04                6393
function.array-merge.php                           24-May-2024 16:04               11524
function.array-multisort.php                       24-May-2024 16:04               23971
function.array-pad.php                             24-May-2024 16:04                5316
function.array-pop.php                             24-May-2024 16:04                5439
function.array-product.php                         24-May-2024 16:04                5768
function.array-push.php                            24-May-2024 16:04                5430
function.array-rand.php                            24-May-2024 16:04                3996
function.array-reduce.php                          24-May-2024 16:04                6779
function.array-replace-recursive.php               24-May-2024 16:04               11263
function.array-replace.php                         24-May-2024 16:04                6910
function.array-reverse.php                         24-May-2024 16:04                5070
function.array-search.php                          24-May-2024 16:04                7249
function.array-shift.php                           24-May-2024 16:04                4776
function.array-slice.php                           24-May-2024 16:04                6598
function.array-splice.php                          24-May-2024 16:04               11607
function.array-sum.php                             24-May-2024 16:04                4695
function.array-udiff-assoc.php                     24-May-2024 16:04               17940
function.array-udiff-uassoc.php                    24-May-2024 16:04               19384
function.array-udiff.php                           24-May-2024 16:04               30140
function.array-uintersect-assoc.php                24-May-2024 16:04               11861
function.array-uintersect-uassoc.php               24-May-2024 16:04               12209
function.array-uintersect.php                      24-May-2024 16:04               11462
function.array-unique.php                          24-May-2024 16:04                6360
function.array-unshift.php                         24-May-2024 16:04                4587
function.array-values.php                          24-May-2024 16:04                3621
function.array-walk-recursive.php                  24-May-2024 16:04                7693
function.array-walk.php                            24-May-2024 16:04               10121
function.array.php                                 24-May-2024 16:04                9171
function.arsort.php                                24-May-2024 16:04                5821
function.asin.php                                  24-May-2024 16:04                2581
function.asinh.php                                 24-May-2024 16:04                2545
function.asort.php                                 24-May-2024 16:04                5767
function.assert-options.php                        24-May-2024 16:03                4146
function.assert.php                                24-May-2024 16:03               25424
function.atan.php                                  24-May-2024 16:04                2518
function.atan2.php                                 24-May-2024 16:04                2765
function.atanh.php                                 24-May-2024 16:04                2576
function.autoload.php                              24-May-2024 16:04                3184
function.base-convert.php                          24-May-2024 16:04                4486
function.base64-decode.php                         24-May-2024 16:04                5203
function.base64-encode.php                         24-May-2024 16:04                4710
function.basename.php                              24-May-2024 16:04                4312
function.bcadd.php                                 24-May-2024 16:04                4319
function.bccomp.php                                24-May-2024 16:04                4699
function.bcdiv.php                                 24-May-2024 16:04                3706
function.bcmod.php                                 24-May-2024 16:04                3551
function.bcmul.php                                 24-May-2024 16:04                4020
function.bcpow.php                                 24-May-2024 16:04                3752
function.bcpowmod.php                              24-May-2024 16:04                5163
function.bcscale.php                               24-May-2024 16:04                3892
function.bcsqrt.php                                24-May-2024 16:04                3417
function.bcsub.php                                 24-May-2024 16:04                4320
function.bin2hex.php                               24-May-2024 16:04                2404
function.bind-textdomain-codeset.php               24-May-2024 16:04                4631
function.bindec.php                                24-May-2024 16:04                4184
function.bindtextdomain.php                        24-May-2024 16:04                5577
function.boolval.php                               24-May-2024 16:04               10294
function.bzclose.php                               24-May-2024 16:03                2618
function.bzcompress.php                            24-May-2024 16:03                4460
function.bzdecompress.php                          24-May-2024 16:03                4715
function.bzerrno.php                               24-May-2024 16:03                2284
function.bzerror.php                               24-May-2024 16:03                3338
function.bzerrstr.php                              24-May-2024 16:03                2260
function.bzflush.php                               24-May-2024 16:03                2523
function.bzopen.php                                24-May-2024 16:03                4058
function.bzread.php                                24-May-2024 16:03                5204
function.bzwrite.php                               24-May-2024 16:03                4401
function.cal-days-in-month.php                     24-May-2024 16:04                3791
function.cal-from-jd.php                           24-May-2024 16:04                4874
function.cal-info.php                              24-May-2024 16:04                2832
function.cal-to-jd.php                             24-May-2024 16:04                3315
function.call-user-func-array.php                  24-May-2024 16:04               17572
function.call-user-func.php                        24-May-2024 16:04               14388
function.ceil.php                                  24-May-2024 16:04                3600
function.chdir.php                                 24-May-2024 16:04                5690
function.checkdate.php                             24-May-2024 16:04                5650
function.checkdnsrr.php                            24-May-2024 16:04                3420
function.chgrp.php                                 24-May-2024 16:04                6687
function.chmod.php                                 24-May-2024 16:04                8880
function.chop.php                                  24-May-2024 16:04                1981
function.chown.php                                 24-May-2024 16:04                6794
function.chr.php                                   24-May-2024 16:04                3884
function.chroot.php                                24-May-2024 16:04                2778
function.chunk-split.php                           24-May-2024 16:04                4277
function.class-alias.php                           24-May-2024 16:04                9090
function.class-exists.php                          24-May-2024 16:04                7054
function.class-implements.php                      24-May-2024 16:04                7369
function.class-parents.php                         24-May-2024 16:04                7078
function.class-uses.php                            24-May-2024 16:04                6351
function.clearstatcache.php                        24-May-2024 16:04                5738
function.cli-get-process-title.php                 24-May-2024 16:03                4528
function.cli-set-process-title.php                 24-May-2024 16:03                5600
function.closedir.php                              24-May-2024 16:04                2136
function.closelog.php                              24-May-2024 16:04                2315
function.com-create-guid.php                       24-May-2024 16:04                2907
function.com-event-sink.php                        24-May-2024 16:04               10468
function.com-get-active-object.php                 24-May-2024 16:04                5730
function.com-load-typelib.php                      24-May-2024 16:04                2400
function.com-message-pump.php                      24-May-2024 16:04                4109
function.com-print-typeinfo.php                    24-May-2024 16:04                5205
function.commonmark-parse.php                      24-May-2024 16:04                4189
function.commonmark-render-html.php                24-May-2024 16:04                4744
function.commonmark-render-latex.php               24-May-2024 16:04                5074
function.commonmark-render-man.php                 24-May-2024 16:04                5056
function.commonmark-render-xml.php                 24-May-2024 16:04                4701
function.commonmark-render.php                     24-May-2024 16:04                5002
function.compact.php                               24-May-2024 16:04                5837
function.connection-aborted.php                    24-May-2024 16:04                3021
function.connection-status.php                     24-May-2024 16:04                3210
function.constant.php                              24-May-2024 16:04                6565
function.convert-cyr-string.php                    24-May-2024 16:04                3544
function.convert-uudecode.php                      24-May-2024 16:04                3005
function.convert-uuencode.php                      24-May-2024 16:04                3372
function.copy.php                                  24-May-2024 16:04                5396
function.cos.php                                   24-May-2024 16:04                3044
function.cosh.php                                  24-May-2024 16:04                2406
function.count-chars.php                           24-May-2024 16:04                6824
function.count.php                                 24-May-2024 16:04               10107
function.crc32.php                                 24-May-2024 16:04                3819
function.create-function.php                       24-May-2024 16:04               31008
function.crypt.php                                 24-May-2024 16:04               11375
function.ctype-alnum.php                           24-May-2024 16:04                6906
function.ctype-alpha.php                           24-May-2024 16:04                7258
function.ctype-cntrl.php                           24-May-2024 16:04                6906
function.ctype-digit.php                           24-May-2024 16:04                9051
function.ctype-graph.php                           24-May-2024 16:04                7586
function.ctype-lower.php                           24-May-2024 16:04                6955
function.ctype-print.php                           24-May-2024 16:04                7651
function.ctype-punct.php                           24-May-2024 16:04                6961
function.ctype-space.php                           24-May-2024 16:04                7733
function.ctype-upper.php                           24-May-2024 16:04                7000
function.ctype-xdigit.php                          24-May-2024 16:04                6829
function.cubrid-affected-rows.php                  24-May-2024 16:03                9450
function.cubrid-bind.php                           24-May-2024 16:03               20759
function.cubrid-client-encoding.php                24-May-2024 16:03                5330
function.cubrid-close-prepare.php                  24-May-2024 16:03                6300
function.cubrid-close-request.php                  24-May-2024 16:03                6311
function.cubrid-close.php                          24-May-2024 16:03                6444
function.cubrid-col-get.php                        24-May-2024 16:03                8605
function.cubrid-col-size.php                       24-May-2024 16:03                8717
function.cubrid-column-names.php                   24-May-2024 16:03                8555
function.cubrid-column-types.php                   24-May-2024 16:03                8535
function.cubrid-commit.php                         24-May-2024 16:03               15383
function.cubrid-connect-with-url.php               24-May-2024 16:03               15151
function.cubrid-connect.php                        24-May-2024 16:03               12369
function.cubrid-current-oid.php                    24-May-2024 16:03                6036
function.cubrid-data-seek.php                      24-May-2024 16:03                7513
function.cubrid-db-name.php                        24-May-2024 16:03                6602
function.cubrid-disconnect.php                     24-May-2024 16:03                7183
function.cubrid-drop.php                           24-May-2024 16:03               11478
function.cubrid-errno.php                          24-May-2024 16:03                6859
function.cubrid-error-code-facility.php            24-May-2024 16:03                5871
function.cubrid-error-code.php                     24-May-2024 16:03                5781
function.cubrid-error-msg.php                      24-May-2024 16:03                5231
function.cubrid-error.php                          24-May-2024 16:03                6419
function.cubrid-execute.php                        24-May-2024 16:03               14423
function.cubrid-fetch-array.php                    24-May-2024 16:03                9860
function.cubrid-fetch-assoc.php                    24-May-2024 16:03                9094
function.cubrid-fetch-field.php                    24-May-2024 16:03               14140
function.cubrid-fetch-lengths.php                  24-May-2024 16:03                6175
function.cubrid-fetch-object.php                   24-May-2024 16:03               12039
function.cubrid-fetch-row.php                      24-May-2024 16:03                9042
function.cubrid-fetch.php                          24-May-2024 16:03                9991
function.cubrid-field-flags.php                    24-May-2024 16:03                7833
function.cubrid-field-len.php                      24-May-2024 16:03                8342
function.cubrid-field-name.php                     24-May-2024 16:03                7248
function.cubrid-field-seek.php                     24-May-2024 16:03               11000
function.cubrid-field-table.php                    24-May-2024 16:03                7453
function.cubrid-field-type.php                     24-May-2024 16:03                7515
function.cubrid-free-result.php                    24-May-2024 16:03                5990
function.cubrid-get-autocommit.php                 24-May-2024 16:03                3848
function.cubrid-get-charset.php                    24-May-2024 16:03                5048
function.cubrid-get-class-name.php                 24-May-2024 16:03                6378
function.cubrid-get-client-info.php                24-May-2024 16:03                8181
function.cubrid-get-db-parameter.php               24-May-2024 16:03               14339
function.cubrid-get-query-timeout.php              24-May-2024 16:03                6764
function.cubrid-get-server-info.php                24-May-2024 16:03                8472
function.cubrid-get.php                            24-May-2024 16:03                9901
function.cubrid-insert-id.php                      24-May-2024 16:03                7188
function.cubrid-is-instance.php                    24-May-2024 16:03                7225
function.cubrid-list-dbs.php                       24-May-2024 16:03                4595
function.cubrid-load-from-glo.php                  24-May-2024 16:03                6942
function.cubrid-lob-close.php                      24-May-2024 16:03                7302
function.cubrid-lob-export.php                     24-May-2024 16:03                7881
function.cubrid-lob-get.php                        24-May-2024 16:03                7705
function.cubrid-lob-send.php                       24-May-2024 16:03                7056
function.cubrid-lob-size.php                       24-May-2024 16:03                5877
function.cubrid-lob2-bind.php                      24-May-2024 16:03                9766
function.cubrid-lob2-close.php                     24-May-2024 16:03                3459
function.cubrid-lob2-export.php                    24-May-2024 16:03                8759
function.cubrid-lob2-import.php                    24-May-2024 16:03                8628
function.cubrid-lob2-new.php                       24-May-2024 16:03                3973
function.cubrid-lob2-read.php                      24-May-2024 16:03               13730
function.cubrid-lob2-seek.php                      24-May-2024 16:03               11290
function.cubrid-lob2-seek64.php                    24-May-2024 16:03               12710
function.cubrid-lob2-size.php                      24-May-2024 16:03                4354
function.cubrid-lob2-size64.php                    24-May-2024 16:03                4534
function.cubrid-lob2-tell.php                      24-May-2024 16:03                4373
function.cubrid-lob2-tell64.php                    24-May-2024 16:03                4571
function.cubrid-lob2-write.php                     24-May-2024 16:03               14052
function.cubrid-lock-read.php                      24-May-2024 16:03                9199
function.cubrid-lock-write.php                     24-May-2024 16:03                9587
function.cubrid-move-cursor.php                    24-May-2024 16:03                9571
function.cubrid-new-glo.php                        24-May-2024 16:03                7021
function.cubrid-next-result.php                    24-May-2024 16:03               16358
function.cubrid-num-cols.php                       24-May-2024 16:03                6022
function.cubrid-num-fields.php                     24-May-2024 16:03                5742
function.cubrid-num-rows.php                       24-May-2024 16:03                7206
function.cubrid-pconnect-with-url.php              24-May-2024 16:03               14478
function.cubrid-pconnect.php                       24-May-2024 16:03               12150
function.cubrid-ping.php                           24-May-2024 16:03                6143
function.cubrid-prepare.php                        24-May-2024 16:03               10305
function.cubrid-put.php                            24-May-2024 16:03               11420
function.cubrid-query.php                          24-May-2024 16:03               14798
function.cubrid-real-escape-string.php             24-May-2024 16:03                8302
function.cubrid-result.php                         24-May-2024 16:03                7473
function.cubrid-rollback.php                       24-May-2024 16:03               14678
function.cubrid-save-to-glo.php                    24-May-2024 16:03                6883
function.cubrid-schema.php                         24-May-2024 16:03               20508
function.cubrid-send-glo.php                       24-May-2024 16:03                6322
function.cubrid-seq-drop.php                       24-May-2024 16:03                9848
function.cubrid-seq-insert.php                     24-May-2024 16:03               10354
function.cubrid-seq-put.php                        24-May-2024 16:03               10281
function.cubrid-set-add.php                        24-May-2024 16:03                9620
function.cubrid-set-autocommit.php                 24-May-2024 16:03                4222
function.cubrid-set-db-parameter.php               24-May-2024 16:03                8235
function.cubrid-set-drop.php                       24-May-2024 16:03                9597
function.cubrid-set-query-timeout.php              24-May-2024 16:03                3610
function.cubrid-unbuffered-query.php               24-May-2024 16:03                7052
function.cubrid-version.php                        24-May-2024 16:03                8733
function.curl-close.php                            24-May-2024 16:04                6031
function.curl-copy-handle.php                      24-May-2024 16:04                6371
function.curl-errno.php                            24-May-2024 16:04                6126
function.curl-error.php                            24-May-2024 16:04                6039
function.curl-escape.php                           24-May-2024 16:04                7473
function.curl-exec.php                             24-May-2024 16:04                5641
function.curl-getinfo.php                          24-May-2024 16:04               20508
function.curl-init.php                             24-May-2024 16:04                6298
function.curl-multi-add-handle.php                 24-May-2024 16:04               10224
function.curl-multi-close.php                      24-May-2024 16:04                9563
function.curl-multi-errno.php                      24-May-2024 16:04                3901
function.curl-multi-exec.php                       24-May-2024 16:04               10314
function.curl-multi-getcontent.php                 24-May-2024 16:04                4371
function.curl-multi-info-read.php                  24-May-2024 16:04               12276
function.curl-multi-init.php                       24-May-2024 16:04                9062
function.curl-multi-remove-handle.php              24-May-2024 16:04                5481
function.curl-multi-select.php                     24-May-2024 16:04                4455
function.curl-multi-setopt.php                     24-May-2024 16:04               13069
function.curl-multi-strerror.php                   24-May-2024 16:04                7059
function.curl-pause.php                            24-May-2024 16:04                3876
function.curl-reset.php                            24-May-2024 16:04                6358
function.curl-setopt-array.php                     24-May-2024 16:04                7574
function.curl-setopt.php                           24-May-2024 16:04               95256
function.curl-share-close.php                      24-May-2024 16:04                7879
function.curl-share-errno.php                      24-May-2024 16:04                3903
function.curl-share-init.php                       24-May-2024 16:04                7467
function.curl-share-setopt.php                     24-May-2024 16:04               10104
function.curl-share-strerror.php                   24-May-2024 16:04                3437
function.curl-strerror.php                         24-May-2024 16:04                6246
function.curl-unescape.php                         24-May-2024 16:04                7896
function.curl-version.php                          24-May-2024 16:04                6543
function.curl_upkeep.php                           24-May-2024 16:04                6919
function.current.php                               24-May-2024 16:04                6410
function.date-add.php                              24-May-2024 16:04                1748
function.date-create-from-format.php               24-May-2024 16:04                1923
function.date-create-immutable-from-format.php     24-May-2024 16:04                2035
function.date-create-immutable.php                 24-May-2024 16:04                4291
function.date-create.php                           24-May-2024 16:04                4445
function.date-date-set.php                         24-May-2024 16:04                1807
function.date-default-timezone-get.php             24-May-2024 16:04                6969
function.date-default-timezone-set.php             24-May-2024 16:04                5642
function.date-diff.php                             24-May-2024 16:04                1767
function.date-format.php                           24-May-2024 16:04                1775
function.date-get-last-errors.php                  24-May-2024 16:04                1940
function.date-interval-create-from-date-string.php 24-May-2024 16:04                2051
function.date-interval-format.php                  24-May-2024 16:04                1902
function.date-isodate-set.php                      24-May-2024 16:04                1830
function.date-modify.php                           24-May-2024 16:04                1779
function.date-offset-get.php                       24-May-2024 16:04                1823
function.date-parse-from-format.php                24-May-2024 16:04               13819
function.date-parse.php                            24-May-2024 16:04               19475
function.date-sub.php                              24-May-2024 16:04                2355
function.date-sun-info.php                         24-May-2024 16:04               15800
function.date-sunrise.php                          24-May-2024 16:04               14515
function.date-sunset.php                           24-May-2024 16:04               14495
function.date-time-set.php                         24-May-2024 16:04                1793
function.date-timestamp-get.php                    24-May-2024 16:04                1852
function.date-timestamp-set.php                    24-May-2024 16:04                1860
function.date-timezone-get.php                     24-May-2024 16:04                1849
function.date-timezone-set.php                     24-May-2024 16:04                1821
function.date.php                                  24-May-2024 16:04               21800
function.db2-autocommit.php                        24-May-2024 16:03               11122
function.db2-bind-param.php                        24-May-2024 16:03               22894
function.db2-client-info.php                       24-May-2024 16:03               11674
function.db2-close.php                             24-May-2024 16:03                5698
function.db2-column-privileges.php                 24-May-2024 16:03                9184
function.db2-columns.php                           24-May-2024 16:03               11233
function.db2-commit.php                            24-May-2024 16:03                3766
function.db2-conn-error.php                        24-May-2024 16:03                6971
function.db2-conn-errormsg.php                     24-May-2024 16:03                6763
function.db2-connect.php                           24-May-2024 16:03               39193
function.db2-cursor-type.php                       24-May-2024 16:03                3354
function.db2-escape-string.php                     24-May-2024 16:03                7608
function.db2-exec.php                              24-May-2024 16:03               26363
function.db2-execute.php                           24-May-2024 16:03               25730
function.db2-fetch-array.php                       24-May-2024 16:03               11323
function.db2-fetch-assoc.php                       24-May-2024 16:03               11339
function.db2-fetch-both.php                        24-May-2024 16:03               11872
function.db2-fetch-object.php                      24-May-2024 16:03                9046
function.db2-fetch-row.php                         24-May-2024 16:03               16336
function.db2-field-display-size.php                24-May-2024 16:03                5148
function.db2-field-name.php                        24-May-2024 16:03                5036
function.db2-field-num.php                         24-May-2024 16:03                5044
function.db2-field-precision.php                   24-May-2024 16:03                5076
function.db2-field-scale.php                       24-May-2024 16:03                5038
function.db2-field-type.php                        24-May-2024 16:03                5041
function.db2-field-width.php                       24-May-2024 16:03                5246
function.db2-foreign-keys.php                      24-May-2024 16:03                9089
function.db2-free-result.php                       24-May-2024 16:03                3424
function.db2-free-stmt.php                         24-May-2024 16:03                3412
function.db2-get-option.php                        24-May-2024 16:03               24117
function.db2-last-insert-id.php                    24-May-2024 16:03                8182
function.db2-lob-read.php                          24-May-2024 16:03               16415
function.db2-next-result.php                       24-May-2024 16:03                8856
function.db2-num-fields.php                        24-May-2024 16:03                7202
function.db2-num-rows.php                          24-May-2024 16:03                4768
function.db2-pclose.php                            24-May-2024 16:03                5891
function.db2-pconnect.php                          24-May-2024 16:03               32307
function.db2-prepare.php                           24-May-2024 16:03               10602
function.db2-primary-keys.php                      24-May-2024 16:03                7723
function.db2-procedure-columns.php                 24-May-2024 16:03               12191
function.db2-procedures.php                        24-May-2024 16:03                8052
function.db2-result.php                            24-May-2024 16:03                8005
function.db2-rollback.php                          24-May-2024 16:03                9350
function.db2-server-info.php                       24-May-2024 16:03               22520
function.db2-set-option.php                        24-May-2024 16:03               67391
function.db2-special-columns.php                   24-May-2024 16:03               10304
function.db2-statistics.php                        24-May-2024 16:03               12575
function.db2-stmt-error.php                        24-May-2024 16:03                4653
function.db2-stmt-errormsg.php                     24-May-2024 16:03                4284
function.db2-table-privileges.php                  24-May-2024 16:03                8613
function.db2-tables.php                            24-May-2024 16:03                8943
function.dba-close.php                             24-May-2024 16:03                3224
function.dba-delete.php                            24-May-2024 16:03                4170
function.dba-exists.php                            24-May-2024 16:03                4193
function.dba-fetch.php                             24-May-2024 16:03                7145
function.dba-firstkey.php                          24-May-2024 16:03                3682
function.dba-handlers.php                          24-May-2024 16:03                5555
function.dba-insert.php                            24-May-2024 16:03                4808
function.dba-key-split.php                         24-May-2024 16:03                3982
function.dba-list.php                              24-May-2024 16:03                2265
function.dba-nextkey.php                           24-May-2024 16:03                3604
function.dba-open.php                              24-May-2024 16:03               13863
function.dba-optimize.php                          24-May-2024 16:03                3254
function.dba-popen.php                             24-May-2024 16:03                9193
function.dba-replace.php                           24-May-2024 16:03                4636
function.dba-sync.php                              24-May-2024 16:03                3274
function.dbase-add-record.php                      24-May-2024 16:03                2458
function.dbase-close.php                           24-May-2024 16:03                2046
function.dbase-create.php                          24-May-2024 16:03                6324
function.dbase-delete-record.php                   24-May-2024 16:03                2466
function.dbase-get-header-info.php                 24-May-2024 16:03                5834
function.dbase-get-record-with-names.php           24-May-2024 16:03                3164
function.dbase-get-record.php                      24-May-2024 16:03                3073
function.dbase-numfields.php                       24-May-2024 16:03                3851
function.dbase-numrecords.php                      24-May-2024 16:03                2247
function.dbase-open.php                            24-May-2024 16:03                6804
function.dbase-pack.php                            24-May-2024 16:03                2202
function.dbase-replace-record.php                  24-May-2024 16:03                3043
function.dcgettext.php                             24-May-2024 16:04                3551
function.dcngettext.php                            24-May-2024 16:04                4203
function.debug-backtrace.php                       24-May-2024 16:03                9442
function.debug-print-backtrace.php                 24-May-2024 16:03                5250
function.debug-zval-dump.php                       24-May-2024 16:04                9577
function.decbin.php                                24-May-2024 16:04                3683
function.dechex.php                                24-May-2024 16:04                3665
function.decoct.php                                24-May-2024 16:04                3769
function.define.php                                24-May-2024 16:04                6940
function.defined.php                               24-May-2024 16:04                5209
function.deflate-add.php                           24-May-2024 16:03                5907
function.deflate-init.php                          24-May-2024 16:03                7851
function.deg2rad.php                               24-May-2024 16:04                3222
function.delete.php                                24-May-2024 16:04                2626
function.dgettext.php                              24-May-2024 16:04                3303
function.die.php                                   24-May-2024 16:04                1579
function.dio-close.php                             24-May-2024 16:04                4011
function.dio-fcntl.php                             24-May-2024 16:04                9836
function.dio-open.php                              24-May-2024 16:04                7418
function.dio-read.php                              24-May-2024 16:04                3587
function.dio-seek.php                              24-May-2024 16:04                7493
function.dio-stat.php                              24-May-2024 16:04                4406
function.dio-tcsetattr.php                         24-May-2024 16:04                6922
function.dio-truncate.php                          24-May-2024 16:04                3904
function.dio-write.php                             24-May-2024 16:04                3923
function.dir.php                                   24-May-2024 16:04                7387
function.dirname.php                               24-May-2024 16:04                5566
function.disk-free-space.php                       24-May-2024 16:04                3837
function.disk-total-space.php                      24-May-2024 16:04                3178
function.diskfreespace.php                         24-May-2024 16:04                1792
function.dl.php                                    24-May-2024 16:03               10312
function.dngettext.php                             24-May-2024 16:04                3967
function.dns-check-record.php                      24-May-2024 16:04                1764
function.dns-get-mx.php                            24-May-2024 16:04                1734
function.dns-get-record.php                        24-May-2024 16:04               22640
function.dom-import-simplexml.php                  24-May-2024 16:04                6658
function.doubleval.php                             24-May-2024 16:04                1717
function.each.php                                  24-May-2024 16:04                9621
function.easter-date.php                           24-May-2024 16:04                5606
function.easter-days.php                           24-May-2024 16:04                5879
function.echo.php                                  24-May-2024 16:04               11379
function.eio-busy.php                              24-May-2024 16:04                4947
function.eio-cancel.php                            24-May-2024 16:04                7511
function.eio-chmod.php                             24-May-2024 16:04                6173
function.eio-chown.php                             24-May-2024 16:04                6375
function.eio-close.php                             24-May-2024 16:04                5606
function.eio-custom.php                            24-May-2024 16:04               10261
function.eio-dup2.php                              24-May-2024 16:04                5655
function.eio-event-loop.php                        24-May-2024 16:04                5805
function.eio-fallocate.php                         24-May-2024 16:04                7510
function.eio-fchmod.php                            24-May-2024 16:04                6133
function.eio-fchown.php                            24-May-2024 16:04                6435
function.eio-fdatasync.php                         24-May-2024 16:04                5519
function.eio-fstat.php                             24-May-2024 16:04               11503
function.eio-fstatvfs.php                          24-May-2024 16:04                5648
function.eio-fsync.php                             24-May-2024 16:04                5622
function.eio-ftruncate.php                         24-May-2024 16:04                6151
function.eio-futime.php                            24-May-2024 16:04                6457
function.eio-get-event-stream.php                  24-May-2024 16:04                8077
function.eio-get-last-error.php                    24-May-2024 16:04                3223
function.eio-grp-add.php                           24-May-2024 16:04               11474
function.eio-grp-cancel.php                        24-May-2024 16:04                3162
function.eio-grp-limit.php                         24-May-2024 16:04                3076
function.eio-grp.php                               24-May-2024 16:04               11699
function.eio-init.php                              24-May-2024 16:04                2624
function.eio-link.php                              24-May-2024 16:04               12513
function.eio-lstat.php                             24-May-2024 16:04                9886
function.eio-mkdir.php                             24-May-2024 16:04                9189
function.eio-mknod.php                             24-May-2024 16:04               11491
function.eio-nop.php                               24-May-2024 16:04                5279
function.eio-npending.php                          24-May-2024 16:04                3034
function.eio-nready.php                            24-May-2024 16:04                2782
function.eio-nreqs.php                             24-May-2024 16:04                5565
function.eio-nthreads.php                          24-May-2024 16:04                3456
function.eio-open.php                              24-May-2024 16:04               11468
function.eio-poll.php                              24-May-2024 16:04                5693
function.eio-read.php                              24-May-2024 16:04               12483
function.eio-readahead.php                         24-May-2024 16:04                6188
function.eio-readdir.php                           24-May-2024 16:04               18212
function.eio-readlink.php                          24-May-2024 16:04               12200
function.eio-realpath.php                          24-May-2024 16:04                5366
function.eio-rename.php                            24-May-2024 16:04                9273
function.eio-rmdir.php                             24-May-2024 16:04                8220
function.eio-seek.php                              24-May-2024 16:04                6998
function.eio-sendfile.php                          24-May-2024 16:04                6513
function.eio-set-max-idle.php                      24-May-2024 16:04                3165
function.eio-set-max-parallel.php                  24-May-2024 16:04                3214
function.eio-set-max-poll-reqs.php                 24-May-2024 16:04                2531
function.eio-set-max-poll-time.php                 24-May-2024 16:04                2601
function.eio-set-min-parallel.php                  24-May-2024 16:04                3205
function.eio-stat.php                              24-May-2024 16:04                9863
function.eio-statvfs.php                           24-May-2024 16:04                8347
function.eio-symlink.php                           24-May-2024 16:04               10834
function.eio-sync-file-range.php                   24-May-2024 16:04                7293
function.eio-sync.php                              24-May-2024 16:04                2921
function.eio-syncfs.php                            24-May-2024 16:04                5202
function.eio-truncate.php                          24-May-2024 16:04                6128
function.eio-unlink.php                            24-May-2024 16:04                5308
function.eio-utime.php                             24-May-2024 16:04                6166
function.eio-write.php                             24-May-2024 16:04                6884
function.empty.php                                 24-May-2024 16:04               11711
function.enchant-broker-describe.php               24-May-2024 16:04                6097
function.enchant-broker-dict-exists.php            24-May-2024 16:04                5774
function.enchant-broker-free-dict.php              24-May-2024 16:04                4851
function.enchant-broker-free.php                   24-May-2024 16:04                4403
function.enchant-broker-get-dict-path.php          24-May-2024 16:04                5355
function.enchant-broker-get-error.php              24-May-2024 16:04                3725
function.enchant-broker-init.php                   24-May-2024 16:04                3539
function.enchant-broker-list-dicts.php             24-May-2024 16:04                6977
function.enchant-broker-request-dict.php           24-May-2024 16:04                7095
function.enchant-broker-request-pwl-dict.php       24-May-2024 16:04                5420
function.enchant-broker-set-dict-path.php          24-May-2024 16:04                5648
function.enchant-broker-set-ordering.php           24-May-2024 16:04                4864
function.enchant-dict-add-to-personal.php          24-May-2024 16:04                2201
function.enchant-dict-add-to-session.php           24-May-2024 16:04                4496
function.enchant-dict-add.php                      24-May-2024 16:04                6438
function.enchant-dict-check.php                    24-May-2024 16:04                4306
function.enchant-dict-describe.php                 24-May-2024 16:04                6593
function.enchant-dict-get-error.php                24-May-2024 16:04                3928
function.enchant-dict-is-added.php                 24-May-2024 16:04                4538
function.enchant-dict-is-in-session.php            24-May-2024 16:04                2187
function.enchant-dict-quick-check.php              24-May-2024 16:04                8349
function.enchant-dict-store-replacement.php        24-May-2024 16:04                4775
function.enchant-dict-suggest.php                  24-May-2024 16:04                7496
function.end.php                                   24-May-2024 16:04                3538
function.enum-exists.php                           24-May-2024 16:04                5385
function.error-clear-last.php                      24-May-2024 16:03                4654
function.error-get-last.php                        24-May-2024 16:03                4890
function.error-log.php                             24-May-2024 16:03                9094
function.error-reporting.php                       24-May-2024 16:03               11844
function.escapeshellarg.php                        24-May-2024 16:04                3871
function.escapeshellcmd.php                        24-May-2024 16:04                4713
function.eval.php                                  24-May-2024 16:04                8550
function.exec.php                                  24-May-2024 16:04                7906
function.exif-imagetype.php                        24-May-2024 16:04               10003
function.exif-read-data.php                        24-May-2024 16:04               21345
function.exif-tagname.php                          24-May-2024 16:04                4769
function.exif-thumbnail.php                        24-May-2024 16:04                8941
function.exit.php                                  24-May-2024 16:04                9120
function.exp.php                                   24-May-2024 16:04                3590
function.expect-expectl.php                        24-May-2024 16:04               11113
function.expect-popen.php                          24-May-2024 16:04                4662
function.explode.php                               24-May-2024 16:04                9519
function.expm1.php                                 24-May-2024 16:04                2706
function.extension-loaded.php                      24-May-2024 16:03                4763
function.extract.php                               24-May-2024 16:04               14556
function.ezmlm-hash.php                            24-May-2024 16:04                3594
function.fann-cascadetrain-on-data.php             24-May-2024 16:04                6814
function.fann-cascadetrain-on-file.php             24-May-2024 16:04                5696
function.fann-clear-scaling-params.php             24-May-2024 16:04                2826
function.fann-copy.php                             24-May-2024 16:04                3348
function.fann-create-from-file.php                 24-May-2024 16:04                3364
function.fann-create-shortcut-array.php            24-May-2024 16:04                4191
function.fann-create-shortcut.php                  24-May-2024 16:04                5211
function.fann-create-sparse-array.php              24-May-2024 16:04                4830
function.fann-create-sparse.php                    24-May-2024 16:04                5588
function.fann-create-standard-array.php            24-May-2024 16:04                4504
function.fann-create-standard.php                  24-May-2024 16:04                5279
function.fann-create-train-from-callback.php       24-May-2024 16:04                9140
function.fann-create-train.php                     24-May-2024 16:04                4669
function.fann-descale-input.php                    24-May-2024 16:04                3887
function.fann-descale-output.php                   24-May-2024 16:04                3903
function.fann-descale-train.php                    24-May-2024 16:04                3916
function.fann-destroy-train.php                    24-May-2024 16:04                2779
function.fann-destroy.php                          24-May-2024 16:04                2813
function.fann-duplicate-train-data.php             24-May-2024 16:04                3022
function.fann-get-activation-function.php          24-May-2024 16:04                5357
function.fann-get-activation-steepness.php         24-May-2024 16:04                5770
function.fann-get-bias-array.php                   24-May-2024 16:04                2696
function.fann-get-bit-fail-limit.php               24-May-2024 16:04                3917
function.fann-get-bit-fail.php                     24-May-2024 16:04                5005
function.fann-get-cascade-activation-functions-..> 24-May-2024 16:04                3954
function.fann-get-cascade-activation-functions.php 24-May-2024 16:04                4770
function.fann-get-cascade-activation-steepnesse..> 24-May-2024 16:04                4010
function.fann-get-cascade-activation-steepnesse..> 24-May-2024 16:04                4161
function.fann-get-cascade-candidate-change-frac..> 24-May-2024 16:04                5267
function.fann-get-cascade-candidate-limit.php      24-May-2024 16:04                3657
function.fann-get-cascade-candidate-stagnation-..> 24-May-2024 16:04                4393
function.fann-get-cascade-max-cand-epochs.php      24-May-2024 16:04                3539
function.fann-get-cascade-max-out-epochs.php       24-May-2024 16:04                3460
function.fann-get-cascade-min-cand-epochs.php      24-May-2024 16:04                3843
function.fann-get-cascade-min-out-epochs.php       24-May-2024 16:04                3800
function.fann-get-cascade-num-candidate-groups.php 24-May-2024 16:04                3937
function.fann-get-cascade-num-candidates.php       24-May-2024 16:04                6071
function.fann-get-cascade-output-change-fractio..> 24-May-2024 16:04                5195
function.fann-get-cascade-output-stagnation-epo..> 24-May-2024 16:04                4336
function.fann-get-cascade-weight-multiplier.php    24-May-2024 16:04                3615
function.fann-get-connection-array.php             24-May-2024 16:04                2723
function.fann-get-connection-rate.php              24-May-2024 16:04                2846
function.fann-get-errno.php                        24-May-2024 16:04                3325
function.fann-get-errstr.php                       24-May-2024 16:04                3330
function.fann-get-layer-array.php                  24-May-2024 16:04                2797
function.fann-get-learning-momentum.php            24-May-2024 16:04                4000
function.fann-get-learning-rate.php                24-May-2024 16:04                3934
function.fann-get-mse.php                          24-May-2024 16:04                3320
function.fann-get-network-type.php                 24-May-2024 16:04                2816
function.fann-get-num-input.php                    24-May-2024 16:04                2703
function.fann-get-num-layers.php                   24-May-2024 16:04                2758
function.fann-get-num-output.php                   24-May-2024 16:04                2722
function.fann-get-quickprop-decay.php              24-May-2024 16:04                3472
function.fann-get-quickprop-mu.php                 24-May-2024 16:04                3365
function.fann-get-rprop-decrease-factor.php        24-May-2024 16:04                3426
function.fann-get-rprop-delta-max.php              24-May-2024 16:04                3488
function.fann-get-rprop-delta-min.php              24-May-2024 16:04                3299
function.fann-get-rprop-delta-zero.php             24-May-2024 16:04                3672
function.fann-get-rprop-increase-factor.php        24-May-2024 16:04                3451
function.fann-get-sarprop-step-error-shift.php     24-May-2024 16:04                3760
function.fann-get-sarprop-step-error-threshold-..> 24-May-2024 16:04                3912
function.fann-get-sarprop-temperature.php          24-May-2024 16:04                3674
function.fann-get-sarprop-weight-decay-shift.php   24-May-2024 16:04                3741
function.fann-get-total-connections.php            24-May-2024 16:04                2895
function.fann-get-total-neurons.php                24-May-2024 16:04                2942
function.fann-get-train-error-function.php         24-May-2024 16:04                3704
function.fann-get-train-stop-function.php          24-May-2024 16:04                3690
function.fann-get-training-algorithm.php           24-May-2024 16:04                3924
function.fann-init-weights.php                     24-May-2024 16:04                4567
function.fann-length-train-data.php                24-May-2024 16:04                3018
function.fann-merge-train-data.php                 24-May-2024 16:04                3391
function.fann-num-input-train-data.php             24-May-2024 16:04                3656
function.fann-num-output-train-data.php            24-May-2024 16:04                3654
function.fann-print-error.php                      24-May-2024 16:04                3076
function.fann-randomize-weights.php                24-May-2024 16:04                4077
function.fann-read-train-from-file.php             24-May-2024 16:04                5073
function.fann-reset-errno.php                      24-May-2024 16:04                3252
function.fann-reset-errstr.php                     24-May-2024 16:04                3233
function.fann-reset-mse.php                        24-May-2024 16:04                3564
function.fann-run.php                              24-May-2024 16:04                3012
function.fann-save-train.php                       24-May-2024 16:04                3627
function.fann-save.php                             24-May-2024 16:04                4440
function.fann-scale-input-train-data.php           24-May-2024 16:04                4254
function.fann-scale-input.php                      24-May-2024 16:04                3901
function.fann-scale-output-train-data.php          24-May-2024 16:04                4282
function.fann-scale-output.php                     24-May-2024 16:04                3905
function.fann-scale-train-data.php                 24-May-2024 16:04                4252
function.fann-scale-train.php                      24-May-2024 16:04                3934
function.fann-set-activation-function-hidden.php   24-May-2024 16:04                4596
function.fann-set-activation-function-layer.php    24-May-2024 16:04                5110
function.fann-set-activation-function-output.php   24-May-2024 16:04                4612
function.fann-set-activation-function.php          24-May-2024 16:04                6587
function.fann-set-activation-steepness-hidden.php  24-May-2024 16:04                4882
function.fann-set-activation-steepness-layer.php   24-May-2024 16:04                5347
function.fann-set-activation-steepness-output.php  24-May-2024 16:04                4863
function.fann-set-activation-steepness.php         24-May-2024 16:04                6243
function.fann-set-bit-fail-limit.php               24-May-2024 16:04                3585
function.fann-set-callback.php                     24-May-2024 16:04                5758
function.fann-set-cascade-activation-functions.php 24-May-2024 16:04                4241
function.fann-set-cascade-activation-steepnesse..> 24-May-2024 16:04                4454
function.fann-set-cascade-candidate-change-frac..> 24-May-2024 16:04                3936
function.fann-set-cascade-candidate-limit.php      24-May-2024 16:04                3743
function.fann-set-cascade-candidate-stagnation-..> 24-May-2024 16:04                3998
function.fann-set-cascade-max-cand-epochs.php      24-May-2024 16:04                3744
function.fann-set-cascade-max-out-epochs.php       24-May-2024 16:04                3695
function.fann-set-cascade-min-cand-epochs.php      24-May-2024 16:04                4053
function.fann-set-cascade-min-out-epochs.php       24-May-2024 16:04                4035
function.fann-set-cascade-num-candidate-groups.php 24-May-2024 16:04                3829
function.fann-set-cascade-output-change-fractio..> 24-May-2024 16:04                3893
function.fann-set-cascade-output-stagnation-epo..> 24-May-2024 16:04                3959
function.fann-set-cascade-weight-multiplier.php    24-May-2024 16:04                3728
function.fann-set-error-log.php                    24-May-2024 16:04                3096
function.fann-set-input-scaling-params.php         24-May-2024 16:04                4694
function.fann-set-learning-momentum.php            24-May-2024 16:04                3969
function.fann-set-learning-rate.php                24-May-2024 16:04                3895
function.fann-set-output-scaling-params.php        24-May-2024 16:04                4714
function.fann-set-quickprop-decay.php              24-May-2024 16:04                3656
function.fann-set-quickprop-mu.php                 24-May-2024 16:04                3511
function.fann-set-rprop-decrease-factor.php        24-May-2024 16:04                3713
function.fann-set-rprop-delta-max.php              24-May-2024 16:04                3825
function.fann-set-rprop-delta-min.php              24-May-2024 16:04                3631
function.fann-set-rprop-delta-zero.php             24-May-2024 16:04                4013
function.fann-set-rprop-increase-factor.php        24-May-2024 16:04                3739
function.fann-set-sarprop-step-error-shift.php     24-May-2024 16:04                4103
function.fann-set-sarprop-step-error-threshold-..> 24-May-2024 16:04                4297
function.fann-set-sarprop-temperature.php          24-May-2024 16:04                4014
function.fann-set-sarprop-weight-decay-shift.php   24-May-2024 16:04                4097
function.fann-set-scaling-params.php               24-May-2024 16:04                5731
function.fann-set-train-error-function.php         24-May-2024 16:04                3925
function.fann-set-train-stop-function.php          24-May-2024 16:04                3913
function.fann-set-training-algorithm.php           24-May-2024 16:04                3861
function.fann-set-weight-array.php                 24-May-2024 16:04                3368
function.fann-set-weight.php                       24-May-2024 16:04                3816
function.fann-shuffle-train-data.php               24-May-2024 16:04                2979
function.fann-subset-train-data.php                24-May-2024 16:04                4390
function.fann-test-data.php                        24-May-2024 16:04                4325
function.fann-test.php                             24-May-2024 16:04                4618
function.fann-train-epoch.php                      24-May-2024 16:04                4699
function.fann-train-on-data.php                    24-May-2024 16:04                6641
function.fann-train-on-file.php                    24-May-2024 16:04                6569
function.fann-train.php                            24-May-2024 16:04                4696
function.fastcgi-finish-request.php                24-May-2024 16:04                2642
function.fbird-add-user.php                        24-May-2024 16:03                2343
function.fbird-affected-rows.php                   24-May-2024 16:03                2359
function.fbird-backup.php                          24-May-2024 16:03                1785
function.fbird-blob-add.php                        24-May-2024 16:03                2672
function.fbird-blob-cancel.php                     24-May-2024 16:03                3733
function.fbird-blob-close.php                      24-May-2024 16:03                2703
function.fbird-blob-create.php                     24-May-2024 16:03                2703
function.fbird-blob-echo.php                       24-May-2024 16:03                2506
function.fbird-blob-get.php                        24-May-2024 16:03                2499
function.fbird-blob-import.php                     24-May-2024 16:03                2699
function.fbird-blob-info.php                       24-May-2024 16:03                1817
function.fbird-blob-open.php                       24-May-2024 16:03                2496
function.fbird-close.php                           24-May-2024 16:03                2282
function.fbird-commit-ret.php                      24-May-2024 16:03                1810
function.fbird-commit.php                          24-May-2024 16:03                1778
function.fbird-connect.php                         24-May-2024 16:03                2288
function.fbird-db-info.php                         24-May-2024 16:03                1791
function.fbird-delete-user.php                     24-May-2024 16:03                2356
function.fbird-drop-db.php                         24-May-2024 16:03                2304
function.fbird-errcode.php                         24-May-2024 16:03                2127
function.fbird-errmsg.php                          24-May-2024 16:03                2120
function.fbird-execute.php                         24-May-2024 16:03                2132
function.fbird-fetch-assoc.php                     24-May-2024 16:03                2372
function.fbird-fetch-object.php                    24-May-2024 16:03                2383
function.fbird-fetch-row.php                       24-May-2024 16:03                2360
function.fbird-field-info.php                      24-May-2024 16:03                2202
function.fbird-free-event-handler.php              24-May-2024 16:03                2306
function.fbird-free-query.php                      24-May-2024 16:03                1846
function.fbird-free-result.php                     24-May-2024 16:03                1831
function.fbird-gen-id.php                          24-May-2024 16:03                1788
function.fbird-maintain-db.php                     24-May-2024 16:03                1833
function.fbird-modify-user.php                     24-May-2024 16:03                2372
function.fbird-name-result.php                     24-May-2024 16:03                2355
function.fbird-num-fields.php                      24-May-2024 16:03                2191
function.fbird-num-params.php                      24-May-2024 16:03                2350
function.fbird-param-info.php                      24-May-2024 16:03                2355
function.fbird-pconnect.php                        24-May-2024 16:03                2305
function.fbird-prepare.php                         24-May-2024 16:03                1781
function.fbird-query.php                           24-May-2024 16:03                2621
function.fbird-restore.php                         24-May-2024 16:03                1788
function.fbird-rollback-ret.php                    24-May-2024 16:03                1840
function.fbird-rollback.php                        24-May-2024 16:03                1812
function.fbird-server-info.php                     24-May-2024 16:03                1843
function.fbird-service-attach.php                  24-May-2024 16:03                1882
function.fbird-service-detach.php                  24-May-2024 16:03                1894
function.fbird-set-event-handler.php               24-May-2024 16:03                2465
function.fbird-trans.php                           24-May-2024 16:03                1787
function.fbird-wait-event.php                      24-May-2024 16:03                2390
function.fclose.php                                24-May-2024 16:04                3482
function.fdatasync.php                             24-May-2024 16:04                6011
function.fdf-add-doc-javascript.php                24-May-2024 16:04                5566
function.fdf-add-template.php                      24-May-2024 16:04                2939
function.fdf-close.php                             24-May-2024 16:04                3117
function.fdf-create.php                            24-May-2024 16:04                5614
function.fdf-enum-values.php                       24-May-2024 16:04                2512
function.fdf-errno.php                             24-May-2024 16:04                2794
function.fdf-error.php                             24-May-2024 16:04                3233
function.fdf-get-ap.php                            24-May-2024 16:04                4458
function.fdf-get-attachment.php                    24-May-2024 16:04                6108
function.fdf-get-encoding.php                      24-May-2024 16:04                3415
function.fdf-get-file.php                          24-May-2024 16:04                3235
function.fdf-get-flags.php                         24-May-2024 16:04                2432
function.fdf-get-opt.php                           24-May-2024 16:04                2471
function.fdf-get-status.php                        24-May-2024 16:04                3254
function.fdf-get-value.php                         24-May-2024 16:04                4562
function.fdf-get-version.php                       24-May-2024 16:04                3614
function.fdf-header.php                            24-May-2024 16:04                2369
function.fdf-next-field-name.php                   24-May-2024 16:04                5406
function.fdf-open-string.php                       24-May-2024 16:04                4862
function.fdf-open.php                              24-May-2024 16:04                5873
function.fdf-remove-item.php                       24-May-2024 16:04                2445
function.fdf-save-string.php                       24-May-2024 16:04                5640
function.fdf-save.php                              24-May-2024 16:04                4131
function.fdf-set-ap.php                            24-May-2024 16:04                4685
function.fdf-set-encoding.php                      24-May-2024 16:04                3813
function.fdf-set-file.php                          24-May-2024 16:04                6748
function.fdf-set-flags.php                         24-May-2024 16:04                4437
function.fdf-set-javascript-action.php             24-May-2024 16:04                4634
function.fdf-set-on-import-javascript.php          24-May-2024 16:04                3223
function.fdf-set-opt.php                           24-May-2024 16:04                4720
function.fdf-set-status.php                        24-May-2024 16:04                3850
function.fdf-set-submit-form-action.php            24-May-2024 16:04                4933
function.fdf-set-target-frame.php                  24-May-2024 16:04                3850
function.fdf-set-value.php                         24-May-2024 16:04                5287
function.fdf-set-version.php                       24-May-2024 16:04                4074
function.fdiv.php                                  24-May-2024 16:04                6387
function.feof.php                                  24-May-2024 16:04                3413
function.fflush.php                                24-May-2024 16:04                3126
function.fgetc.php                                 24-May-2024 16:04                5378
function.fgetcsv.php                               24-May-2024 16:04                9761
function.fgets.php                                 24-May-2024 16:04                6870
function.fgetss.php                                24-May-2024 16:04                3984
function.file-exists.php                           24-May-2024 16:04                4819
function.file-get-contents.php                     24-May-2024 16:04                6595
function.file-put-contents.php                     24-May-2024 16:04               13257
function.file.php                                  24-May-2024 16:04                9076
function.fileatime.php                             24-May-2024 16:04                5315
function.filectime.php                             24-May-2024 16:04                5481
function.filegroup.php                             24-May-2024 16:04                5799
function.fileinode.php                             24-May-2024 16:04                3008
function.filemtime.php                             24-May-2024 16:04                5014
function.fileowner.php                             24-May-2024 16:04                3263
function.fileperms.php                             24-May-2024 16:04               14709
function.filesize.php                              24-May-2024 16:04                4667
function.filetype.php                              24-May-2024 16:04                4823
function.filter-has-var.php                        24-May-2024 16:04                3449
function.filter-id.php                             24-May-2024 16:04                3006
function.filter-input-array.php                    24-May-2024 16:04               13237
function.filter-input.php                          24-May-2024 16:04                8550
function.filter-list.php                           24-May-2024 16:04                3703
function.filter-var-array.php                      24-May-2024 16:04               12123
function.filter-var.php                            24-May-2024 16:04               14298
function.finfo-buffer.php                          24-May-2024 16:04                8471
function.finfo-close.php                           24-May-2024 16:04                3602
function.finfo-file.php                            24-May-2024 16:04                9066
function.finfo-open.php                            24-May-2024 16:04               10130
function.finfo-set-flags.php                       24-May-2024 16:04                4635
function.floatval.php                              24-May-2024 16:04                6244
function.flock.php                                 24-May-2024 16:04                9007
function.floor.php                                 24-May-2024 16:04                3561
function.flush.php                                 24-May-2024 16:03                4603
function.fmod.php                                  24-May-2024 16:04                5037
function.fnmatch.php                               24-May-2024 16:04               11054
function.fopen.php                                 24-May-2024 16:04               22855
function.forward-static-call-array.php             24-May-2024 16:04                9569
function.forward-static-call.php                   24-May-2024 16:04                8834
function.fpassthru.php                             24-May-2024 16:04                6795
function.fpm-get-status.php                        24-May-2024 16:04                2825
function.fprintf.php                               24-May-2024 16:04                7547
function.fputcsv.php                               24-May-2024 16:04               10385
function.fputs.php                                 24-May-2024 16:04                1680
function.fread.php                                 24-May-2024 16:04               14580
function.frenchtojd.php                            24-May-2024 16:04                2639
function.fscanf.php                                24-May-2024 16:04                6392
function.fseek.php                                 24-May-2024 16:04                5977
function.fsockopen.php                             24-May-2024 16:04               11705
function.fstat.php                                 24-May-2024 16:04                5429
function.fsync.php                                 24-May-2024 16:04                5773
function.ftell.php                                 24-May-2024 16:04                4769
function.ftok.php                                  24-May-2024 16:04                3033
function.ftp-alloc.php                             24-May-2024 16:04                8470
function.ftp-append.php                            24-May-2024 16:04                4648
function.ftp-cdup.php                              24-May-2024 16:04                5049
function.ftp-chdir.php                             24-May-2024 16:04                5715
function.ftp-chmod.php                             24-May-2024 16:04                7108
function.ftp-close.php                             24-May-2024 16:04                5486
function.ftp-connect.php                           24-May-2024 16:04                5120
function.ftp-delete.php                            24-May-2024 16:04                5645
function.ftp-exec.php                              24-May-2024 16:04                4879
function.ftp-fget.php                              24-May-2024 16:04                7395
function.ftp-fput.php                              24-May-2024 16:04                7389
function.ftp-get-option.php                        24-May-2024 16:04                4086
function.ftp-get.php                               24-May-2024 16:04                6950
function.ftp-login.php                             24-May-2024 16:04                5170
function.ftp-mdtm.php                              24-May-2024 16:04                5892
function.ftp-mkdir.php                             24-May-2024 16:04                4918
function.ftp-mlsd.php                              24-May-2024 16:04                9201
function.ftp-nb-continue.php                       24-May-2024 16:04                4371
function.ftp-nb-fget.php                           24-May-2024 16:04                8141
function.ftp-nb-fput.php                           24-May-2024 16:04                8049
function.ftp-nb-get.php                            24-May-2024 16:04               11750
function.ftp-nb-put.php                            24-May-2024 16:04                9074
function.ftp-nlist.php                             24-May-2024 16:04                4787
function.ftp-pasv.php                              24-May-2024 16:04                5948
function.ftp-put.php                               24-May-2024 16:04                6841
function.ftp-pwd.php                               24-May-2024 16:04                4218
function.ftp-quit.php                              24-May-2024 16:04                1688
function.ftp-raw.php                               24-May-2024 16:04                3867
function.ftp-rawlist.php                           24-May-2024 16:04                5540
function.ftp-rename.php                            24-May-2024 16:04                5749
function.ftp-rmdir.php                             24-May-2024 16:04                5076
function.ftp-set-option.php                        24-May-2024 16:04                5130
function.ftp-site.php                              24-May-2024 16:04                5118
function.ftp-size.php                              24-May-2024 16:04                5371
function.ftp-ssl-connect.php                       24-May-2024 16:04                5928
function.ftp-systype.php                           24-May-2024 16:04                4220
function.ftruncate.php                             24-May-2024 16:04                3327
function.func-get-arg.php                          24-May-2024 16:04               11069
function.func-get-args.php                         24-May-2024 16:04               11714
function.func-num-args.php                         24-May-2024 16:04                5940
function.function-exists.php                       24-May-2024 16:04                6082
function.fwrite.php                                24-May-2024 16:04                7553
function.gc-collect-cycles.php                     24-May-2024 16:03                2573
function.gc-disable.php                            24-May-2024 16:03                2613
function.gc-enable.php                             24-May-2024 16:03                2586
function.gc-enabled.php                            24-May-2024 16:03                3429
function.gc-mem-caches.php                         24-May-2024 16:03                2513
function.gc-status.php                             24-May-2024 16:03                8760
function.gd-info.php                               24-May-2024 16:04                9101
function.geoip-asnum-by-name.php                   24-May-2024 16:04                4262
function.geoip-continent-code-by-name.php          24-May-2024 16:04                5774
function.geoip-country-code-by-name.php            24-May-2024 16:04                5497
function.geoip-country-code3-by-name.php           24-May-2024 16:04                5060
function.geoip-country-name-by-name.php            24-May-2024 16:04                5024
function.geoip-database-info.php                   24-May-2024 16:04                4346
function.geoip-db-avail.php                        24-May-2024 16:04                4562
function.geoip-db-filename.php                     24-May-2024 16:04                4222
function.geoip-db-get-all-info.php                 24-May-2024 16:04                6802
function.geoip-domain-by-name.php                  24-May-2024 16:04                4497
function.geoip-id-by-name.php                      24-May-2024 16:04                5569
function.geoip-isp-by-name.php                     24-May-2024 16:04                4501
function.geoip-netspeedcell-by-name.php            24-May-2024 16:04                5239
function.geoip-org-by-name.php                     24-May-2024 16:04                4520
function.geoip-record-by-name.php                  24-May-2024 16:04                7850
function.geoip-region-by-name.php                  24-May-2024 16:04                5181
function.geoip-region-name-by-code.php             24-May-2024 16:04                7233
function.geoip-setup-custom-directory.php          24-May-2024 16:04                4270
function.geoip-time-zone-by-country-and-region.php 24-May-2024 16:04                7443
function.get-browser.php                           24-May-2024 16:04                8680
function.get-called-class.php                      24-May-2024 16:04                6218
function.get-cfg-var.php                           24-May-2024 16:03                2908
function.get-class-methods.php                     24-May-2024 16:04                6421
function.get-class-vars.php                        24-May-2024 16:04               11037
function.get-class.php                             24-May-2024 16:04                9251
function.get-current-user.php                      24-May-2024 16:03                2471
function.get-debug-type.php                        24-May-2024 16:04                9568
function.get-declared-classes.php                  24-May-2024 16:04                4419
function.get-declared-interfaces.php               24-May-2024 16:04                4316
function.get-declared-traits.php                   24-May-2024 16:04                2865
function.get-defined-constants.php                 24-May-2024 16:03                3799
function.get-defined-functions.php                 24-May-2024 16:04                7149
function.get-defined-vars.php                      24-May-2024 16:04                6167
function.get-extension-funcs.php                   24-May-2024 16:03                3622
function.get-headers.php                           24-May-2024 16:04                9292
function.get-html-translation-table.php            24-May-2024 16:04                5877
function.get-include-path.php                      24-May-2024 16:03                3415
function.get-included-files.php                    24-May-2024 16:03                6166
function.get-loaded-extensions.php                 24-May-2024 16:03                3444
function.get-magic-quotes-gpc.php                  24-May-2024 16:03                4059
function.get-magic-quotes-runtime.php              24-May-2024 16:03                2391
function.get-mangled-object-vars.php               24-May-2024 16:04                8255
function.get-meta-tags.php                         24-May-2024 16:04                7883
function.get-object-vars.php                       24-May-2024 16:04                6955
function.get-parent-class.php                      24-May-2024 16:04                7767
function.get-required-files.php                    24-May-2024 16:03                1854
function.get-resource-id.php                       24-May-2024 16:04                4894
function.get-resource-type.php                     24-May-2024 16:04                5498
function.get-resources.php                         24-May-2024 16:03                8001
function.getallheaders.php                         24-May-2024 16:04                4593
function.getcwd.php                                24-May-2024 16:04                4115
function.getdate.php                               24-May-2024 16:04                8927
function.getenv.php                                24-May-2024 16:03                4993
function.gethostbyaddr.php                         24-May-2024 16:04                2373
function.gethostbyname.php                         24-May-2024 16:04                2300
function.gethostbynamel.php                        24-May-2024 16:04                2712
function.gethostname.php                           24-May-2024 16:04                4010
function.getimagesize.php                          24-May-2024 16:04               16915
function.getimagesizefromstring.php                24-May-2024 16:04                5660
function.getlastmod.php                            24-May-2024 16:03                4166
function.getmxrr.php                               24-May-2024 16:04                3518
function.getmygid.php                              24-May-2024 16:03                2515
function.getmyinode.php                            24-May-2024 16:03                2655
function.getmypid.php                              24-May-2024 16:03                2755
function.getmyuid.php                              24-May-2024 16:03                2498
function.getopt.php                                24-May-2024 16:03                4276
function.getprotobyname.php                        24-May-2024 16:04                2399
function.getprotobynumber.php                      24-May-2024 16:04                2423
function.getrandmax.php                            24-May-2024 16:04                3027
function.getrusage.php                             24-May-2024 16:03                4308
function.getservbyname.php                         24-May-2024 16:04                5420
function.getservbyport.php                         24-May-2024 16:04                2833
function.gettext.php                               24-May-2024 16:04                5870
function.gettimeofday.php                          24-May-2024 16:04                5021
function.gettype.php                               24-May-2024 16:04                9063
function.glob.php                                  24-May-2024 16:04               10676
function.gmdate.php                                24-May-2024 16:04                8114
function.gmmktime.php                              24-May-2024 16:04                3296
function.gmp-abs.php                               24-May-2024 16:04                1952
function.gmp-add.php                               24-May-2024 16:04                2160
function.gmp-and.php                               24-May-2024 16:04                2099
function.gmp-binomial.php                          24-May-2024 16:04                4093
function.gmp-clrbit.php                            24-May-2024 16:04                2193
function.gmp-cmp.php                               24-May-2024 16:04                2236
function.gmp-com.php                               24-May-2024 16:04                2110
function.gmp-div-q.php                             24-May-2024 16:04                3630
function.gmp-div-qr.php                            24-May-2024 16:04                4733
function.gmp-div-r.php                             24-May-2024 16:04                2979
function.gmp-div.php                               24-May-2024 16:04                2203
function.gmp-divexact.php                          24-May-2024 16:04                2415
function.gmp-export.php                            24-May-2024 16:04                5737
function.gmp-fact.php                              24-May-2024 16:04                1979
function.gmp-gcd.php                               24-May-2024 16:04                2274
function.gmp-gcdext.php                            24-May-2024 16:04                2300
function.gmp-hamdist.php                           24-May-2024 16:04                2267
function.gmp-import.php                            24-May-2024 16:04                6056
function.gmp-init.php                              24-May-2024 16:04                3549
function.gmp-intval.php                            24-May-2024 16:04                2415
function.gmp-invert.php                            24-May-2024 16:04                2351
function.gmp-jacobi.php                            24-May-2024 16:04                2408
function.gmp-kronecker.php                         24-May-2024 16:04                4116
function.gmp-lcm.php                               24-May-2024 16:04                3901
function.gmp-legendre.php                          24-May-2024 16:04                2400
function.gmp-mod.php                               24-May-2024 16:04                2265
function.gmp-mul.php                               24-May-2024 16:04                2172
function.gmp-neg.php                               24-May-2024 16:04                1955
function.gmp-nextprime.php                         24-May-2024 16:04                5123
function.gmp-or.php                                24-May-2024 16:04                2118
function.gmp-perfect-power.php                     24-May-2024 16:04                3444
function.gmp-perfect-square.php                    24-May-2024 16:04                2509
function.gmp-popcount.php                          24-May-2024 16:04                2031
function.gmp-pow.php                               24-May-2024 16:04                2302
function.gmp-powm.php                              24-May-2024 16:04                2508
function.gmp-prob-prime.php                        24-May-2024 16:04                2810
function.gmp-random-bits.php                       24-May-2024 16:04                5422
function.gmp-random-range.php                      24-May-2024 16:04                6787
function.gmp-random-seed.php                       24-May-2024 16:04                7637
function.gmp-random.php                            24-May-2024 16:04                2221
function.gmp-root.php                              24-May-2024 16:04                3279
function.gmp-rootrem.php                           24-May-2024 16:04                3445
function.gmp-scan0.php                             24-May-2024 16:04                2276
function.gmp-scan1.php                             24-May-2024 16:04                2275
function.gmp-setbit.php                            24-May-2024 16:04                2502
function.gmp-sign.php                              24-May-2024 16:04                2031
function.gmp-sqrt.php                              24-May-2024 16:04                1970
function.gmp-sqrtrem.php                           24-May-2024 16:04                2301
function.gmp-strval.php                            24-May-2024 16:04                3497
function.gmp-sub.php                               24-May-2024 16:04                2185
function.gmp-testbit.php                           24-May-2024 16:04                6093
function.gmp-xor.php                               24-May-2024 16:04                2108
function.gmstrftime.php                            24-May-2024 16:04                3194
function.gnupg-adddecryptkey.php                   24-May-2024 16:04                5412
function.gnupg-addencryptkey.php                   24-May-2024 16:04                4959
function.gnupg-addsignkey.php                      24-May-2024 16:04                5432
function.gnupg-cleardecryptkeys.php                24-May-2024 16:04                4501
function.gnupg-clearencryptkeys.php                24-May-2024 16:04                4506
function.gnupg-clearsignkeys.php                   24-May-2024 16:04                4448
function.gnupg-decrypt.php                         24-May-2024 16:04                6159
function.gnupg-decryptverify.php                   24-May-2024 16:04                7311
function.gnupg-deletekey.php                       24-May-2024 16:04                5244
function.gnupg-encrypt.php                         24-May-2024 16:04                6062
function.gnupg-encryptsign.php                     24-May-2024 16:04                6962
function.gnupg-export.php                          24-May-2024 16:04                5262
function.gnupg-getengineinfo.php                   24-May-2024 16:04                5635
function.gnupg-geterror.php                        24-May-2024 16:04                4413
function.gnupg-geterrorinfo.php                    24-May-2024 16:04                5738
function.gnupg-getprotocol.php                     24-May-2024 16:04                4501
function.gnupg-gettrustlist.php                    24-May-2024 16:04                5323
function.gnupg-import.php                          24-May-2024 16:04                5520
function.gnupg-init.php                            24-May-2024 16:04                7310
function.gnupg-keyinfo.php                         24-May-2024 16:04                5447
function.gnupg-listsignatures.php                  24-May-2024 16:04                5547
function.gnupg-setarmor.php                        24-May-2024 16:04                5717
function.gnupg-seterrormode.php                    24-May-2024 16:04                5771
function.gnupg-setsignmode.php                     24-May-2024 16:04                5852
function.gnupg-sign.php                            24-May-2024 16:04                6304
function.gnupg-verify.php                          24-May-2024 16:04                8552
function.grapheme-extract.php                      24-May-2024 16:04                9007
function.grapheme-stripos.php                      24-May-2024 16:04                8283
function.grapheme-stristr.php                      24-May-2024 16:04                7893
function.grapheme-strlen.php                       24-May-2024 16:04                5623
function.grapheme-strpos.php                       24-May-2024 16:04                7955
function.grapheme-strripos.php                     24-May-2024 16:04                7727
function.grapheme-strrpos.php                      24-May-2024 16:04                7391
function.grapheme-strstr.php                       24-May-2024 16:04                7542
function.grapheme-substr.php                       24-May-2024 16:04                8144
function.gregoriantojd.php                         24-May-2024 16:04                4179
function.gzclose.php                               24-May-2024 16:03                4370
function.gzcompress.php                            24-May-2024 16:03                5988
function.gzdecode.php                              24-May-2024 16:03                3828
function.gzdeflate.php                             24-May-2024 16:03                5783
function.gzencode.php                              24-May-2024 16:03                7941
function.gzeof.php                                 24-May-2024 16:03                4199
function.gzfile.php                                24-May-2024 16:03                4848
function.gzgetc.php                                24-May-2024 16:03                4755
function.gzgets.php                                24-May-2024 16:03                6208
function.gzgetss.php                               24-May-2024 16:03                6165
function.gzinflate.php                             24-May-2024 16:03                5474
function.gzopen.php                                24-May-2024 16:03                5786
function.gzpassthru.php                            24-May-2024 16:03                4806
function.gzputs.php                                24-May-2024 16:03                1674
function.gzread.php                                24-May-2024 16:03                6706
function.gzrewind.php                              24-May-2024 16:03                3360
function.gzseek.php                                24-May-2024 16:03                6413
function.gztell.php                                24-May-2024 16:03                3511
function.gzuncompress.php                          24-May-2024 16:03                5350
function.gzwrite.php                               24-May-2024 16:03                6711
function.halt-compiler.php                         24-May-2024 16:04                4965
function.hash-algos.php                            24-May-2024 16:03                5849
function.hash-copy.php                             24-May-2024 16:03                5563
function.hash-equals.php                           24-May-2024 16:03                7435
function.hash-file.php                             24-May-2024 16:03                7619
function.hash-final.php                            24-May-2024 16:03                4895
function.hash-hkdf.php                             24-May-2024 16:03                9956
function.hash-hmac-algos.php                       24-May-2024 16:03                5343
function.hash-hmac-file.php                        24-May-2024 16:03                8467
function.hash-hmac.php                             24-May-2024 16:03                8037
function.hash-init.php                             24-May-2024 16:03               10686
function.hash-pbkdf2.php                           24-May-2024 16:03               12785
function.hash-update-file.php                      24-May-2024 16:03                5873
function.hash-update-stream.php                    24-May-2024 16:03                7450
function.hash-update.php                           24-May-2024 16:03                4462
function.hash.php                                  24-May-2024 16:03                7403
function.header-register-callback.php              24-May-2024 16:04                6856
function.header-remove.php                         24-May-2024 16:04                6866
function.header.php                                24-May-2024 16:04               19402
function.headers-list.php                          24-May-2024 16:04                6026
function.headers-sent.php                          24-May-2024 16:04                8237
function.hebrev.php                                24-May-2024 16:04                2533
function.hebrevc.php                               24-May-2024 16:04                2765
function.hex2bin.php                               24-May-2024 16:04                5044
function.hexdec.php                                24-May-2024 16:04                4351
function.highlight-file.php                        24-May-2024 16:04                5640
function.highlight-string.php                      24-May-2024 16:04                6894
function.hrtime.php                                24-May-2024 16:04                5276
function.html-entity-decode.php                    24-May-2024 16:04               11789
function.htmlentities.php                          24-May-2024 16:04               10244
function.htmlspecialchars-decode.php               24-May-2024 16:04                9427
function.htmlspecialchars.php                      24-May-2024 16:04               10401
function.http-build-query.php                      24-May-2024 16:04               19836
function.http-response-code.php                    24-May-2024 16:04                7076
function.hypot.php                                 24-May-2024 16:04                2261
function.ibase-add-user.php                        24-May-2024 16:03                5218
function.ibase-affected-rows.php                   24-May-2024 16:03                3480
function.ibase-backup.php                          24-May-2024 16:03               10530
function.ibase-blob-add.php                        24-May-2024 16:03                4028
function.ibase-blob-cancel.php                     24-May-2024 16:03                3741
function.ibase-blob-close.php                      24-May-2024 16:03                4002
function.ibase-blob-create.php                     24-May-2024 16:03                4079
function.ibase-blob-echo.php                       24-May-2024 16:03                4268
function.ibase-blob-get.php                        24-May-2024 16:03                6599
function.ibase-blob-import.php                     24-May-2024 16:03                8016
function.ibase-blob-info.php                       24-May-2024 16:03                3544
function.ibase-blob-open.php                       24-May-2024 16:03                4474
function.ibase-close.php                           24-May-2024 16:03                3843
function.ibase-commit-ret.php                      24-May-2024 16:03                3361
function.ibase-commit.php                          24-May-2024 16:03                3162
function.ibase-connect.php                         24-May-2024 16:03               10545
function.ibase-db-info.php                         24-May-2024 16:03                2763
function.ibase-delete-user.php                     24-May-2024 16:03                3634
function.ibase-drop-db.php                         24-May-2024 16:03                3741
function.ibase-errcode.php                         24-May-2024 16:03                2721
function.ibase-errmsg.php                          24-May-2024 16:03                2714
function.ibase-execute.php                         24-May-2024 16:03                6983
function.ibase-fetch-assoc.php                     24-May-2024 16:03                4755
function.ibase-fetch-object.php                    24-May-2024 16:03                6681
function.ibase-fetch-row.php                       24-May-2024 16:03                4572
function.ibase-field-info.php                      24-May-2024 16:03                6977
function.ibase-free-event-handler.php              24-May-2024 16:03                3579
function.ibase-free-query.php                      24-May-2024 16:03                2877
function.ibase-free-result.php                     24-May-2024 16:03                2969
function.ibase-gen-id.php                          24-May-2024 16:03                2882
function.ibase-maintain-db.php                     24-May-2024 16:03                3209
function.ibase-modify-user.php                     24-May-2024 16:03                5223
function.ibase-name-result.php                     24-May-2024 16:03                5831
function.ibase-num-fields.php                      24-May-2024 16:03                6438
function.ibase-num-params.php                      24-May-2024 16:03                3470
function.ibase-param-info.php                      24-May-2024 16:03                3722
function.ibase-pconnect.php                        24-May-2024 16:03                7949
function.ibase-prepare.php                         24-May-2024 16:03                4693
function.ibase-query.php                           24-May-2024 16:03                7251
function.ibase-restore.php                         24-May-2024 16:03               10797
function.ibase-rollback-ret.php                    24-May-2024 16:03                3402
function.ibase-rollback.php                        24-May-2024 16:03                3207
function.ibase-server-info.php                     24-May-2024 16:03                9893
function.ibase-service-attach.php                  24-May-2024 16:03               11068
function.ibase-service-detach.php                  24-May-2024 16:03                6186
function.ibase-set-event-handler.php               24-May-2024 16:03                7893
function.ibase-trans.php                           24-May-2024 16:03                5915
function.ibase-wait-event.php                      24-May-2024 16:03                4371
function.iconv-get-encoding.php                    24-May-2024 16:04                5643
function.iconv-mime-decode-headers.php             24-May-2024 16:04               10491
function.iconv-mime-decode.php                     24-May-2024 16:04                8399
function.iconv-mime-encode.php                     24-May-2024 16:04               12015
function.iconv-set-encoding.php                    24-May-2024 16:04                5106
function.iconv-strlen.php                          24-May-2024 16:04                5142
function.iconv-strpos.php                          24-May-2024 16:04                7577
function.iconv-strrpos.php                         24-May-2024 16:04                6806
function.iconv-substr.php                          24-May-2024 16:04                8559
function.iconv.php                                 24-May-2024 16:04                7987
function.idate.php                                 24-May-2024 16:04               11495
function.idn-to-ascii.php                          24-May-2024 16:04                7985
function.idn-to-utf8.php                           24-May-2024 16:04                8004
function.igbinary-serialize.php                    24-May-2024 16:04                9912
function.igbinary-unserialize.php                  24-May-2024 16:04                9941
function.ignore-user-abort.php                     24-May-2024 16:04                7433
function.image-type-to-extension.php               24-May-2024 16:04                5461
function.image-type-to-mime-type.php               24-May-2024 16:04                9092
function.image2wbmp.php                            24-May-2024 16:04                6588
function.imageaffine.php                           24-May-2024 16:04                4846
function.imageaffinematrixconcat.php               24-May-2024 16:04                6682
function.imageaffinematrixget.php                  24-May-2024 16:04                6753
function.imagealphablending.php                    24-May-2024 16:04                7698
function.imageantialias.php                        24-May-2024 16:04               10890
function.imagearc.php                              24-May-2024 16:04               13770
function.imageavif.php                             24-May-2024 16:04                6023
function.imagebmp.php                              24-May-2024 16:04                8179
function.imagechar.php                             24-May-2024 16:04               10103
function.imagecharup.php                           24-May-2024 16:04                9968
function.imagecolorallocate.php                    24-May-2024 16:04               10055
function.imagecolorallocatealpha.php               24-May-2024 16:04               18223
function.imagecolorat.php                          24-May-2024 16:04               10347
function.imagecolorclosest.php                     24-May-2024 16:04               12158
function.imagecolorclosestalpha.php                24-May-2024 16:04               12599
function.imagecolorclosesthwb.php                  24-May-2024 16:04                6665
function.imagecolordeallocate.php                  24-May-2024 16:04                5953
function.imagecolorexact.php                       24-May-2024 16:04                8548
function.imagecolorexactalpha.php                  24-May-2024 16:04                9490
function.imagecolormatch.php                       24-May-2024 16:04                8554
function.imagecolorresolve.php                     24-May-2024 16:04                7727
function.imagecolorresolvealpha.php                24-May-2024 16:04                8447
function.imagecolorset.php                         24-May-2024 16:04                8923
function.imagecolorsforindex.php                   24-May-2024 16:04                7396
function.imagecolorstotal.php                      24-May-2024 16:04                5838
function.imagecolortransparent.php                 24-May-2024 16:04                9167
function.imageconvolution.php                      24-May-2024 16:04               11869
function.imagecopy.php                             24-May-2024 16:04                9581
function.imagecopymerge.php                        24-May-2024 16:04                9835
function.imagecopymergegray.php                    24-May-2024 16:04               10358
function.imagecopyresampled.php                    24-May-2024 16:04               19326
function.imagecopyresized.php                      24-May-2024 16:04               14225
function.imagecreate.php                           24-May-2024 16:04                8425
function.imagecreatefromavif.php                   24-May-2024 16:04                2964
function.imagecreatefrombmp.php                    24-May-2024 16:04                5691
function.imagecreatefromgd.php                     24-May-2024 16:04                6257
function.imagecreatefromgd2.php                    24-May-2024 16:04                6525
function.imagecreatefromgd2part.php                24-May-2024 16:04                9113
function.imagecreatefromgif.php                    24-May-2024 16:04                9860
function.imagecreatefromjpeg.php                   24-May-2024 16:04                9508
function.imagecreatefrompng.php                    24-May-2024 16:04                9452
function.imagecreatefromstring.php                 24-May-2024 16:04                8162
function.imagecreatefromtga.php                    24-May-2024 16:04                3616
function.imagecreatefromwbmp.php                   24-May-2024 16:04                9491
function.imagecreatefromwebp.php                   24-May-2024 16:04                5843
function.imagecreatefromxbm.php                    24-May-2024 16:04                5683
function.imagecreatefromxpm.php                    24-May-2024 16:04                6328
function.imagecreatetruecolor.php                  24-May-2024 16:04                7290
function.imagecrop.php                             24-May-2024 16:04                7860
function.imagecropauto.php                         24-May-2024 16:04               10749
function.imagedashedline.php                       24-May-2024 16:04               12766
function.imagedestroy.php                          24-May-2024 16:04                5149
function.imageellipse.php                          24-May-2024 16:04               10212
function.imagefill.php                             24-May-2024 16:04                7709
function.imagefilledarc.php                        24-May-2024 16:04               19084
function.imagefilledellipse.php                    24-May-2024 16:04                9913
function.imagefilledpolygon.php                    24-May-2024 16:04               12205
function.imagefilledrectangle.php                  24-May-2024 16:04                8501
function.imagefilltoborder.php                     24-May-2024 16:04               11331
function.imagefilter.php                           24-May-2024 16:04               34032
function.imageflip.php                             24-May-2024 16:04                9876
function.imagefontheight.php                       24-May-2024 16:04                6509
function.imagefontwidth.php                        24-May-2024 16:04                6462
function.imageftbbox.php                           24-May-2024 16:04               14307
function.imagefttext.php                           24-May-2024 16:04               15915
function.imagegammacorrect.php                     24-May-2024 16:04                6033
function.imagegd.php                               24-May-2024 16:04               10663
function.imagegd2.php                              24-May-2024 16:04               11617
function.imagegetclip.php                          24-May-2024 16:04                6117
function.imagegetinterpolation.php                 24-May-2024 16:04                3763
function.imagegif.php                              24-May-2024 16:04               16651
function.imagegrabscreen.php                       24-May-2024 16:04                4864
function.imagegrabwindow.php                       24-May-2024 16:04                9978
function.imageinterlace.php                        24-May-2024 16:04                7232
function.imageistruecolor.php                      24-May-2024 16:04                7423
function.imagejpeg.php                             24-May-2024 16:04               14974
function.imagelayereffect.php                      24-May-2024 16:04               12092
function.imageline.php                             24-May-2024 16:04               15634
function.imageloadfont.php                         24-May-2024 16:04                9445
function.imageopenpolygon.php                      24-May-2024 16:04               10565
function.imagepalettecopy.php                      24-May-2024 16:04                7517
function.imagepalettetotruecolor.php               24-May-2024 16:04                9833
function.imagepng.php                              24-May-2024 16:04                9002
function.imagepolygon.php                          24-May-2024 16:04               10819
function.imagerectangle.php                        24-May-2024 16:04               10676
function.imageresolution.php                       24-May-2024 16:04                7925
function.imagerotate.php                           24-May-2024 16:04                9215
function.imagesavealpha.php                        24-May-2024 16:04                7740
function.imagescale.php                            24-May-2024 16:04                6862
function.imagesetbrush.php                         24-May-2024 16:04                9466
function.imagesetclip.php                          24-May-2024 16:04                5333
function.imagesetinterpolation.php                 24-May-2024 16:04               11648
function.imagesetpixel.php                         24-May-2024 16:04               11553
function.imagesetstyle.php                         24-May-2024 16:04               12423
function.imagesetthickness.php                     24-May-2024 16:04                8506
function.imagesettile.php                          24-May-2024 16:04                8487
function.imagestring.php                           24-May-2024 16:04               10303
function.imagestringup.php                         24-May-2024 16:04                9490
function.imagesx.php                               24-May-2024 16:04                5071
function.imagesy.php                               24-May-2024 16:04                5093
function.imagetruecolortopalette.php               24-May-2024 16:04                6961
function.imagettfbbox.php                          24-May-2024 16:04               19592
function.imagettftext.php                          24-May-2024 16:04               18246
function.imagetypes.php                            24-May-2024 16:04                5137
function.imagewbmp.php                             24-May-2024 16:04               15163
function.imagewebp.php                             24-May-2024 16:04                7516
function.imagexbm.php                              24-May-2024 16:04               11953
function.imap-8bit.php                             24-May-2024 16:04                3204
function.imap-alerts.php                           24-May-2024 16:04                3300
function.imap-append.php                           24-May-2024 16:04                9687
function.imap-base64.php                           24-May-2024 16:04                3556
function.imap-binary.php                           24-May-2024 16:04                3168
function.imap-body.php                             24-May-2024 16:04                5681
function.imap-bodystruct.php                       24-May-2024 16:04                4783
function.imap-check.php                            24-May-2024 16:04                6103
function.imap-clearflag-full.php                   24-May-2024 16:04                6531
function.imap-close.php                            24-May-2024 16:04                5044
function.imap-create.php                           24-May-2024 16:04                1778
function.imap-createmailbox.php                    24-May-2024 16:04               13901
function.imap-delete.php                           24-May-2024 16:04               10556
function.imap-deletemailbox.php                    24-May-2024 16:04                5015
function.imap-errors.php                           24-May-2024 16:04                3487
function.imap-expunge.php                          24-May-2024 16:04                3674
function.imap-fetch-overview.php                   24-May-2024 16:04               11362
function.imap-fetchbody.php                        24-May-2024 16:04                6282
function.imap-fetchheader.php                      24-May-2024 16:04                5933
function.imap-fetchmime.php                        24-May-2024 16:04                6471
function.imap-fetchstructure.php                   24-May-2024 16:04                9785
function.imap-fetchtext.php                        24-May-2024 16:04                1759
function.imap-gc.php                               24-May-2024 16:04                5906
function.imap-get-quota.php                        24-May-2024 16:04               12256
function.imap-get-quotaroot.php                    24-May-2024 16:04                9215
function.imap-getacl.php                           24-May-2024 16:04                5955
function.imap-getmailboxes.php                     24-May-2024 16:04               12251
function.imap-getsubscribed.php                    24-May-2024 16:04                7987
function.imap-header.php                           24-May-2024 16:04                1965
function.imap-headerinfo.php                       24-May-2024 16:04               11838
function.imap-headers.php                          24-May-2024 16:04                3557
function.imap-is-open.php                          24-May-2024 16:04                4239
function.imap-last-error.php                       24-May-2024 16:04                3216
function.imap-list.php                             24-May-2024 16:04                8764
function.imap-listmailbox.php                      24-May-2024 16:04                1764
function.imap-listscan.php                         24-May-2024 16:04                7051
function.imap-listsubscribed.php                   24-May-2024 16:04                1785
function.imap-lsub.php                             24-May-2024 16:04                6096
function.imap-mail-compose.php                     24-May-2024 16:04               16602
function.imap-mail-copy.php                        24-May-2024 16:04                6343
function.imap-mail-move.php                        24-May-2024 16:04                6722
function.imap-mail.php                             24-May-2024 16:04                7456
function.imap-mailboxmsginfo.php                   24-May-2024 16:04                9325
function.imap-mime-header-decode.php               24-May-2024 16:04                6524
function.imap-msgno.php                            24-May-2024 16:04                4247
function.imap-mutf7-to-utf8.php                    24-May-2024 16:04                3390
function.imap-num-msg.php                          24-May-2024 16:04                4104
function.imap-num-recent.php                       24-May-2024 16:04                3911
function.imap-open.php                             24-May-2024 16:04               21791
function.imap-ping.php                             24-May-2024 16:04                4970
function.imap-qprint.php                           24-May-2024 16:04                3214
function.imap-rename.php                           24-May-2024 16:04                1781
function.imap-renamemailbox.php                    24-May-2024 16:04                5655
function.imap-reopen.php                           24-May-2024 16:04                8827
function.imap-rfc822-parse-adrlist.php             24-May-2024 16:04                7914
function.imap-rfc822-parse-headers.php             24-May-2024 16:04                3762
function.imap-rfc822-write-address.php             24-May-2024 16:04                5431
function.imap-savebody.php                         24-May-2024 16:04                6680
function.imap-scan.php                             24-May-2024 16:04                1746
function.imap-scanmailbox.php                      24-May-2024 16:04                1776
function.imap-search.php                           24-May-2024 16:04               13621
function.imap-set-quota.php                        24-May-2024 16:04                6821
function.imap-setacl.php                           24-May-2024 16:04                5570
function.imap-setflag-full.php                     24-May-2024 16:04                8692
function.imap-sort.php                             24-May-2024 16:04                8617
function.imap-status.php                           24-May-2024 16:04               10795
function.imap-subscribe.php                        24-May-2024 16:04                4523
function.imap-thread.php                           24-May-2024 16:04                7948
function.imap-timeout.php                          24-May-2024 16:04                4807
function.imap-uid.php                              24-May-2024 16:04                4656
function.imap-undelete.php                         24-May-2024 16:04                5050
function.imap-unsubscribe.php                      24-May-2024 16:04                4600
function.imap-utf7-decode.php                      24-May-2024 16:04                3792
function.imap-utf7-encode.php                      24-May-2024 16:04                3309
function.imap-utf8-to-mutf7.php                    24-May-2024 16:04                3393
function.imap-utf8.php                             24-May-2024 16:04                4283
function.implode.php                               24-May-2024 16:04                4864
function.in-array.php                              24-May-2024 16:04                9078
function.include-once.php                          24-May-2024 16:03                2333
function.include.php                               24-May-2024 16:03               19732
function.inet-ntop.php                             24-May-2024 16:04                6567
function.inet-pton.php                             24-May-2024 16:04                5125
function.inflate-add.php                           24-May-2024 16:03                6227
function.inflate-get-read-len.php                  24-May-2024 16:03                3427
function.inflate-get-status.php                    24-May-2024 16:03                3207
function.inflate-init.php                          24-May-2024 16:03                7048
function.ini-alter.php                             24-May-2024 16:03                1713
function.ini-get-all.php                           24-May-2024 16:03                5069
function.ini-get.php                               24-May-2024 16:03                8615
function.ini-parse-quantity.php                    24-May-2024 16:03                7651
function.ini-restore.php                           24-May-2024 16:03                2408
function.ini-set.php                               24-May-2024 16:03                3229
function.inotify-add-watch.php                     24-May-2024 16:04                4487
function.inotify-init.php                          24-May-2024 16:04                8989
function.inotify-queue-len.php                     24-May-2024 16:04                3869
function.inotify-read.php                          24-May-2024 16:04                4467
function.inotify-rm-watch.php                      24-May-2024 16:04                3736
function.intdiv.php                                24-May-2024 16:04                7615
function.interface-exists.php                      24-May-2024 16:04                5450
function.intl-error-name.php                       24-May-2024 16:04                5079
function.intl-get-error-code.php                   24-May-2024 16:04                4567
function.intl-get-error-message.php                24-May-2024 16:04                4578
function.intl-is-failure.php                       24-May-2024 16:04                5541
function.intval.php                                24-May-2024 16:04               12552
function.ip2long.php                               24-May-2024 16:04                5880
function.iptcembed.php                             24-May-2024 16:04               11804
function.iptcparse.php                             24-May-2024 16:04                4677
function.is-a.php                                  24-May-2024 16:04                8071
function.is-array.php                              24-May-2024 16:04                5614
function.is-bool.php                               24-May-2024 16:04                5664
function.is-callable.php                           24-May-2024 16:04                8439
function.is-countable.php                          24-May-2024 16:04                6406
function.is-dir.php                                24-May-2024 16:04                6767
function.is-double.php                             24-May-2024 16:04                1717
function.is-executable.php                         24-May-2024 16:04                4494
function.is-file.php                               24-May-2024 16:04                3092
function.is-finite.php                             24-May-2024 16:04                2423
function.is-float.php                              24-May-2024 16:04                6939
function.is-infinite.php                           24-May-2024 16:04                2522
function.is-int.php                                24-May-2024 16:04                6726
function.is-integer.php                            24-May-2024 16:04                1710
function.is-iterable.php                           24-May-2024 16:04                5868
function.is-link.php                               24-May-2024 16:04                3083
function.is-long.php                               24-May-2024 16:04                1691
function.is-nan.php                                24-May-2024 16:04                2390
function.is-null.php                               24-May-2024 16:04                6188
function.is-numeric.php                            24-May-2024 16:04                8446
function.is-object.php                             24-May-2024 16:04                7091
function.is-readable.php                           24-May-2024 16:04                3432
function.is-real.php                               24-May-2024 16:04                1703
function.is-resource.php                           24-May-2024 16:04                4642
function.is-scalar.php                             24-May-2024 16:04                8484
function.is-soap-fault.php                         24-May-2024 16:04                8178
function.is-string.php                             24-May-2024 16:04                6791
function.is-subclass-of.php                        24-May-2024 16:04               13709
function.is-tainted.php                            24-May-2024 16:04                2428
function.is-uploaded-file.php                      24-May-2024 16:04                7193
function.is-writable.php                           24-May-2024 16:04                3602
function.is-writeable.php                          24-May-2024 16:04                1759
function.isset.php                                 24-May-2024 16:04               17258
function.iterator-apply.php                        24-May-2024 16:04                6820
function.iterator-count.php                        24-May-2024 16:04                8775
function.iterator-to-array.php                     24-May-2024 16:04                8028
function.jddayofweek.php                           24-May-2024 16:04                3036
function.jdmonthname.php                           24-May-2024 16:04                3767
function.jdtofrench.php                            24-May-2024 16:04                2086
function.jdtogregorian.php                         24-May-2024 16:04                2096
function.jdtojewish.php                            24-May-2024 16:04                4534
function.jdtojulian.php                            24-May-2024 16:04                2102
function.jdtounix.php                              24-May-2024 16:04                2567
function.jewishtojd.php                            24-May-2024 16:04                2634
function.join.php                                  24-May-2024 16:04                1693
function.jpeg2wbmp.php                             24-May-2024 16:04                6739
function.json-decode.php                           24-May-2024 16:04               20339
function.json-encode.php                           24-May-2024 16:04               31142
function.json-last-error-msg.php                   24-May-2024 16:04                3120
function.json-last-error.php                       24-May-2024 16:04               14056
function.json-validate.php                         24-May-2024 16:04                8692
function.juliantojd.php                            24-May-2024 16:04                3176
function.key-exists.php                            24-May-2024 16:04                1744
function.key.php                                   24-May-2024 16:04                6226
function.krsort.php                                24-May-2024 16:04                5703
function.ksort.php                                 24-May-2024 16:04                5937
function.lcfirst.php                               24-May-2024 16:04                5946
function.lcg-value.php                             24-May-2024 16:04                4533
function.lchgrp.php                                24-May-2024 16:04                6031
function.lchown.php                                24-May-2024 16:04                5887
function.ldap-8859-to-t61.php                      24-May-2024 16:04                3426
function.ldap-add-ext.php                          24-May-2024 16:04                5875
function.ldap-add.php                              24-May-2024 16:04               10526
function.ldap-bind-ext.php                         24-May-2024 16:04                6133
function.ldap-bind.php                             24-May-2024 16:04                9673
function.ldap-close.php                            24-May-2024 16:04                1729
function.ldap-compare.php                          24-May-2024 16:04               10391
function.ldap-connect-wallet.php                   24-May-2024 16:04                4555
function.ldap-connect.php                          24-May-2024 16:04                9848
function.ldap-control-paged-result-response.php    24-May-2024 16:04                5959
function.ldap-control-paged-result.php             24-May-2024 16:04               14553
function.ldap-count-entries.php                    24-May-2024 16:04                5802
function.ldap-count-references.php                 24-May-2024 16:04                4825
function.ldap-delete-ext.php                       24-May-2024 16:04                5381
function.ldap-delete.php                           24-May-2024 16:04                5412
function.ldap-dn2ufn.php                           24-May-2024 16:04                2807
function.ldap-err2str.php                          24-May-2024 16:04                4687
function.ldap-errno.php                            24-May-2024 16:04                7600
function.ldap-error.php                            24-May-2024 16:04                4591
function.ldap-escape.php                           24-May-2024 16:04                6396
function.ldap-exop-passwd.php                      24-May-2024 16:04               10611
function.ldap-exop-refresh.php                     24-May-2024 16:04                5237
function.ldap-exop-sync.php                        24-May-2024 16:04                5691
function.ldap-exop-whoami.php                      24-May-2024 16:04                4011
function.ldap-exop.php                             24-May-2024 16:04               12563
function.ldap-explode-dn.php                       24-May-2024 16:04                3713
function.ldap-first-attribute.php                  24-May-2024 16:04                5533
function.ldap-first-entry.php                      24-May-2024 16:04                5884
function.ldap-first-reference.php                  24-May-2024 16:04                2409
function.ldap-free-result.php                      24-May-2024 16:04                4194
function.ldap-get-attributes.php                   24-May-2024 16:04                8298
function.ldap-get-dn.php                           24-May-2024 16:04                4388
function.ldap-get-entries.php                      24-May-2024 16:04                6211
function.ldap-get-option.php                       24-May-2024 16:04               16790
function.ldap-get-values-len.php                   24-May-2024 16:04                5592
function.ldap-get-values.php                       24-May-2024 16:04                8702
function.ldap-list.php                             24-May-2024 16:04               15530
function.ldap-mod-add.php                          24-May-2024 16:04                6935
function.ldap-mod-del.php                          24-May-2024 16:04                6460
function.ldap-mod-replace.php                      24-May-2024 16:04                6880
function.ldap-mod_add-ext.php                      24-May-2024 16:04                5850
function.ldap-mod_del-ext.php                      24-May-2024 16:04                5866
function.ldap-mod_replace-ext.php                  24-May-2024 16:04                5928
function.ldap-modify-batch.php                     24-May-2024 16:04               19060
function.ldap-modify.php                           24-May-2024 16:04                2136
function.ldap-next-attribute.php                   24-May-2024 16:04                5312
function.ldap-next-entry.php                       24-May-2024 16:04                5893
function.ldap-next-reference.php                   24-May-2024 16:04                2336
function.ldap-parse-exop.php                       24-May-2024 16:04                6075
function.ldap-parse-reference.php                  24-May-2024 16:04                2478
function.ldap-parse-result.php                     24-May-2024 16:04               10012
function.ldap-read.php                             24-May-2024 16:04               12849
function.ldap-rename-ext.php                       24-May-2024 16:04                6200
function.ldap-rename.php                           24-May-2024 16:04                7303
function.ldap-sasl-bind.php                        24-May-2024 16:04                7265
function.ldap-search.php                           24-May-2024 16:04               15731
function.ldap-set-option.php                       24-May-2024 16:04               19375
function.ldap-set-rebind-proc.php                  24-May-2024 16:04                3309
function.ldap-sort.php                             24-May-2024 16:04                7282
function.ldap-start-tls.php                        24-May-2024 16:04                2092
function.ldap-t61-to-8859.php                      24-May-2024 16:04                2244
function.ldap-unbind.php                           24-May-2024 16:04                3939
function.levenshtein.php                           24-May-2024 16:04               10198
function.libxml-clear-errors.php                   24-May-2024 16:04                2715
function.libxml-disable-entity-loader.php          24-May-2024 16:04                5001
function.libxml-get-errors.php                     24-May-2024 16:04               10760
function.libxml-get-external-entity-loader.php     24-May-2024 16:04                3538
function.libxml-get-last-error.php                 24-May-2024 16:04                3280
function.libxml-set-external-entity-loader.php     24-May-2024 16:04               10598
function.libxml-set-streams-context.php            24-May-2024 16:04                5119
function.libxml-use-internal-errors.php            24-May-2024 16:04                6747
function.link.php                                  24-May-2024 16:04                3209
function.linkinfo.php                              24-May-2024 16:04                3683
function.list.php                                  24-May-2024 16:04               18172
function.localeconv.php                            24-May-2024 16:04               14840
function.localtime.php                             24-May-2024 16:04                4378
function.log.php                                   24-May-2024 16:04                3066
function.log10.php                                 24-May-2024 16:04                2063
function.log1p.php                                 24-May-2024 16:04                2709
function.long2ip.php                               24-May-2024 16:04                2411
function.lstat.php                                 24-May-2024 16:04                3277
function.ltrim.php                                 24-May-2024 16:04                9670
function.lzf-compress.php                          24-May-2024 16:03                3017
function.lzf-decompress.php                        24-May-2024 16:03                3107
function.lzf-optimized-for.php                     24-May-2024 16:03                2296
function.mail.php                                  24-May-2024 16:04               27106
function.mailparse-determine-best-xfer-encoding..> 24-May-2024 16:04                4336
function.mailparse-msg-create.php                  24-May-2024 16:04                3436
function.mailparse-msg-extract-part-file.php       24-May-2024 16:04                5404
function.mailparse-msg-extract-part.php            24-May-2024 16:04                4192
function.mailparse-msg-extract-whole-part-file.php 24-May-2024 16:04                4209
function.mailparse-msg-free.php                    24-May-2024 16:04                3708
function.mailparse-msg-get-part-data.php           24-May-2024 16:04                2644
function.mailparse-msg-get-part.php                24-May-2024 16:04                2927
function.mailparse-msg-get-structure.php           24-May-2024 16:04                2664
function.mailparse-msg-parse-file.php              24-May-2024 16:04                4303
function.mailparse-msg-parse.php                   24-May-2024 16:04                3622
function.mailparse-rfc822-parse-addresses.php      24-May-2024 16:04                5730
function.mailparse-stream-encode.php               24-May-2024 16:04                5992
function.mailparse-uudecode-all.php                24-May-2024 16:04                6976
function.max.php                                   24-May-2024 16:04                7780
function.mb-check-encoding.php                     24-May-2024 16:04                5617
function.mb-chr.php                                24-May-2024 16:04                7011
function.mb-convert-case.php                       24-May-2024 16:04               11961
function.mb-convert-encoding.php                   24-May-2024 16:04               11953
function.mb-convert-kana.php                       24-May-2024 16:04               10167
function.mb-convert-variables.php                  24-May-2024 16:04                6748
function.mb-decode-mimeheader.php                  24-May-2024 16:04                3349
function.mb-decode-numericentity.php               24-May-2024 16:04               33997
function.mb-detect-encoding.php                    24-May-2024 16:04               16540
function.mb-detect-order.php                       24-May-2024 16:04                9007
function.mb-encode-mimeheader.php                  24-May-2024 16:04               10028
function.mb-encode-numericentity.php               24-May-2024 16:04               12726
function.mb-encoding-aliases.php                   24-May-2024 16:04                6467
function.mb-ereg-match.php                         24-May-2024 16:04                5706
function.mb-ereg-replace-callback.php              24-May-2024 16:04               12593
function.mb-ereg-replace.php                       24-May-2024 16:04                7368
function.mb-ereg-search-getpos.php                 24-May-2024 16:04                3958
function.mb-ereg-search-getregs.php                24-May-2024 16:04                4437
function.mb-ereg-search-init.php                   24-May-2024 16:04                6251
function.mb-ereg-search-pos.php                    24-May-2024 16:04                6103
function.mb-ereg-search-regs.php                   24-May-2024 16:04                5855
function.mb-ereg-search-setpos.php                 24-May-2024 16:04                4651
function.mb-ereg-search.php                        24-May-2024 16:04                5796
function.mb-ereg.php                               24-May-2024 16:04                6580
function.mb-eregi-replace.php                      24-May-2024 16:04                7252
function.mb-eregi.php                              24-May-2024 16:04                6624
function.mb-get-info.php                           24-May-2024 16:04                6384
function.mb-http-input.php                         24-May-2024 16:04                5102
function.mb-http-output.php                        24-May-2024 16:04                5047
function.mb-internal-encoding.php                  24-May-2024 16:04                7099
function.mb-language.php                           24-May-2024 16:04                6666
function.mb-list-encodings.php                     24-May-2024 16:04                5142
function.mb-ord.php                                24-May-2024 16:04                6819
function.mb-output-handler.php                     24-May-2024 16:04                5300
function.mb-parse-str.php                          24-May-2024 16:04                4765
function.mb-preferred-mime-name.php                24-May-2024 16:04                4606
function.mb-regex-encoding.php                     24-May-2024 16:04                4593
function.mb-regex-set-options.php                  24-May-2024 16:04                8722
function.mb-scrub.php                              24-May-2024 16:04                4197
function.mb-send-mail.php                          24-May-2024 16:04               10045
function.mb-split.php                              24-May-2024 16:04                4892
function.mb-str-pad.php                            24-May-2024 16:04                8572
function.mb-str-split.php                          24-May-2024 16:04                5395
function.mb-strcut.php                             24-May-2024 16:04                7582
function.mb-strimwidth.php                         24-May-2024 16:04                8038
function.mb-stripos.php                            24-May-2024 16:04                6556
function.mb-stristr.php                            24-May-2024 16:04                6872
function.mb-strlen.php                             24-May-2024 16:04                5180
function.mb-strpos.php                             24-May-2024 16:04                6559
function.mb-strrchr.php                            24-May-2024 16:04                6690
function.mb-strrichr.php                           24-May-2024 16:04                6740
function.mb-strripos.php                           24-May-2024 16:04                6472
function.mb-strrpos.php                            24-May-2024 16:04                6895
function.mb-strstr.php                             24-May-2024 16:04                6677
function.mb-strtolower.php                         24-May-2024 16:04                7166
function.mb-strtoupper.php                         24-May-2024 16:04                7248
function.mb-strwidth.php                           24-May-2024 16:04                9165
function.mb-substitute-character.php               24-May-2024 16:04                7414
function.mb-substr-count.php                       24-May-2024 16:04                6139
function.mb-substr.php                             24-May-2024 16:04                6608
function.mcrypt-create-iv.php                      24-May-2024 16:03                6994
function.mcrypt-decrypt.php                        24-May-2024 16:03                5991
function.mcrypt-enc-get-algorithms-name.php        24-May-2024 16:03                5397
function.mcrypt-enc-get-block-size.php             24-May-2024 16:03                3071
function.mcrypt-enc-get-iv-size.php                24-May-2024 16:03                3196
function.mcrypt-enc-get-key-size.php               24-May-2024 16:03                3075
function.mcrypt-enc-get-modes-name.php             24-May-2024 16:03                5299
function.mcrypt-enc-get-supported-key-sizes.php    24-May-2024 16:03                5081
function.mcrypt-enc-is-block-algorithm-mode.php    24-May-2024 16:03                3645
function.mcrypt-enc-is-block-algorithm.php         24-May-2024 16:03                3366
function.mcrypt-enc-is-block-mode.php              24-May-2024 16:03                3473
function.mcrypt-enc-self-test.php                  24-May-2024 16:03                3157
function.mcrypt-encrypt.php                        24-May-2024 16:03               13961
function.mcrypt-generic-deinit.php                 24-May-2024 16:03                4111
function.mcrypt-generic-init.php                   24-May-2024 16:03                5301
function.mcrypt-generic.php                        24-May-2024 16:03                5939
function.mcrypt-get-block-size.php                 24-May-2024 16:03                6758
function.mcrypt-get-cipher-name.php                24-May-2024 16:03                5136
function.mcrypt-get-iv-size.php                    24-May-2024 16:03                6569
function.mcrypt-get-key-size.php                   24-May-2024 16:03                6922
function.mcrypt-list-algorithms.php                24-May-2024 16:03                4856
function.mcrypt-list-modes.php                     24-May-2024 16:03                4714
function.mcrypt-module-close.php                   24-May-2024 16:03                3547
function.mcrypt-module-get-algo-block-size.php     24-May-2024 16:03                3587
function.mcrypt-module-get-algo-key-size.php       24-May-2024 16:03                3654
function.mcrypt-module-get-supported-key-sizes.php 24-May-2024 16:03                4727
function.mcrypt-module-is-block-algorithm-mode.php 24-May-2024 16:03                4580
function.mcrypt-module-is-block-algorithm.php      24-May-2024 16:03                4121
function.mcrypt-module-is-block-mode.php           24-May-2024 16:03                4613
function.mcrypt-module-open.php                    24-May-2024 16:03               14164
function.mcrypt-module-self-test.php               24-May-2024 16:03                5155
function.md5-file.php                              24-May-2024 16:04                5229
function.md5.php                                   24-May-2024 16:04                6075
function.mdecrypt-generic.php                      24-May-2024 16:03               10925
function.memcache-debug.php                        24-May-2024 16:04                3793
function.memory-get-peak-usage.php                 24-May-2024 16:03                3770
function.memory-get-usage.php                      24-May-2024 16:03                4092
function.memory-reset-peak-usage.php               24-May-2024 16:03                5050
function.metaphone.php                             24-May-2024 16:04                2931
function.method-exists.php                         24-May-2024 16:04                6586
function.mhash-count.php                           24-May-2024 16:03                4691
function.mhash-get-block-size.php                  24-May-2024 16:03                4631
function.mhash-get-hash-name.php                   24-May-2024 16:03                4586
function.mhash-keygen-s2k.php                      24-May-2024 16:03                5760
function.mhash.php                                 24-May-2024 16:03                4910
function.microtime.php                             24-May-2024 16:04               10113
function.mime-content-type.php                     24-May-2024 16:04                5187
function.min.php                                   24-May-2024 16:04                7775
function.mkdir.php                                 24-May-2024 16:04                8221
function.mktime.php                                24-May-2024 16:04                6847
function.money-format.php                          24-May-2024 16:04               16133
function.mongodb.bson-fromjson.php                 24-May-2024 16:03                5927
function.mongodb.bson-fromphp.php                  24-May-2024 16:03                6267
function.mongodb.bson-tocanonicalextendedjson.php  24-May-2024 16:03               13966
function.mongodb.bson-tojson.php                   24-May-2024 16:03               15039
function.mongodb.bson-tophp.php                    24-May-2024 16:03                9158
function.mongodb.bson-torelaxedextendedjson.php    24-May-2024 16:03               13663
function.mongodb.driver.monitoring.addsubscribe..> 24-May-2024 16:03                5126
function.mongodb.driver.monitoring.removesubscr..> 24-May-2024 16:03                4984
function.move-uploaded-file.php                    24-May-2024 16:04                8805
function.mqseries-back.php                         24-May-2024 16:04                6521
function.mqseries-begin.php                        24-May-2024 16:04                7484
function.mqseries-close.php                        24-May-2024 16:04                6706
function.mqseries-cmit.php                         24-May-2024 16:04                6449
function.mqseries-conn.php                         24-May-2024 16:04                6031
function.mqseries-connx.php                        24-May-2024 16:04               12733
function.mqseries-disc.php                         24-May-2024 16:04                5733
function.mqseries-get.php                          24-May-2024 16:04               12351
function.mqseries-inq.php                          24-May-2024 16:04                9409
function.mqseries-open.php                         24-May-2024 16:04                7342
function.mqseries-put.php                          24-May-2024 16:04               12630
function.mqseries-put1.php                         24-May-2024 16:04                6377
function.mqseries-set.php                          24-May-2024 16:04                6303
function.mqseries-strerror.php                     24-May-2024 16:04                4312
function.msg-get-queue.php                         24-May-2024 16:04                3534
function.msg-queue-exists.php                      24-May-2024 16:04                3483
function.msg-receive.php                           24-May-2024 16:04                9623
function.msg-remove-queue.php                      24-May-2024 16:04                2841
function.msg-send.php                              24-May-2024 16:04                5940
function.msg-set-queue.php                         24-May-2024 16:04                3439
function.msg-stat-queue.php                        24-May-2024 16:04                5048
function.mt-getrandmax.php                         24-May-2024 16:04                3339
function.mt-rand.php                               24-May-2024 16:04                9767
function.mt-srand.php                              24-May-2024 16:04                8560
function.mysql-affected-rows.php                   24-May-2024 16:04               12240
function.mysql-client-encoding.php                 24-May-2024 16:04                6402
function.mysql-close.php                           24-May-2024 16:04                7592
function.mysql-connect.php                         24-May-2024 16:04               17294
function.mysql-create-db.php                       24-May-2024 16:04                8548
function.mysql-data-seek.php                       24-May-2024 16:04               12065
function.mysql-db-name.php                         24-May-2024 16:04                7915
function.mysql-db-query.php                        24-May-2024 16:04               10005
function.mysql-drop-db.php                         24-May-2024 16:04                7838
function.mysql-errno.php                           24-May-2024 16:04                8373
function.mysql-error.php                           24-May-2024 16:04                8358
function.mysql-escape-string.php                   24-May-2024 16:04                6552
function.mysql-fetch-array.php                     24-May-2024 16:04               15780
function.mysql-fetch-assoc.php                     24-May-2024 16:04               11546
function.mysql-fetch-field.php                     24-May-2024 16:04               13114
function.mysql-fetch-lengths.php                   24-May-2024 16:04                7810
function.mysql-fetch-object.php                    24-May-2024 16:04               12002
function.mysql-fetch-row.php                       24-May-2024 16:04                7859
function.mysql-field-flags.php                     24-May-2024 16:04                8779
function.mysql-field-len.php                       24-May-2024 16:04                7214
function.mysql-field-name.php                      24-May-2024 16:04                9275
function.mysql-field-seek.php                      24-May-2024 16:04                5284
function.mysql-field-table.php                     24-May-2024 16:04                7822
function.mysql-field-type.php                      24-May-2024 16:04               11852
function.mysql-free-result.php                     24-May-2024 16:04                7949
function.mysql-get-client-info.php                 24-May-2024 16:04                5261
function.mysql-get-host-info.php                   24-May-2024 16:04                7207
function.mysql-get-proto-info.php                  24-May-2024 16:04                6753
function.mysql-get-server-info.php                 24-May-2024 16:04                7239
function.mysql-info.php                            24-May-2024 16:04                6504
function.mysql-insert-id.php                       24-May-2024 16:04                8444
function.mysql-list-dbs.php                        24-May-2024 16:04                8836
function.mysql-list-fields.php                     24-May-2024 16:04                8970
function.mysql-list-processes.php                  24-May-2024 16:04                7796
function.mysql-list-tables.php                     24-May-2024 16:04                9649
function.mysql-num-fields.php                      24-May-2024 16:04                6791
function.mysql-num-rows.php                        24-May-2024 16:04                8208
function.mysql-pconnect.php                        24-May-2024 16:04                8511
function.mysql-ping.php                            24-May-2024 16:04                8070
function.mysql-query.php                           24-May-2024 16:04               13972
function.mysql-real-escape-string.php              24-May-2024 16:04               15502
function.mysql-result.php                          24-May-2024 16:04                9727
function.mysql-select-db.php                       24-May-2024 16:04                7912
function.mysql-set-charset.php                     24-May-2024 16:04                6077
function.mysql-stat.php                            24-May-2024 16:04                9498
function.mysql-tablename.php                       24-May-2024 16:04                8243
function.mysql-thread-id.php                       24-May-2024 16:04                6805
function.mysql-unbuffered-query.php                24-May-2024 16:04                7331
function.mysql-xdevapi-expression.php              24-May-2024 16:03                4884
function.mysql-xdevapi-getsession.php              24-May-2024 16:03               13131
function.mysqli-connect.php                        24-May-2024 16:03                2372
function.mysqli-escape-string.php                  24-May-2024 16:03                1972
function.mysqli-execute.php                        24-May-2024 16:03                2526
function.mysqli-get-client-stats.php               24-May-2024 16:03                8454
function.mysqli-get-links-stats.php                24-May-2024 16:03                3441
function.mysqli-report.php                         24-May-2024 16:03                1774
function.mysqli-set-opt.php                        24-May-2024 16:03                1875
function.natcasesort.php                           24-May-2024 16:04                5775
function.natsort.php                               24-May-2024 16:04                5264
function.net-get-interfaces.php                    24-May-2024 16:04                4806
function.next.php                                  24-May-2024 16:04                6211
function.ngettext.php                              24-May-2024 16:04                5813
function.nl-langinfo.php                           24-May-2024 16:04               11184
function.nl2br.php                                 24-May-2024 16:04                3910
function.number-format.php                         24-May-2024 16:04                7272
function.oauth-get-sbs.php                         24-May-2024 16:04                3198
function.oauth-urlencode.php                       24-May-2024 16:04                2640
function.ob-clean.php                              24-May-2024 16:03                4646
function.ob-end-clean.php                          24-May-2024 16:03                5839
function.ob-end-flush.php                          24-May-2024 16:03                5700
function.ob-flush.php                              24-May-2024 16:03                4749
function.ob-get-clean.php                          24-May-2024 16:03                6906
function.ob-get-contents.php                       24-May-2024 16:03                4849
function.ob-get-flush.php                          24-May-2024 16:03                6692
function.ob-get-length.php                         24-May-2024 16:03                4786
function.ob-get-level.php                          24-May-2024 16:03                3684
function.ob-get-status.php                         24-May-2024 16:03               10123
function.ob-gzhandler.php                          24-May-2024 16:03                5958
function.ob-iconv-handler.php                      24-May-2024 16:04                5248
function.ob-implicit-flush.php                     24-May-2024 16:03                5301
function.ob-list-handlers.php                      24-May-2024 16:03               13934
function.ob-start.php                              24-May-2024 16:03               15495
function.ob-tidyhandler.php                        24-May-2024 16:04                4443
function.oci-bind-array-by-name.php                24-May-2024 16:04               13971
function.oci-bind-by-name.php                      24-May-2024 16:04               21345
function.oci-cancel.php                            24-May-2024 16:04                2787
function.oci-client-version.php                    24-May-2024 16:04                4063
function.oci-close.php                             24-May-2024 16:04               18628
function.oci-commit.php                            24-May-2024 16:04               11077
function.oci-connect.php                           24-May-2024 16:04               35331
function.oci-define-by-name.php                    24-May-2024 16:04               24054
function.oci-error.php                             24-May-2024 16:04               11965
function.oci-execute.php                           24-May-2024 16:04               21439
function.oci-fetch-all.php                         24-May-2024 16:04               24786
function.oci-fetch-array.php                       24-May-2024 16:04               64410
function.oci-fetch-assoc.php                       24-May-2024 16:04                8935
function.oci-fetch-object.php                      24-May-2024 16:04               18278
function.oci-fetch-row.php                         24-May-2024 16:04                8876
function.oci-fetch.php                             24-May-2024 16:04               13562
function.oci-field-is-null.php                     24-May-2024 16:04                7930
function.oci-field-name.php                        24-May-2024 16:04                9858
function.oci-field-precision.php                   24-May-2024 16:04                8716
function.oci-field-scale.php                       24-May-2024 16:04                8694
function.oci-field-size.php                        24-May-2024 16:04               10310
function.oci-field-type-raw.php                    24-May-2024 16:04                7970
function.oci-field-type.php                        24-May-2024 16:04               10712
function.oci-free-descriptor.php                   24-May-2024 16:04                3594
function.oci-free-statement.php                    24-May-2024 16:04                3045
function.oci-get-implicit-resultset.php            24-May-2024 16:04               28227
function.oci-internal-debug.php                    24-May-2024 16:04                3142
function.oci-lob-copy.php                          24-May-2024 16:04                4664
function.oci-lob-is-equal.php                      24-May-2024 16:04                3335
function.oci-new-collection.php                    24-May-2024 16:04                5171
function.oci-new-connect.php                       24-May-2024 16:04               16548
function.oci-new-cursor.php                        24-May-2024 16:04                7803
function.oci-new-descriptor.php                    24-May-2024 16:04               18283
function.oci-num-fields.php                        24-May-2024 16:04                6967
function.oci-num-rows.php                          24-May-2024 16:04                7982
function.oci-parse.php                             24-May-2024 16:04               12609
function.oci-password-change.php                   24-May-2024 16:04               13589
function.oci-pconnect.php                          24-May-2024 16:04               14949
function.oci-register-taf-callback.php             24-May-2024 16:04                5856
function.oci-result.php                            24-May-2024 16:04                8662
function.oci-rollback.php                          24-May-2024 16:04               14378
function.oci-server-version.php                    24-May-2024 16:04                4813
function.oci-set-action.php                        24-May-2024 16:04                8568
function.oci-set-call-timout.php                   24-May-2024 16:04                6032
function.oci-set-client-identifier.php             24-May-2024 16:04                8227
function.oci-set-client-info.php                   24-May-2024 16:04                8490
function.oci-set-db-operation.php                  24-May-2024 16:04                7898
function.oci-set-edition.php                       24-May-2024 16:04                9804
function.oci-set-module-name.php                   24-May-2024 16:04                8684
function.oci-set-prefetch-lob.php                  24-May-2024 16:04                8933
function.oci-set-prefetch.php                      24-May-2024 16:04               20768
function.oci-statement-type.php                    24-May-2024 16:04                7104
function.oci-unregister-taf-callback.php           24-May-2024 16:04                3707
function.ocibindbyname.php                         24-May-2024 16:04                2022
function.ocicancel.php                             24-May-2024 16:04                1963
function.ocicloselob.php                           24-May-2024 16:04                1963
function.ocicollappend.php                         24-May-2024 16:04                2027
function.ocicollassign.php                         24-May-2024 16:04                2032
function.ocicollassignelem.php                     24-May-2024 16:04                2077
function.ocicollgetelem.php                        24-May-2024 16:04                2044
function.ocicollmax.php                            24-May-2024 16:04                1996
function.ocicollsize.php                           24-May-2024 16:04                1999
function.ocicolltrim.php                           24-May-2024 16:04                2009
function.ocicolumnisnull.php                       24-May-2024 16:04                2033
function.ocicolumnname.php                         24-May-2024 16:04                2025
function.ocicolumnprecision.php                    24-May-2024 16:04                2068
function.ocicolumnscale.php                        24-May-2024 16:04                2032
function.ocicolumnsize.php                         24-May-2024 16:04                2013
function.ocicolumntype.php                         24-May-2024 16:04                2017
function.ocicolumntyperaw.php                      24-May-2024 16:04                2040
function.ocicommit.php                             24-May-2024 16:04                1977
function.ocidefinebyname.php                       24-May-2024 16:04                2023
function.ocierror.php                              24-May-2024 16:04                1954
function.ociexecute.php                            24-May-2024 16:04                1958
function.ocifetch.php                              24-May-2024 16:04                1948
function.ocifetchinto.php                          24-May-2024 16:04                2695
function.ocifetchstatement.php                     24-May-2024 16:04                2041
function.ocifreecollection.php                     24-May-2024 16:04                2059
function.ocifreecursor.php                         24-May-2024 16:04                2031
function.ocifreedesc.php                           24-May-2024 16:04                1975
function.ocifreestatement.php                      24-May-2024 16:04                2050
function.ociinternaldebug.php                      24-May-2024 16:04                2064
function.ociloadlob.php                            24-May-2024 16:04                1960
function.ocilogoff.php                             24-May-2024 16:04                1947
function.ocilogon.php                              24-May-2024 16:04                1962
function.ocinewcollection.php                      24-May-2024 16:04                2048
function.ocinewcursor.php                          24-May-2024 16:04                2016
function.ocinewdescriptor.php                      24-May-2024 16:04                2038
function.ocinlogon.php                             24-May-2024 16:04                1987
function.ocinumcols.php                            24-May-2024 16:04                1972
function.ociparse.php                              24-May-2024 16:04                1942
function.ociplogon.php                             24-May-2024 16:04                1957
function.ociresult.php                             24-May-2024 16:04                1955
function.ocirollback.php                           24-May-2024 16:04                1977
function.ocirowcount.php                           24-May-2024 16:04                1979
function.ocisavelob.php                            24-May-2024 16:04                1960
function.ocisavelobfile.php                        24-May-2024 16:04                1998
function.ociserverversion.php                      24-May-2024 16:04                2052
function.ocisetprefetch.php                        24-May-2024 16:04                2038
function.ocistatementtype.php                      24-May-2024 16:04                2058
function.ociwritelobtofile.php                     24-May-2024 16:04                2039
function.ociwritetemporarylob.php                  24-May-2024 16:04                2063
function.octdec.php                                24-May-2024 16:04                3773
function.odbc-autocommit.php                       24-May-2024 16:03                4770
function.odbc-binmode.php                          24-May-2024 16:03                5462
function.odbc-close-all.php                        24-May-2024 16:03                2215
function.odbc-close.php                            24-May-2024 16:03                2417
function.odbc-columnprivileges.php                 24-May-2024 16:03                4271
function.odbc-columns.php                          24-May-2024 16:03                4935
function.odbc-commit.php                           24-May-2024 16:03                2396
function.odbc-connect.php                          24-May-2024 16:03                4721
function.odbc-connection-string-is-quoted.php      24-May-2024 16:03                3752
function.odbc-connection-string-quote.php          24-May-2024 16:03                5807
function.odbc-connection-string-should-quote.php   24-May-2024 16:03                4016
function.odbc-cursor.php                           24-May-2024 16:03                2089
function.odbc-data-source.php                      24-May-2024 16:03                2879
function.odbc-do.php                               24-May-2024 16:03                2280
function.odbc-error.php                            24-May-2024 16:03                3776
function.odbc-errormsg.php                         24-May-2024 16:03                3822
function.odbc-exec.php                             24-May-2024 16:03                3399
function.odbc-execute.php                          24-May-2024 16:03                7310
function.odbc-fetch-array.php                      24-May-2024 16:03                4344
function.odbc-fetch-into.php                       24-May-2024 16:03                9211
function.odbc-fetch-object.php                     24-May-2024 16:03                4295
function.odbc-fetch-row.php                        24-May-2024 16:03                4181
function.odbc-field-len.php                        24-May-2024 16:03                2697
function.odbc-field-name.php                       24-May-2024 16:03                2530
function.odbc-field-num.php                        24-May-2024 16:03                2568
function.odbc-field-precision.php                  24-May-2024 16:03                2776
function.odbc-field-scale.php                      24-May-2024 16:03                2442
function.odbc-field-type.php                       24-May-2024 16:03                2453
function.odbc-foreignkeys.php                      24-May-2024 16:03                6117
function.odbc-free-result.php                      24-May-2024 16:03                3268
function.odbc-gettypeinfo.php                      24-May-2024 16:03                4094
function.odbc-longreadlen.php                      24-May-2024 16:03                2734
function.odbc-next-result.php                      24-May-2024 16:03                2273
function.odbc-num-fields.php                       24-May-2024 16:03                2468
function.odbc-num-rows.php                         24-May-2024 16:03                2657
function.odbc-pconnect.php                         24-May-2024 16:03                4070
function.odbc-prepare.php                          24-May-2024 16:03                6570
function.odbc-primarykeys.php                      24-May-2024 16:03                3632
function.odbc-procedurecolumns.php                 24-May-2024 16:03                4853
function.odbc-procedures.php                       24-May-2024 16:03                4036
function.odbc-result-all.php                       24-May-2024 16:03                2873
function.odbc-result.php                           24-May-2024 16:03                4414
function.odbc-rollback.php                         24-May-2024 16:03                2311
function.odbc-setoption.php                        24-May-2024 16:03                7487
function.odbc-specialcolumns.php                   24-May-2024 16:03                6579
function.odbc-statistics.php                       24-May-2024 16:03                5749
function.odbc-tableprivileges.php                  24-May-2024 16:03                4979
function.odbc-tables.php                           24-May-2024 16:03                7968
function.opcache-compile-file.php                  24-May-2024 16:03                3920
function.opcache-get-configuration.php             24-May-2024 16:03                3347
function.opcache-get-status.php                    24-May-2024 16:03                3897
function.opcache-invalidate.php                    24-May-2024 16:03                4439
function.opcache-is-script-cached.php              24-May-2024 16:03                3493
function.opcache-reset.php                         24-May-2024 16:03                3438
function.openal-buffer-create.php                  24-May-2024 16:03                2928
function.openal-buffer-data.php                    24-May-2024 16:03                5065
function.openal-buffer-destroy.php                 24-May-2024 16:03                3260
function.openal-buffer-get.php                     24-May-2024 16:03                4049
function.openal-buffer-loadwav.php                 24-May-2024 16:03                3801
function.openal-context-create.php                 24-May-2024 16:03                3445
function.openal-context-current.php                24-May-2024 16:03                3315
function.openal-context-destroy.php                24-May-2024 16:03                3301
function.openal-context-process.php                24-May-2024 16:03                3689
function.openal-context-suspend.php                24-May-2024 16:03                3683
function.openal-device-close.php                   24-May-2024 16:03                3267
function.openal-device-open.php                    24-May-2024 16:03                3438
function.openal-listener-get.php                   24-May-2024 16:03                3485
function.openal-listener-set.php                   24-May-2024 16:03                3896
function.openal-source-create.php                  24-May-2024 16:03                3122
function.openal-source-destroy.php                 24-May-2024 16:03                3268
function.openal-source-get.php                     24-May-2024 16:03                5676
function.openal-source-pause.php                   24-May-2024 16:03                3569
function.openal-source-play.php                    24-May-2024 16:03                3568
function.openal-source-rewind.php                  24-May-2024 16:03                3578
function.openal-source-set.php                     24-May-2024 16:03                6427
function.openal-source-stop.php                    24-May-2024 16:03                3550
function.openal-stream.php                         24-May-2024 16:03                4511
function.opendir.php                               24-May-2024 16:04                8436
function.openlog.php                               24-May-2024 16:04                6989
function.openssl-cipher-iv-length.php              24-May-2024 16:03                4571
function.openssl-cipher-key-length.php             24-May-2024 16:03                4493
function.openssl-cms-decrypt.php                   24-May-2024 16:03                5787
function.openssl-cms-encrypt.php                   24-May-2024 16:03                6777
function.openssl-cms-read.php                      24-May-2024 16:03                3360
function.openssl-cms-sign.php                      24-May-2024 16:03                8434
function.openssl-cms-verify.php                    24-May-2024 16:03                7528
function.openssl-csr-export-to-file.php            24-May-2024 16:03                8668
function.openssl-csr-export.php                    24-May-2024 16:03                8595
function.openssl-csr-get-public-key.php            24-May-2024 16:03                8895
function.openssl-csr-get-subject.php               24-May-2024 16:03                9654
function.openssl-csr-new.php                       24-May-2024 16:03               22222
function.openssl-csr-sign.php                      24-May-2024 16:03               14120
function.openssl-decrypt.php                       24-May-2024 16:03                8177
function.openssl-dh-compute-key.php                24-May-2024 16:03               16566
function.openssl-digest.php                        24-May-2024 16:03                4709
function.openssl-encrypt.php                       24-May-2024 16:03               18475
function.openssl-error-string.php                  24-May-2024 16:03                3866
function.openssl-free-key.php                      24-May-2024 16:03                3832
function.openssl-get-cert-locations.php            24-May-2024 16:03                4125
function.openssl-get-cipher-methods.php            24-May-2024 16:03               14197
function.openssl-get-curve-names.php               24-May-2024 16:03                7245
function.openssl-get-md-methods.php                24-May-2024 16:03                7135
function.openssl-get-privatekey.php                24-May-2024 16:03                1933
function.openssl-get-publickey.php                 24-May-2024 16:03                1904
function.openssl-open.php                          24-May-2024 16:03               10498
function.openssl-pbkdf2.php                        24-May-2024 16:03                7697
function.openssl-pkcs12-export-to-file.php         24-May-2024 16:03                7789
function.openssl-pkcs12-export.php                 24-May-2024 16:03                7787
function.openssl-pkcs12-read.php                   24-May-2024 16:03                5810
function.openssl-pkcs7-decrypt.php                 24-May-2024 16:03                7976
function.openssl-pkcs7-encrypt.php                 24-May-2024 16:03               10884
function.openssl-pkcs7-read.php                    24-May-2024 16:03                7038
function.openssl-pkcs7-sign.php                    24-May-2024 16:03               12255
function.openssl-pkcs7-verify.php                  24-May-2024 16:03                8516
function.openssl-pkey-derive.php                   24-May-2024 16:03                8281
function.openssl-pkey-export-to-file.php           24-May-2024 16:03                6922
function.openssl-pkey-export.php                   24-May-2024 16:03                6785
function.openssl-pkey-free.php                     24-May-2024 16:03                4064
function.openssl-pkey-get-details.php              24-May-2024 16:03                9758
function.openssl-pkey-get-private.php              24-May-2024 16:03                6380
function.openssl-pkey-get-public.php               24-May-2024 16:03                5601
function.openssl-pkey-new.php                      24-May-2024 16:03                7135
function.openssl-private-decrypt.php               24-May-2024 16:03                7153
function.openssl-private-encrypt.php               24-May-2024 16:03                6846
function.openssl-public-decrypt.php                24-May-2024 16:03                6803
function.openssl-public-encrypt.php                24-May-2024 16:03                7140
function.openssl-random-pseudo-bytes.php           24-May-2024 16:03                9470
function.openssl-seal.php                          24-May-2024 16:03               11609
function.openssl-sign.php                          24-May-2024 16:03               12970
function.openssl-spki-export-challenge.php         24-May-2024 16:03                7661
function.openssl-spki-export.php                   24-May-2024 16:03                8470
function.openssl-spki-new.php                      24-May-2024 16:03                9375
function.openssl-spki-verify.php                   24-May-2024 16:03                7850
function.openssl-verify.php                        24-May-2024 16:03               13447
function.openssl-x509-check-private-key.php        24-May-2024 16:03                6043
function.openssl-x509-checkpurpose.php             24-May-2024 16:03                7565
function.openssl-x509-export-to-file.php           24-May-2024 16:03                5273
function.openssl-x509-export.php                   24-May-2024 16:03                5235
function.openssl-x509-fingerprint.php              24-May-2024 16:03                5501
function.openssl-x509-free.php                     24-May-2024 16:03                4089
function.openssl-x509-parse.php                    24-May-2024 16:03                4869
function.openssl-x509-read.php                     24-May-2024 16:03                4612
function.openssl-x509-verify.php                   24-May-2024 16:03               12574
function.ord.php                                   24-May-2024 16:04                3378
function.output-add-rewrite-var.php                24-May-2024 16:03                9545
function.output-reset-rewrite-vars.php             24-May-2024 16:03                6726
function.pack.php                                  24-May-2024 16:04               12697
function.parse-ini-file.php                        24-May-2024 16:04               18374
function.parse-ini-string.php                      24-May-2024 16:04                7631
function.parse-str.php                             24-May-2024 16:04                6570
function.parse-url.php                             24-May-2024 16:04               16919
function.passthru.php                              24-May-2024 16:04                5852
function.password-algos.php                        24-May-2024 16:03                3437
function.password-get-info.php                     24-May-2024 16:03                3583
function.password-hash.php                         24-May-2024 16:03               23153
function.password-needs-rehash.php                 24-May-2024 16:03                8451
function.password-verify.php                       24-May-2024 16:03                6912
function.pathinfo.php                              24-May-2024 16:04                5864
function.pclose.php                                24-May-2024 16:04                2534
function.pcntl-alarm.php                           24-May-2024 16:04                3017
function.pcntl-async-signals.php                   24-May-2024 16:04                4290
function.pcntl-errno.php                           24-May-2024 16:04                1796
function.pcntl-exec.php                            24-May-2024 16:04                3869
function.pcntl-fork.php                            24-May-2024 16:04                5070
function.pcntl-get-last-error.php                  24-May-2024 16:04                2837
function.pcntl-getpriority.php                     24-May-2024 16:04                5930
function.pcntl-rfork.php                           24-May-2024 16:04                7732
function.pcntl-setpriority.php                     24-May-2024 16:04                5798
function.pcntl-signal-dispatch.php                 24-May-2024 16:04                5733
function.pcntl-signal-get-handler.php              24-May-2024 16:04                6852
function.pcntl-signal.php                          24-May-2024 16:04               11371
function.pcntl-sigprocmask.php                     24-May-2024 16:04                6181
function.pcntl-sigtimedwait.php                    24-May-2024 16:04                5224
function.pcntl-sigwaitinfo.php                     24-May-2024 16:04                7581
function.pcntl-strerror.php                        24-May-2024 16:04                3038
function.pcntl-unshare.php                         24-May-2024 16:04                4685
function.pcntl-wait.php                            24-May-2024 16:04                8135
function.pcntl-waitpid.php                         24-May-2024 16:04                9582
function.pcntl-wexitstatus.php                     24-May-2024 16:04                3830
function.pcntl-wifexited.php                       24-May-2024 16:04                3552
function.pcntl-wifsignaled.php                     24-May-2024 16:04                3604
function.pcntl-wifstopped.php                      24-May-2024 16:04                3674
function.pcntl-wstopsig.php                        24-May-2024 16:04                3835
function.pcntl-wtermsig.php                        24-May-2024 16:04                4010
function.pfsockopen.php                            24-May-2024 16:04                3261
function.pg-affected-rows.php                      24-May-2024 16:04                4022
function.pg-cancel-query.php                       24-May-2024 16:04                2670
function.pg-client-encoding.php                    24-May-2024 16:04                3386
function.pg-close.php                              24-May-2024 16:04                2946
function.pg-connect-poll.php                       24-May-2024 16:04                4205
function.pg-connect.php                            24-May-2024 16:04                6637
function.pg-connection-busy.php                    24-May-2024 16:04                2759
function.pg-connection-reset.php                   24-May-2024 16:04                2820
function.pg-connection-status.php                  24-May-2024 16:04                2491
function.pg-consume-input.php                      24-May-2024 16:04                3745
function.pg-convert.php                            24-May-2024 16:04                3164
function.pg-copy-from.php                          24-May-2024 16:04                3534
function.pg-copy-to.php                            24-May-2024 16:04                3172
function.pg-dbname.php                             24-May-2024 16:04                2309
function.pg-delete.php                             24-May-2024 16:04                4922
function.pg-end-copy.php                           24-May-2024 16:04                2983
function.pg-escape-bytea.php                       24-May-2024 16:04                3571
function.pg-escape-identifier.php                  24-May-2024 16:04                7935
function.pg-escape-literal.php                     24-May-2024 16:04                8300
function.pg-escape-string.php                      24-May-2024 16:04                2743
function.pg-execute.php                            24-May-2024 16:04               10446
function.pg-fetch-all-columns.php                  24-May-2024 16:04                7156
function.pg-fetch-all.php                          24-May-2024 16:04                4965
function.pg-fetch-array.php                        24-May-2024 16:04                8321
function.pg-fetch-assoc.php                        24-May-2024 16:04                8702
function.pg-fetch-object.php                       24-May-2024 16:04               11615
function.pg-fetch-result.php                       24-May-2024 16:04                3952
function.pg-fetch-row.php                          24-May-2024 16:04                6139
function.pg-field-is-null.php                      24-May-2024 16:04                3211
function.pg-field-name.php                         24-May-2024 16:04                2806
function.pg-field-num.php                          24-May-2024 16:04                2874
function.pg-field-prtlen.php                       24-May-2024 16:04                3033
function.pg-field-size.php                         24-May-2024 16:04                3128
function.pg-field-table.php                        24-May-2024 16:04                8778
function.pg-field-type-oid.php                     24-May-2024 16:04                7579
function.pg-field-type.php                         24-May-2024 16:04                2974
function.pg-flush.php                              24-May-2024 16:04                3757
function.pg-free-result.php                        24-May-2024 16:04                3181
function.pg-get-notify.php                         24-May-2024 16:04                7010
function.pg-get-pid.php                            24-May-2024 16:04                4529
function.pg-get-result.php                         24-May-2024 16:04                2744
function.pg-host.php                               24-May-2024 16:04                2407
function.pg-insert.php                             24-May-2024 16:04                4878
function.pg-last-error.php                         24-May-2024 16:04                3333
function.pg-last-notice.php                        24-May-2024 16:04                4259
function.pg-last-oid.php                           24-May-2024 16:04                3619
function.pg-lo-close.php                           24-May-2024 16:04                2969
function.pg-lo-create.php                          24-May-2024 16:04                3232
function.pg-lo-export.php                          24-May-2024 16:04                3283
function.pg-lo-import.php                          24-May-2024 16:04                6776
function.pg-lo-open.php                            24-May-2024 16:04                3606
function.pg-lo-read-all.php                        24-May-2024 16:04                2950
function.pg-lo-read.php                            24-May-2024 16:04                3140
function.pg-lo-seek.php                            24-May-2024 16:04                2681
function.pg-lo-tell.php                            24-May-2024 16:04                2283
function.pg-lo-truncate.php                        24-May-2024 16:04                6737
function.pg-lo-unlink.php                          24-May-2024 16:04                3117
function.pg-lo-write.php                           24-May-2024 16:04                3245
function.pg-meta-data.php                          24-May-2024 16:04                2773
function.pg-num-fields.php                         24-May-2024 16:04                2820
function.pg-num-rows.php                           24-May-2024 16:04                3163
function.pg-options.php                            24-May-2024 16:04                2175
function.pg-parameter-status.php                   24-May-2024 16:04                8576
function.pg-pconnect.php                           24-May-2024 16:04                3752
function.pg-ping.php                               24-May-2024 16:04                5061
function.pg-port.php                               24-May-2024 16:04                2133
function.pg-prepare.php                            24-May-2024 16:04               10409
function.pg-put-line.php                           24-May-2024 16:04                5348
function.pg-query-params.php                       24-May-2024 16:04               10895
function.pg-query.php                              24-May-2024 16:04                5456
function.pg-result-error-field.php                 24-May-2024 16:04                9814
function.pg-result-error.php                       24-May-2024 16:04                3028
function.pg-result-seek.php                        24-May-2024 16:04                6705
function.pg-result-status.php                      24-May-2024 16:04                2509
function.pg-select.php                             24-May-2024 16:04                5197
function.pg-send-execute.php                       24-May-2024 16:04               10504
function.pg-send-prepare.php                       24-May-2024 16:04               10961
function.pg-send-query-params.php                  24-May-2024 16:04                8190
function.pg-send-query.php                         24-May-2024 16:04                4340
function.pg-set-client-encoding.php                24-May-2024 16:04                3582
function.pg-set-error-context-visibility.php       24-May-2024 16:04                7108
function.pg-set-error-verbosity.php                24-May-2024 16:04                9078
function.pg-socket.php                             24-May-2024 16:04                3910
function.pg-trace.php                              24-May-2024 16:04                4398
function.pg-transaction-status.php                 24-May-2024 16:04                6727
function.pg-tty.php                                24-May-2024 16:04                2205
function.pg-unescape-bytea.php                     24-May-2024 16:04                7146
function.pg-untrace.php                            24-May-2024 16:04                2588
function.pg-update.php                             24-May-2024 16:04                5548
function.pg-version.php                            24-May-2024 16:04                6642
function.php-ini-loaded-file.php                   24-May-2024 16:03                4675
function.php-ini-scanned-files.php                 24-May-2024 16:03                5281
function.php-sapi-name.php                         24-May-2024 16:03                3475
function.php-strip-whitespace.php                  24-May-2024 16:04                4739
function.php-uname.php                             24-May-2024 16:03                8020
function.phpcredits.php                            24-May-2024 16:03                8381
function.phpdbg-break-file.php                     24-May-2024 16:03                3793
function.phpdbg-break-function.php                 24-May-2024 16:03                3530
function.phpdbg-break-method.php                   24-May-2024 16:03                3864
function.phpdbg-break-next.php                     24-May-2024 16:03                3174
function.phpdbg-clear.php                          24-May-2024 16:03                3451
function.phpdbg-color.php                          24-May-2024 16:03                3730
function.phpdbg-end-oplog.php                      24-May-2024 16:03                2684
function.phpdbg-exec.php                           24-May-2024 16:03                3174
function.phpdbg-get-executable.php                 24-May-2024 16:03                2627
function.phpdbg-prompt.php                         24-May-2024 16:03                2873
function.phpdbg-start-oplog.php                    24-May-2024 16:03                2342
function.phpinfo.php                               24-May-2024 16:03                8167
function.phpversion.php                            24-May-2024 16:03                3433
function.pi.php                                    24-May-2024 16:04                3044
function.png2wbmp.php                              24-May-2024 16:04                6716
function.popen.php                                 24-May-2024 16:04                8559
function.pos.php                                   24-May-2024 16:04                1640
function.posix-access.php                          24-May-2024 16:04                6694
function.posix-ctermid.php                         24-May-2024 16:04                1997
function.posix-eaccess.php                         24-May-2024 16:04                7495
function.posix-errno.php                           24-May-2024 16:04                1802
function.posix-fpathconf.php                       24-May-2024 16:04                6957
function.posix-get-last-error.php                  24-May-2024 16:04                2426
function.posix-getcwd.php                          24-May-2024 16:04                2161
function.posix-getegid.php                         24-May-2024 16:04                2106
function.posix-geteuid.php                         24-May-2024 16:04                2127
function.posix-getgid.php                          24-May-2024 16:04                2096
function.posix-getgrgid.php                        24-May-2024 16:04                6412
function.posix-getgrnam.php                        24-May-2024 16:04                2187
function.posix-getgroups.php                       24-May-2024 16:04                2151
function.posix-getlogin.php                        24-May-2024 16:04                2086
function.posix-getpgid.php                         24-May-2024 16:04                2404
function.posix-getpgrp.php                         24-May-2024 16:04                2080
function.posix-getpid.php                          24-May-2024 16:04                1846
function.posix-getppid.php                         24-May-2024 16:04                1878
function.posix-getpwnam.php                        24-May-2024 16:04                4717
function.posix-getpwuid.php                        24-May-2024 16:04                4724
function.posix-getrlimit.php                       24-May-2024 16:04                2035
function.posix-getsid.php                          24-May-2024 16:04                2469
function.posix-getuid.php                          24-May-2024 16:04                2113
function.posix-initgroups.php                      24-May-2024 16:04                3362
function.posix-isatty.php                          24-May-2024 16:04                2166
function.posix-kill.php                            24-May-2024 16:04                2694
function.posix-mkfifo.php                          24-May-2024 16:04                3608
function.posix-mknod.php                           24-May-2024 16:04                7536
function.posix-pathconf.php                        24-May-2024 16:04                6335
function.posix-setegid.php                         24-May-2024 16:04                2473
function.posix-seteuid.php                         24-May-2024 16:04                2599
function.posix-setgid.php                          24-May-2024 16:04                2668
function.posix-setpgid.php                         24-May-2024 16:04                2691
function.posix-setrlimit.php                       24-May-2024 16:04                4684
function.posix-setsid.php                          24-May-2024 16:04                2069
function.posix-setuid.php                          24-May-2024 16:04                2590
function.posix-strerror.php                        24-May-2024 16:04                2587
function.posix-sysconf.php                         24-May-2024 16:04                4085
function.posix-times.php                           24-May-2024 16:04                2841
function.posix-ttyname.php                         24-May-2024 16:04                2153
function.posix-uname.php                           24-May-2024 16:04                3134
function.pow.php                                   24-May-2024 16:04                5282
function.preg-filter.php                           24-May-2024 16:04               10374
function.preg-grep.php                             24-May-2024 16:04                4431
function.preg-last-error-msg.php                   24-May-2024 16:04                4105
function.preg-last-error.php                       24-May-2024 16:04                5173
function.preg-match-all.php                        24-May-2024 16:04               16925
function.preg-match.php                            24-May-2024 16:04               11591
function.preg-quote.php                            24-May-2024 16:04                6196
function.preg-replace-callback-array.php           24-May-2024 16:04               10624
function.preg-replace-callback.php                 24-May-2024 16:04               16867
function.preg-replace.php                          24-May-2024 16:04               21020
function.preg-split.php                            24-May-2024 16:04                9470
function.prev.php                                  24-May-2024 16:04                5696
function.print-r.php                               24-May-2024 16:04                9310
function.print.php                                 24-May-2024 16:04                7630
function.printf.php                                24-May-2024 16:04                3268
function.proc-close.php                            24-May-2024 16:04                3725
function.proc-get-status.php                       24-May-2024 16:04                6859
function.proc-nice.php                             24-May-2024 16:04                7775
function.proc-open.php                             24-May-2024 16:04               22410
function.proc-terminate.php                        24-May-2024 16:04                4796
function.property-exists.php                       24-May-2024 16:04                8605
function.ps-add-bookmark.php                       24-May-2024 16:04                5165
function.ps-add-launchlink.php                     24-May-2024 16:04                5887
function.ps-add-locallink.php                      24-May-2024 16:04                6671
function.ps-add-note.php                           24-May-2024 16:04                7397
function.ps-add-pdflink.php                        24-May-2024 16:04                7044
function.ps-add-weblink.php                        24-May-2024 16:04                5973
function.ps-arc.php                                24-May-2024 16:04                5383
function.ps-arcn.php                               24-May-2024 16:04                5389
function.ps-begin-page.php                         24-May-2024 16:04                7044
function.ps-begin-pattern.php                      24-May-2024 16:04               13466
function.ps-begin-template.php                     24-May-2024 16:04               11460
function.ps-circle.php                             24-May-2024 16:04                4902
function.ps-clip.php                               24-May-2024 16:04                3181
function.ps-close-image.php                        24-May-2024 16:04                4066
function.ps-close.php                              24-May-2024 16:04                3819
function.ps-closepath-stroke.php                   24-May-2024 16:04                3254
function.ps-closepath.php                          24-May-2024 16:04                3415
function.ps-continue-text.php                      24-May-2024 16:04                4227
function.ps-curveto.php                            24-May-2024 16:04                5258
function.ps-delete.php                             24-May-2024 16:04                3698
function.ps-end-page.php                           24-May-2024 16:04                3424
function.ps-end-pattern.php                        24-May-2024 16:04                3355
function.ps-end-template.php                       24-May-2024 16:04                3362
function.ps-fill-stroke.php                        24-May-2024 16:04                3460
function.ps-fill.php                               24-May-2024 16:04                3393
function.ps-findfont.php                           24-May-2024 16:04                7262
function.ps-get-buffer.php                         24-May-2024 16:04                3315
function.ps-get-parameter.php                      24-May-2024 16:04                8034
function.ps-get-value.php                          24-May-2024 16:04                9545
function.ps-hyphenate.php                          24-May-2024 16:04                7418
function.ps-include-file.php                       24-May-2024 16:04                3275
function.ps-lineto.php                             24-May-2024 16:04                8376
function.ps-makespotcolor.php                      24-May-2024 16:04               10278
function.ps-moveto.php                             24-May-2024 16:04                3992
function.ps-new.php                                24-May-2024 16:04                3110
function.ps-open-file.php                          24-May-2024 16:04                3833
function.ps-open-image-file.php                    24-May-2024 16:04                5037
function.ps-open-image.php                         24-May-2024 16:04                7124
function.ps-open-memory-image.php                  24-May-2024 16:04                2942
function.ps-place-image.php                        24-May-2024 16:04                5393
function.ps-rect.php                               24-May-2024 16:04                5113
function.ps-restore.php                            24-May-2024 16:04                3537
function.ps-rotate.php                             24-May-2024 16:04               12247
function.ps-save.php                               24-May-2024 16:04                3284
function.ps-scale.php                              24-May-2024 16:04                3901
function.ps-set-border-color.php                   24-May-2024 16:04                5019
function.ps-set-border-dash.php                    24-May-2024 16:04                4607
function.ps-set-border-style.php                   24-May-2024 16:04                4671
function.ps-set-info.php                           24-May-2024 16:04                6143
function.ps-set-parameter.php                      24-May-2024 16:04                4081
function.ps-set-text-pos.php                       24-May-2024 16:04                9453
function.ps-set-value.php                          24-May-2024 16:04                4893
function.ps-setcolor.php                           24-May-2024 16:04                6095
function.ps-setdash.php                            24-May-2024 16:04                3788
function.ps-setflat.php                            24-May-2024 16:04                3262
function.ps-setfont.php                            24-May-2024 16:04                4206
function.ps-setgray.php                            24-May-2024 16:04                3461
function.ps-setlinecap.php                         24-May-2024 16:04                3987
function.ps-setlinejoin.php                        24-May-2024 16:04                4005
function.ps-setlinewidth.php                       24-May-2024 16:04                3869
function.ps-setmiterlimit.php                      24-May-2024 16:04                4289
function.ps-setoverprintmode.php                   24-May-2024 16:04                3299
function.ps-setpolydash.php                        24-May-2024 16:04                7872
function.ps-shading-pattern.php                    24-May-2024 16:04                4385
function.ps-shading.php                            24-May-2024 16:04                7320
function.ps-shfill.php                             24-May-2024 16:04                4110
function.ps-show-boxed.php                         24-May-2024 16:04               12873
function.ps-show-xy.php                            24-May-2024 16:04                4389
function.ps-show-xy2.php                           24-May-2024 16:04                3262
function.ps-show.php                               24-May-2024 16:04                5894
function.ps-show2.php                              24-May-2024 16:04                3453
function.ps-string-geometry.php                    24-May-2024 16:04                4984
function.ps-stringwidth.php                        24-May-2024 16:04                4461
function.ps-stroke.php                             24-May-2024 16:04                3590
function.ps-symbol-name.php                        24-May-2024 16:04                3989
function.ps-symbol-width.php                       24-May-2024 16:04                4533
function.ps-symbol.php                             24-May-2024 16:04                3856
function.ps-translate.php                          24-May-2024 16:04               14266
function.pspell-add-to-personal.php                24-May-2024 16:04                6508
function.pspell-add-to-session.php                 24-May-2024 16:04                4166
function.pspell-check.php                          24-May-2024 16:04                5073
function.pspell-clear-session.php                  24-May-2024 16:04                5922
function.pspell-config-create.php                  24-May-2024 16:04                8085
function.pspell-config-data-dir.php                24-May-2024 16:04                3479
function.pspell-config-dict-dir.php                24-May-2024 16:04                3478
function.pspell-config-ignore.php                  24-May-2024 16:04                5806
function.pspell-config-mode.php                    24-May-2024 16:04                6650
function.pspell-config-personal.php                24-May-2024 16:04                6592
function.pspell-config-repl.php                    24-May-2024 16:04                6895
function.pspell-config-runtogether.php             24-May-2024 16:04                6459
function.pspell-config-save-repl.php               24-May-2024 16:04                5398
function.pspell-new-config.php                     24-May-2024 16:04                6432
function.pspell-new-personal.php                   24-May-2024 16:04               11028
function.pspell-new.php                            24-May-2024 16:04                9561
function.pspell-save-wordlist.php                  24-May-2024 16:04                6114
function.pspell-store-replacement.php              24-May-2024 16:04                7789
function.pspell-suggest.php                        24-May-2024 16:04                5609
function.putenv.php                                24-May-2024 16:03                4184
function.quoted-printable-decode.php               24-May-2024 16:04                2750
function.quoted-printable-encode.php               24-May-2024 16:04                5123
function.quotemeta.php                             24-May-2024 16:04                2930
function.rad2deg.php                               24-May-2024 16:04                2804
function.radius-acct-open.php                      24-May-2024 16:03                3277
function.radius-add-server.php                     24-May-2024 16:03                7845
function.radius-auth-open.php                      24-May-2024 16:03                3288
function.radius-close.php                          24-May-2024 16:03                2732
function.radius-config.php                         24-May-2024 16:03                4150
function.radius-create-request.php                 24-May-2024 16:03                5396
function.radius-cvt-addr.php                       24-May-2024 16:03                6252
function.radius-cvt-int.php                        24-May-2024 16:03                5652
function.radius-cvt-string.php                     24-May-2024 16:03                5706
function.radius-demangle-mppe-key.php              24-May-2024 16:03                3286
function.radius-demangle.php                       24-May-2024 16:03                3017
function.radius-get-attr.php                       24-May-2024 16:03                6506
function.radius-get-tagged-attr-data.php           24-May-2024 16:03                6603
function.radius-get-tagged-attr-tag.php            24-May-2024 16:03                6656
function.radius-get-vendor-attr.php                24-May-2024 16:03                8247
function.radius-put-addr.php                       24-May-2024 16:03                5690
function.radius-put-attr.php                       24-May-2024 16:03                8925
function.radius-put-int.php                        24-May-2024 16:03                7662
function.radius-put-string.php                     24-May-2024 16:03                8042
function.radius-put-vendor-addr.php                24-May-2024 16:03                5639
function.radius-put-vendor-attr.php                24-May-2024 16:03                7904
function.radius-put-vendor-int.php                 24-May-2024 16:03                6418
function.radius-put-vendor-string.php              24-May-2024 16:03                6811
function.radius-request-authenticator.php          24-May-2024 16:03                3215
function.radius-salt-encrypt-attr.php              24-May-2024 16:03                4312
function.radius-send-request.php                   24-May-2024 16:03                4055
function.radius-server-secret.php                  24-May-2024 16:03                2745
function.radius-strerror.php                       24-May-2024 16:03                2650
function.rand.php                                  24-May-2024 16:04                9648
function.random-bytes.php                          24-May-2024 16:04                9623
function.random-int.php                            24-May-2024 16:04                9500
function.range.php                                 24-May-2024 16:04                7329
function.rar-wrapper-cache-stats.php               24-May-2024 16:03                2408
function.rawurldecode.php                          24-May-2024 16:04                4631
function.rawurlencode.php                          24-May-2024 16:04                6274
function.read-exif-data.php                        24-May-2024 16:04                2488
function.readdir.php                               24-May-2024 16:04                7769
function.readfile.php                              24-May-2024 16:04                4479
function.readgzfile.php                            24-May-2024 16:03                4598
function.readline-add-history.php                  24-May-2024 16:03                2844
function.readline-callback-handler-install.php     24-May-2024 16:03                9487
function.readline-callback-handler-remove.php      24-May-2024 16:03                3940
function.readline-callback-read-char.php           24-May-2024 16:03                3865
function.readline-clear-history.php                24-May-2024 16:03                2573
function.readline-completion-function.php          24-May-2024 16:03                3112
function.readline-info.php                         24-May-2024 16:03                4970
function.readline-list-history.php                 24-May-2024 16:03                2385
function.readline-on-new-line.php                  24-May-2024 16:03                2722
function.readline-read-history.php                 24-May-2024 16:03                3555
function.readline-redisplay.php                    24-May-2024 16:03                2300
function.readline-write-history.php                24-May-2024 16:03                3511
function.readline.php                              24-May-2024 16:03                5181
function.readlink.php                              24-May-2024 16:04                3449
function.realpath-cache-get.php                    24-May-2024 16:04                4255
function.realpath-cache-size.php                   24-May-2024 16:04                3727
function.realpath.php                              24-May-2024 16:04                3569
function.recode-file.php                           24-May-2024 16:04                5900
function.recode-string.php                         24-May-2024 16:04                5211
function.recode.php                                24-May-2024 16:04                1753
function.register-shutdown-function.php            24-May-2024 16:04                7597
function.register-tick-function.php                24-May-2024 16:04                5498
function.rename.php                                24-May-2024 16:04                4982
function.require-once.php                          24-May-2024 16:03                1831
function.require.php                               24-May-2024 16:03                2001
function.reset.php                                 24-May-2024 16:04                5009
function.restore-error-handler.php                 24-May-2024 16:03                2773
function.restore-exception-handler.php             24-May-2024 16:03                2997
function.restore-include-path.php                  24-May-2024 16:03                4096
function.return.php                                24-May-2024 16:03                4321
function.rewind.php                                24-May-2024 16:04                3053
function.rewinddir.php                             24-May-2024 16:04                2053
function.rmdir.php                                 24-May-2024 16:04                5223
function.rnp-backend-string.php                    24-May-2024 16:03                2288
function.rnp-backend-version.php                   24-May-2024 16:03                2222
function.rnp-decrypt.php                           24-May-2024 16:03                3265
function.rnp-dump-packets-to-json.php              24-May-2024 16:03                3179
function.rnp-dump-packets.php                      24-May-2024 16:03                3133
function.rnp-ffi-create.php                        24-May-2024 16:03                3228
function.rnp-ffi-destroy.php                       24-May-2024 16:03                2465
function.rnp-ffi-set-pass-provider.php             24-May-2024 16:03                6759
function.rnp-import-keys.php                       24-May-2024 16:03                3517
function.rnp-import-signatures.php                 24-May-2024 16:03                3507
function.rnp-key-export-autocrypt.php              24-May-2024 16:03                4568
function.rnp-key-export-revocation.php             24-May-2024 16:03                5218
function.rnp-key-export.php                        24-May-2024 16:03                3487
function.rnp-key-get-info.php                      24-May-2024 16:03                8005
function.rnp-key-remove.php                        24-May-2024 16:03                3627
function.rnp-key-revoke.php                        24-May-2024 16:03                4864
function.rnp-list-keys.php                         24-May-2024 16:03                3170
function.rnp-load-keys-from-path.php               24-May-2024 16:03                3866
function.rnp-load-keys.php                         24-May-2024 16:03                3822
function.rnp-locate-key.php                        24-May-2024 16:03                3590
function.rnp-op-encrypt.php                        24-May-2024 16:03                7957
function.rnp-op-generate-key.php                   24-May-2024 16:03                7576
function.rnp-op-sign-cleartext.php                 24-May-2024 16:03                5226
function.rnp-op-sign-detached.php                  24-May-2024 16:03                5105
function.rnp-op-sign.php                           24-May-2024 16:03                6186
function.rnp-op-verify-detached.php                24-May-2024 16:03                7115
function.rnp-op-verify.php                         24-May-2024 16:03                6854
function.rnp-save-keys-to-path.php                 24-May-2024 16:03                3880
function.rnp-save-keys.php                         24-May-2024 16:03                3853
function.rnp-supported-features.php                24-May-2024 16:03                2947
function.rnp-version-string-full.php               24-May-2024 16:03                2307
function.rnp-version-string.php                    24-May-2024 16:03                2204
function.round.php                                 24-May-2024 16:04               23604
function.rpmaddtag.php                             24-May-2024 16:04                3365
function.rpmdbinfo.php                             24-May-2024 16:04                5249
function.rpmdbsearch.php                           24-May-2024 16:04                6149
function.rpmgetsymlink.php                         24-May-2024 16:04                2992
function.rpminfo.php                               24-May-2024 16:04                5431
function.rpmvercmp.php                             24-May-2024 16:04                4928
function.rrd-create.php                            24-May-2024 16:04                2985
function.rrd-error.php                             24-May-2024 16:04                2134
function.rrd-fetch.php                             24-May-2024 16:04                2970
function.rrd-first.php                             24-May-2024 16:04                2951
function.rrd-graph.php                             24-May-2024 16:04                3203
function.rrd-info.php                              24-May-2024 16:04                2536
function.rrd-last.php                              24-May-2024 16:04                2483
function.rrd-lastupdate.php                        24-May-2024 16:04                2666
function.rrd-restore.php                           24-May-2024 16:04                3372
function.rrd-tune.php                              24-May-2024 16:04                3054
function.rrd-update.php                            24-May-2024 16:04                3127
function.rrd-version.php                           24-May-2024 16:04                2228
function.rrd-xport.php                             24-May-2024 16:04                2710
function.rrdc-disconnect.php                       24-May-2024 16:04                2588
function.rsort.php                                 24-May-2024 16:04                5269
function.rtrim.php                                 24-May-2024 16:04                6690
function.runkit7-constant-add.php                  24-May-2024 16:03                4460
function.runkit7-constant-redefine.php             24-May-2024 16:03                4354
function.runkit7-constant-remove.php               24-May-2024 16:03                3668
function.runkit7-function-add.php                  24-May-2024 16:03                9770
function.runkit7-function-copy.php                 24-May-2024 16:03                5537
function.runkit7-function-redefine.php             24-May-2024 16:03               10205
function.runkit7-function-remove.php               24-May-2024 16:03                4154
function.runkit7-function-rename.php               24-May-2024 16:03                4431
function.runkit7-import.php                        24-May-2024 16:03                3864
function.runkit7-method-add.php                    24-May-2024 16:03               11796
function.runkit7-method-copy.php                   24-May-2024 16:03                7088
function.runkit7-method-redefine.php               24-May-2024 16:03               12232
function.runkit7-method-remove.php                 24-May-2024 16:03                6487
function.runkit7-method-rename.php                 24-May-2024 16:03                6649
function.runkit7-object-id.php                     24-May-2024 16:03                3777
function.runkit7-superglobals.php                  24-May-2024 16:03                2664
function.runkit7-zval-inspect.php                  24-May-2024 16:03                5135
function.sapi-windows-cp-conv.php                  24-May-2024 16:04                4762
function.sapi-windows-cp-get.php                   24-May-2024 16:04                3483
function.sapi-windows-cp-is-utf8.php               24-May-2024 16:04                2768
function.sapi-windows-cp-set.php                   24-May-2024 16:04                3106
function.sapi-windows-generate-ctrl-event.php      24-May-2024 16:04                7803
function.sapi-windows-set-ctrl-handler.php         24-May-2024 16:04                7612
function.sapi-windows-vt100-support.php            24-May-2024 16:04               11243
function.scandir.php                               24-May-2024 16:04                9082
function.scoutapm-get-calls.php                    24-May-2024 16:04                4487
function.scoutapm-list-instrumented-functions.php  24-May-2024 16:04                3825
function.seaslog-get-author.php                    24-May-2024 16:04                3144
function.seaslog-get-version.php                   24-May-2024 16:04                3143
function.sem-acquire.php                           24-May-2024 16:04                3248
function.sem-get.php                               24-May-2024 16:04                4404
function.sem-release.php                           24-May-2024 16:04                2890
function.sem-remove.php                            24-May-2024 16:04                3013
function.serialize.php                             24-May-2024 16:04                8708
function.session-abort.php                         24-May-2024 16:04                4223
function.session-cache-expire.php                  24-May-2024 16:04                5742
function.session-cache-limiter.php                 24-May-2024 16:04                5230
function.session-commit.php                        24-May-2024 16:04                1847
function.session-create-id.php                     24-May-2024 16:04                9874
function.session-decode.php                        24-May-2024 16:04                2354
function.session-destroy.php                       24-May-2024 16:04                4343
function.session-encode.php                        24-May-2024 16:04                1996
function.session-gc.php                            24-May-2024 16:04                7631
function.session-get-cookie-params.php             24-May-2024 16:04                2866
function.session-id.php                            24-May-2024 16:04                2500
function.session-module-name.php                   24-May-2024 16:04                2290
function.session-name.php                          24-May-2024 16:04                5707
function.session-regenerate-id.php                 24-May-2024 16:04               15677
function.session-register-shutdown.php             24-May-2024 16:04                2782
function.session-reset.php                         24-May-2024 16:04                4311
function.session-save-path.php                     24-May-2024 16:04                2759
function.session-set-cookie-params.php             24-May-2024 16:04                2653
function.session-set-save-handler.php              24-May-2024 16:04               12340
function.session-start.php                         24-May-2024 16:04                3683
function.session-status.php                        24-May-2024 16:04                3299
function.session-unset.php                         24-May-2024 16:04                2484
function.session-write-close.php                   24-May-2024 16:04                2639
function.set-error-handler.php                     24-May-2024 16:03               26589
function.set-exception-handler.php                 24-May-2024 16:03                9267
function.set-file-buffer.php                       24-May-2024 16:04                1812
function.set-include-path.php                      24-May-2024 16:03                3911
function.set-time-limit.php                        24-May-2024 16:03                4878
function.setcookie.php                             24-May-2024 16:04               26753
function.setlocale.php                             24-May-2024 16:04               16155
function.setrawcookie.php                          24-May-2024 16:04                6388
function.settype.php                               24-May-2024 16:04                6600
function.sha1-file.php                             24-May-2024 16:04                4909
function.sha1.php                                  24-May-2024 16:04                4331
function.shell-exec.php                            24-May-2024 16:04                5189
function.shm-attach.php                            24-May-2024 16:04                3563
function.shm-detach.php                            24-May-2024 16:04                2952
function.shm-get-var.php                           24-May-2024 16:04                2468
function.shm-has-var.php                           24-May-2024 16:04                4439
function.shm-put-var.php                           24-May-2024 16:04                3250
function.shm-remove-var.php                        24-May-2024 16:04                2415
function.shm-remove.php                            24-May-2024 16:04                2351
function.shmop-close.php                           24-May-2024 16:04                3071
function.shmop-delete.php                          24-May-2024 16:04                3157
function.shmop-open.php                            24-May-2024 16:04                6600
function.shmop-read.php                            24-May-2024 16:04                3756
function.shmop-size.php                            24-May-2024 16:04                3385
function.shmop-write.php                           24-May-2024 16:04                3911
function.show-source.php                           24-May-2024 16:04                1769
function.shuffle.php                               24-May-2024 16:04                4512
function.simdjson-decode.php                       24-May-2024 16:04               17028
function.simdjson-is-valid.php                     24-May-2024 16:04               10494
function.simdjson-key-count.php                    24-May-2024 16:04                4833
function.simdjson-key-exists.php                   24-May-2024 16:04                4628
function.simdjson-key-value.php                    24-May-2024 16:04                7380
function.similar-text.php                          24-May-2024 16:04                3299
function.simplexml-import-dom.php                  24-May-2024 16:04                6403
function.simplexml-load-file.php                   24-May-2024 16:04               10276
function.simplexml-load-string.php                 24-May-2024 16:04               10020
function.sin.php                                   24-May-2024 16:04                3559
function.sinh.php                                  24-May-2024 16:04                2399
function.sizeof.php                                24-May-2024 16:04                1660
function.sleep.php                                 24-May-2024 16:04                6633
function.snmp-get-quick-print.php                  24-May-2024 16:04                3398
function.snmp-get-valueretrieval.php               24-May-2024 16:04                4470
function.snmp-read-mib.php                         24-May-2024 16:04                4913
function.snmp-set-enum-print.php                   24-May-2024 16:04                5396
function.snmp-set-oid-numeric-print.php            24-May-2024 16:04                2347
function.snmp-set-oid-output-format.php            24-May-2024 16:04                7826
function.snmp-set-quick-print.php                  24-May-2024 16:04                5343
function.snmp-set-valueretrieval.php               24-May-2024 16:04                9536
function.snmp2-get.php                             24-May-2024 16:04                5822
function.snmp2-getnext.php                         24-May-2024 16:04                6190
function.snmp2-real-walk.php                       24-May-2024 16:04                6629
function.snmp2-set.php                             24-May-2024 16:04               11011
function.snmp2-walk.php                            24-May-2024 16:04                7114
function.snmp3-get.php                             24-May-2024 16:04                8929
function.snmp3-getnext.php                         24-May-2024 16:04                9257
function.snmp3-real-walk.php                       24-May-2024 16:04                9945
function.snmp3-set.php                             24-May-2024 16:04               13785
function.snmp3-walk.php                            24-May-2024 16:04               10402
function.snmpget.php                               24-May-2024 16:04                4100
function.snmpgetnext.php                           24-May-2024 16:04                6071
function.snmprealwalk.php                          24-May-2024 16:04                3043
function.snmpset.php                               24-May-2024 16:04                3871
function.snmpwalk.php                              24-May-2024 16:04                5744
function.snmpwalkoid.php                           24-May-2024 16:04                6491
function.socket-accept.php                         24-May-2024 16:04                5352
function.socket-addrinfo-bind.php                  24-May-2024 16:04                5478
function.socket-addrinfo-connect.php               24-May-2024 16:04                5273
function.socket-addrinfo-explain.php               24-May-2024 16:04                4513
function.socket-addrinfo-lookup.php                24-May-2024 16:04                6110
function.socket-atmark.php                         24-May-2024 16:04                5015
function.socket-bind.php                           24-May-2024 16:04               10398
function.socket-clear-error.php                    24-May-2024 16:04                3222
function.socket-close.php                          24-May-2024 16:04                3951
function.socket-cmsg-space.php                     24-May-2024 16:04                3815
function.socket-connect.php                        24-May-2024 16:04                5142
function.socket-create-listen.php                  24-May-2024 16:04                5401
function.socket-create-pair.php                    24-May-2024 16:04               19316
function.socket-create.php                         24-May-2024 16:04               10180
function.socket-export-stream.php                  24-May-2024 16:04                3581
function.socket-get-option.php                     24-May-2024 16:04                7115
function.socket-get-status.php                     24-May-2024 16:04                1845
function.socket-getopt.php                         24-May-2024 16:04                1826
function.socket-getpeername.php                    24-May-2024 16:04                6000
function.socket-getsockname.php                    24-May-2024 16:04                6038
function.socket-import-stream.php                  24-May-2024 16:04                5193
function.socket-last-error.php                     24-May-2024 16:04                5160
function.socket-listen.php                         24-May-2024 16:04                5222
function.socket-read.php                           24-May-2024 16:04                5753
function.socket-recv.php                           24-May-2024 16:04                3134
function.socket-recvfrom.php                       24-May-2024 16:04                3752
function.socket-recvmsg.php                        24-May-2024 16:04                4492
function.socket-select.php                         24-May-2024 16:04               14759
function.socket-send.php                           24-May-2024 16:04                4591
function.socket-sendmsg.php                        24-May-2024 16:04                4629
function.socket-sendto.php                         24-May-2024 16:04                7764
function.socket-set-block.php                      24-May-2024 16:04                6251
function.socket-set-blocking.php                   24-May-2024 16:04                1865
function.socket-set-nonblock.php                   24-May-2024 16:04                5272
function.socket-set-option.php                     24-May-2024 16:04                4715
function.socket-set-timeout.php                    24-May-2024 16:04                1833
function.socket-setopt.php                         24-May-2024 16:04                1820
function.socket-shutdown.php                       24-May-2024 16:04                3589
function.socket-strerror.php                       24-May-2024 16:04                6308
function.socket-write.php                          24-May-2024 16:04                5655
function.socket-wsaprotocol-info-export.php        24-May-2024 16:04                5114
function.socket-wsaprotocol-info-import.php        24-May-2024 16:04                4499
function.socket-wsaprotocol-info-release.php       24-May-2024 16:04                3682
function.sodium-add.php                            24-May-2024 16:03                3222
function.sodium-base642bin.php                     24-May-2024 16:03                4594
function.sodium-bin2base64.php                     24-May-2024 16:03                4124
function.sodium-bin2hex.php                        24-May-2024 16:03                2821
function.sodium-compare.php                        24-May-2024 16:03                3445
function.sodium-crypto-aead-aes256gcm-decrypt.php  24-May-2024 16:03                4823
function.sodium-crypto-aead-aes256gcm-encrypt.php  24-May-2024 16:03                4625
function.sodium-crypto-aead-aes256gcm-is-availa..> 24-May-2024 16:03                2870
function.sodium-crypto-aead-aes256gcm-keygen.php   24-May-2024 16:03                2860
function.sodium-crypto-aead-chacha20poly1305-de..> 24-May-2024 16:03                4688
function.sodium-crypto-aead-chacha20poly1305-en..> 24-May-2024 16:03                4504
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-May-2024 16:03                4918
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-May-2024 16:03                4670
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-May-2024 16:03                3054
function.sodium-crypto-aead-chacha20poly1305-ke..> 24-May-2024 16:03                2989
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-May-2024 16:03                5096
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-May-2024 16:03                4888
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-May-2024 16:03                3030
function.sodium-crypto-auth-keygen.php             24-May-2024 16:03                2681
function.sodium-crypto-auth-verify.php             24-May-2024 16:03                4019
function.sodium-crypto-auth.php                    24-May-2024 16:03                3477
function.sodium-crypto-box-keypair-from-secretk..> 24-May-2024 16:03                3556
function.sodium-crypto-box-keypair.php             24-May-2024 16:03                2962
function.sodium-crypto-box-open.php                24-May-2024 16:03                4123
function.sodium-crypto-box-publickey-from-secre..> 24-May-2024 16:03                3387
function.sodium-crypto-box-publickey.php           24-May-2024 16:03                3100
function.sodium-crypto-box-seal-open.php           24-May-2024 16:03                6172
function.sodium-crypto-box-seal.php                24-May-2024 16:03                7300
function.sodium-crypto-box-secretkey.php           24-May-2024 16:03                3067
function.sodium-crypto-box-seed-keypair.php        24-May-2024 16:03                3126
function.sodium-crypto-box.php                     24-May-2024 16:03                4443
function.sodium-crypto-core-ristretto255-add.php   24-May-2024 16:03                6178
function.sodium-crypto-core-ristretto255-from-h..> 24-May-2024 16:03                5538
function.sodium-crypto-core-ristretto255-is-val..> 24-May-2024 16:03                5703
function.sodium-crypto-core-ristretto255-random..> 24-May-2024 16:03                5690
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:03                6445
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:03                3682
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:03                5537
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:03                3941
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:03                5521
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:03                5849
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:03                3626
function.sodium-crypto-core-ristretto255-scalar..> 24-May-2024 16:03                6436
function.sodium-crypto-core-ristretto255-sub.php   24-May-2024 16:03                6215
function.sodium-crypto-generichash-final.php       24-May-2024 16:03                6916
function.sodium-crypto-generichash-init.php        24-May-2024 16:03                6963
function.sodium-crypto-generichash-keygen.php      24-May-2024 16:03                2491
function.sodium-crypto-generichash-update.php      24-May-2024 16:03                6596
function.sodium-crypto-generichash.php             24-May-2024 16:03                3882
function.sodium-crypto-kdf-derive-from-key.php     24-May-2024 16:03                4093
function.sodium-crypto-kdf-keygen.php              24-May-2024 16:03                2593
function.sodium-crypto-kx-client-session-keys.php  24-May-2024 16:03                3509
function.sodium-crypto-kx-keypair.php              24-May-2024 16:03                5042
function.sodium-crypto-kx-publickey.php            24-May-2024 16:03                2919
function.sodium-crypto-kx-secretkey.php            24-May-2024 16:03                2930
function.sodium-crypto-kx-seed-keypair.php         24-May-2024 16:03                2878
function.sodium-crypto-kx-server-session-keys.php  24-May-2024 16:03                3575
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-May-2024 16:03                3483
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-May-2024 16:03                3686
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-May-2024 16:03                6575
function.sodium-crypto-pwhash-str-needs-rehash.php 24-May-2024 16:03                4052
function.sodium-crypto-pwhash-str-verify.php       24-May-2024 16:03                4906
function.sodium-crypto-pwhash-str.php              24-May-2024 16:03                8745
function.sodium-crypto-pwhash.php                  24-May-2024 16:03               10568
function.sodium-crypto-scalarmult-base.php         24-May-2024 16:03                2073
function.sodium-crypto-scalarmult-ristretto255-..> 24-May-2024 16:03                3595
function.sodium-crypto-scalarmult-ristretto255.php 24-May-2024 16:03                3944
function.sodium-crypto-scalarmult.php              24-May-2024 16:03                3101
function.sodium-crypto-secretbox-keygen.php        24-May-2024 16:03                6318
function.sodium-crypto-secretbox-open.php          24-May-2024 16:03                8921
function.sodium-crypto-secretbox.php               24-May-2024 16:03                8923
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:03               11020
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:03               10354
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:03                2757
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:03                5859
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:03                5967
function.sodium-crypto-secretstream-xchacha20po..> 24-May-2024 16:03                3018
function.sodium-crypto-shorthash-keygen.php        24-May-2024 16:03                2751
function.sodium-crypto-shorthash.php               24-May-2024 16:03                3310
function.sodium-crypto-sign-detached.php           24-May-2024 16:03                3303
function.sodium-crypto-sign-ed25519-pk-to-curve..> 24-May-2024 16:03                2990
function.sodium-crypto-sign-ed25519-sk-to-curve..> 24-May-2024 16:03                3143
function.sodium-crypto-sign-keypair-from-secret..> 24-May-2024 16:03                3382
function.sodium-crypto-sign-keypair.php            24-May-2024 16:03                2479
function.sodium-crypto-sign-open.php               24-May-2024 16:03                3392
function.sodium-crypto-sign-publickey-from-secr..> 24-May-2024 16:03                2945
function.sodium-crypto-sign-publickey.php          24-May-2024 16:03                2955
function.sodium-crypto-sign-secretkey.php          24-May-2024 16:03                2931
function.sodium-crypto-sign-seed-keypair.php       24-May-2024 16:03                3164
function.sodium-crypto-sign-verify-detached.php    24-May-2024 16:03                3699
function.sodium-crypto-sign.php                    24-May-2024 16:03                3381
function.sodium-crypto-stream-keygen.php           24-May-2024 16:03                2662
function.sodium-crypto-stream-xchacha20-keygen.php 24-May-2024 16:03                2820
function.sodium-crypto-stream-xchacha20-xor-ic.php 24-May-2024 16:03                9866
function.sodium-crypto-stream-xchacha20-xor.php    24-May-2024 16:03                4928
function.sodium-crypto-stream-xchacha20.php        24-May-2024 16:03                3837
function.sodium-crypto-stream-xor.php              24-May-2024 16:03                3720
function.sodium-crypto-stream.php                  24-May-2024 16:03                3556
function.sodium-hex2bin.php                        24-May-2024 16:03                3429
function.sodium-increment.php                      24-May-2024 16:03                2558
function.sodium-memcmp.php                         24-May-2024 16:03                3749
function.sodium-memzero.php                        24-May-2024 16:03                2650
function.sodium-pad.php                            24-May-2024 16:03                2878
function.sodium-unpad.php                          24-May-2024 16:03                2833
function.solr-get-version.php                      24-May-2024 16:04                3980
function.sort.php                                  24-May-2024 16:04                7084
function.soundex.php                               24-May-2024 16:04                5604
function.spl-autoload-call.php                     24-May-2024 16:04                2687
function.spl-autoload-extensions.php               24-May-2024 16:04                5026
function.spl-autoload-functions.php                24-May-2024 16:04                3298
function.spl-autoload-register.php                 24-May-2024 16:04               13537
function.spl-autoload-unregister.php               24-May-2024 16:04                3141
function.spl-autoload.php                          24-May-2024 16:04                4745
function.spl-classes.php                           24-May-2024 16:04                3839
function.spl-object-hash.php                       24-May-2024 16:04                5064
function.spl-object-id.php                         24-May-2024 16:04                4162
function.sprintf.php                               24-May-2024 16:04               24587
function.sqlsrv-begin-transaction.php              24-May-2024 16:04               11309
function.sqlsrv-cancel.php                         24-May-2024 16:04               10380
function.sqlsrv-client-info.php                    24-May-2024 16:04                6792
function.sqlsrv-close.php                          24-May-2024 16:04                5651
function.sqlsrv-commit.php                         24-May-2024 16:04               11166
function.sqlsrv-configure.php                      24-May-2024 16:04                4786
function.sqlsrv-connect.php                        24-May-2024 16:04               12239
function.sqlsrv-errors.php                         24-May-2024 16:04               10079
function.sqlsrv-execute.php                        24-May-2024 16:04               10203
function.sqlsrv-fetch-array.php                    24-May-2024 16:04               15659
function.sqlsrv-fetch-object.php                   24-May-2024 16:04               12416
function.sqlsrv-fetch.php                          24-May-2024 16:04               10865
function.sqlsrv-field-metadata.php                 24-May-2024 16:04                8903
function.sqlsrv-free-stmt.php                      24-May-2024 16:04                7781
function.sqlsrv-get-config.php                     24-May-2024 16:04                3380
function.sqlsrv-get-field.php                      24-May-2024 16:04               10237
function.sqlsrv-has-rows.php                       24-May-2024 16:04                6396
function.sqlsrv-next-result.php                    24-May-2024 16:04                9310
function.sqlsrv-num-fields.php                     24-May-2024 16:04                8230
function.sqlsrv-num-rows.php                       24-May-2024 16:04                7957
function.sqlsrv-prepare.php                        24-May-2024 16:04               14573
function.sqlsrv-query.php                          24-May-2024 16:04               11926
function.sqlsrv-rollback.php                       24-May-2024 16:04               10636
function.sqlsrv-rows-affected.php                  24-May-2024 16:04                8007
function.sqlsrv-send-stream-data.php               24-May-2024 16:04                8576
function.sqlsrv-server-info.php                    24-May-2024 16:04                6207
function.sqrt.php                                  24-May-2024 16:04                3054
function.srand.php                                 24-May-2024 16:04                7262
function.sscanf.php                                24-May-2024 16:04                7821
function.ssdeep-fuzzy-compare.php                  24-May-2024 16:04                3317
function.ssdeep-fuzzy-hash-filename.php            24-May-2024 16:04                3040
function.ssdeep-fuzzy-hash.php                     24-May-2024 16:04                2882
function.ssh2-auth-agent.php                       24-May-2024 16:04                4809
function.ssh2-auth-hostbased-file.php              24-May-2024 16:04                7785
function.ssh2-auth-none.php                        24-May-2024 16:04                4904
function.ssh2-auth-password.php                    24-May-2024 16:04                5072
function.ssh2-auth-pubkey-file.php                 24-May-2024 16:04                7286
function.ssh2-connect.php                          24-May-2024 16:04               15799
function.ssh2-disconnect.php                       24-May-2024 16:04                3157
function.ssh2-exec.php                             24-May-2024 16:04                7673
function.ssh2-fetch-stream.php                     24-May-2024 16:04                5583
function.ssh2-fingerprint.php                      24-May-2024 16:04                5575
function.ssh2-forward-accept.php                   24-May-2024 16:04                3130
function.ssh2-forward-listen.php                   24-May-2024 16:04                4576
function.ssh2-methods-negotiated.php               24-May-2024 16:04                8041
function.ssh2-poll.php                             24-May-2024 16:04                3611
function.ssh2-publickey-add.php                    24-May-2024 16:04                8514
function.ssh2-publickey-init.php                   24-May-2024 16:04                4754
function.ssh2-publickey-list.php                   24-May-2024 16:04                8908
function.ssh2-publickey-remove.php                 24-May-2024 16:04                4802
function.ssh2-scp-recv.php                         24-May-2024 16:04                5522
function.ssh2-scp-send.php                         24-May-2024 16:04                6133
function.ssh2-send-eof.php                         24-May-2024 16:04                3510
function.ssh2-sftp-chmod.php                       24-May-2024 16:04                6044
function.ssh2-sftp-lstat.php                       24-May-2024 16:04                7329
function.ssh2-sftp-mkdir.php                       24-May-2024 16:04                6910
function.ssh2-sftp-readlink.php                    24-May-2024 16:04                5391
function.ssh2-sftp-realpath.php                    24-May-2024 16:04                5612
function.ssh2-sftp-rename.php                      24-May-2024 16:04                5625
function.ssh2-sftp-rmdir.php                       24-May-2024 16:04                5616
function.ssh2-sftp-stat.php                        24-May-2024 16:04                7244
function.ssh2-sftp-symlink.php                     24-May-2024 16:04                5817
function.ssh2-sftp-unlink.php                      24-May-2024 16:04                5091
function.ssh2-sftp.php                             24-May-2024 16:04                5519
function.ssh2-shell.php                            24-May-2024 16:04                8134
function.ssh2-tunnel.php                           24-May-2024 16:04                5404
function.stat.php                                  24-May-2024 16:04                6399
function.stats-absolute-deviation.php              24-May-2024 16:04                2875
function.stats-cdf-beta.php                        24-May-2024 16:04                5240
function.stats-cdf-binomial.php                    24-May-2024 16:04                5225
function.stats-cdf-cauchy.php                      24-May-2024 16:04                5260
function.stats-cdf-chisquare.php                   24-May-2024 16:04                4579
function.stats-cdf-exponential.php                 24-May-2024 16:04                4610
function.stats-cdf-f.php                           24-May-2024 16:04                5165
function.stats-cdf-gamma.php                       24-May-2024 16:04                5224
function.stats-cdf-laplace.php                     24-May-2024 16:04                5245
function.stats-cdf-logistic.php                    24-May-2024 16:04                5280
function.stats-cdf-negative-binomial.php           24-May-2024 16:04                5368
function.stats-cdf-noncentral-chisquare.php        24-May-2024 16:04                5470
function.stats-cdf-noncentral-f.php                24-May-2024 16:04                6044
function.stats-cdf-noncentral-t.php                24-May-2024 16:04                5330
function.stats-cdf-normal.php                      24-May-2024 16:04                5262
function.stats-cdf-poisson.php                     24-May-2024 16:04                4544
function.stats-cdf-t.php                           24-May-2024 16:04                4472
function.stats-cdf-uniform.php                     24-May-2024 16:04                5225
function.stats-cdf-weibull.php                     24-May-2024 16:04                5262
function.stats-covariance.php                      24-May-2024 16:04                3073
function.stats-dens-beta.php                       24-May-2024 16:04                3559
function.stats-dens-cauchy.php                     24-May-2024 16:04                3617
function.stats-dens-chisquare.php                  24-May-2024 16:04                3287
function.stats-dens-exponential.php                24-May-2024 16:04                3277
function.stats-dens-f.php                          24-May-2024 16:04                3557
function.stats-dens-gamma.php                      24-May-2024 16:04                3610
function.stats-dens-laplace.php                    24-May-2024 16:04                3644
function.stats-dens-logistic.php                   24-May-2024 16:04                3656
function.stats-dens-normal.php                     24-May-2024 16:04                3627
function.stats-dens-pmf-binomial.php               24-May-2024 16:04                3681
function.stats-dens-pmf-hypergeometric.php         24-May-2024 16:04                4333
function.stats-dens-pmf-negative-binomial.php      24-May-2024 16:04                3810
function.stats-dens-pmf-poisson.php                24-May-2024 16:04                3278
function.stats-dens-t.php                          24-May-2024 16:04                3191
function.stats-dens-uniform.php                    24-May-2024 16:04                3592
function.stats-dens-weibull.php                    24-May-2024 16:04                3624
function.stats-harmonic-mean.php                   24-May-2024 16:04                2772
function.stats-kurtosis.php                        24-May-2024 16:04                2780
function.stats-rand-gen-beta.php                   24-May-2024 16:04                3086
function.stats-rand-gen-chisquare.php              24-May-2024 16:04                2759
function.stats-rand-gen-exponential.php            24-May-2024 16:04                2757
function.stats-rand-gen-f.php                      24-May-2024 16:04                3140
function.stats-rand-gen-funiform.php               24-May-2024 16:04                3067
function.stats-rand-gen-gamma.php                  24-May-2024 16:04                3153
function.stats-rand-gen-ibinomial-negative.php     24-May-2024 16:04                3233
function.stats-rand-gen-ibinomial.php              24-May-2024 16:04                3157
function.stats-rand-gen-int.php                    24-May-2024 16:04                2332
function.stats-rand-gen-ipoisson.php               24-May-2024 16:04                2732
function.stats-rand-gen-iuniform.php               24-May-2024 16:04                3134
function.stats-rand-gen-noncentral-chisquare.php   24-May-2024 16:04                3275
function.stats-rand-gen-noncentral-f.php           24-May-2024 16:04                3628
function.stats-rand-gen-noncentral-t.php           24-May-2024 16:04                3188
function.stats-rand-gen-normal.php                 24-May-2024 16:04                3101
function.stats-rand-gen-t.php                      24-May-2024 16:04                2651
function.stats-rand-get-seeds.php                  24-May-2024 16:04                2375
function.stats-rand-phrase-to-seeds.php            24-May-2024 16:04                2740
function.stats-rand-ranf.php                       24-May-2024 16:04                2376
function.stats-rand-setall.php                     24-May-2024 16:04                3009
function.stats-skew.php                            24-May-2024 16:04                2746
function.stats-standard-deviation.php              24-May-2024 16:04                3915
function.stats-stat-binomial-coef.php              24-May-2024 16:04                3046
function.stats-stat-correlation.php                24-May-2024 16:04                3253
function.stats-stat-factorial.php                  24-May-2024 16:04                2619
function.stats-stat-independent-t.php              24-May-2024 16:04                3381
function.stats-stat-innerproduct.php               24-May-2024 16:04                3195
function.stats-stat-paired-t.php                   24-May-2024 16:04                3132
function.stats-stat-percentile.php                 24-May-2024 16:04                2998
function.stats-stat-powersum.php                   24-May-2024 16:04                2990
function.stats-variance.php                        24-May-2024 16:04                3417
function.stomp-connect-error.php                   24-May-2024 16:04                3748
function.stomp-version.php                         24-May-2024 16:04                3177
function.str-contains.php                          24-May-2024 16:04                8408
function.str-decrement.php                         24-May-2024 16:04                6566
function.str-ends-with.php                         24-May-2024 16:04                8335
function.str-getcsv.php                            24-May-2024 16:04                9279
function.str-increment.php                         24-May-2024 16:04                6253
function.str-ireplace.php                          24-May-2024 16:04                6075
function.str-pad.php                               24-May-2024 16:04                6620
function.str-repeat.php                            24-May-2024 16:04                3655
function.str-replace.php                           24-May-2024 16:04               10818
function.str-rot13.php                             24-May-2024 16:04                3436
function.str-shuffle.php                           24-May-2024 16:04                3333
function.str-split.php                             24-May-2024 16:04                7052
function.str-starts-with.php                       24-May-2024 16:04                8363
function.str-word-count.php                        24-May-2024 16:04                9104
function.strcasecmp.php                            24-May-2024 16:04                4153
function.strchr.php                                24-May-2024 16:04                1682
function.strcmp.php                                24-May-2024 16:04                5648
function.strcoll.php                               24-May-2024 16:04                4061
function.strcspn.php                               24-May-2024 16:04                3506
function.stream-bucket-append.php                  24-May-2024 16:04                2328
function.stream-bucket-make-writeable.php          24-May-2024 16:04                4455
function.stream-bucket-new.php                     24-May-2024 16:04                2360
function.stream-bucket-prepend.php                 24-May-2024 16:04                6365
function.stream-context-create.php                 24-May-2024 16:04                7834
function.stream-context-get-default.php            24-May-2024 16:04                8913
function.stream-context-get-options.php            24-May-2024 16:04                4536
function.stream-context-get-params.php             24-May-2024 16:04                5579
function.stream-context-set-default.php            24-May-2024 16:04                6268
function.stream-context-set-option.php             24-May-2024 16:04                5584
function.stream-context-set-options.php            24-May-2024 16:04                6483
function.stream-context-set-params.php             24-May-2024 16:04                4744
function.stream-copy-to-stream.php                 24-May-2024 16:04                7781
function.stream-filter-append.php                  24-May-2024 16:04               10933
function.stream-filter-prepend.php                 24-May-2024 16:04                8253
function.stream-filter-register.php                24-May-2024 16:04               18464
function.stream-filter-remove.php                  24-May-2024 16:04                6727
function.stream-get-contents.php                   24-May-2024 16:04                9135
function.stream-get-filters.php                    24-May-2024 16:04                4099
function.stream-get-line.php                       24-May-2024 16:04                5085
function.stream-get-meta-data.php                  24-May-2024 16:04               14709
function.stream-get-transports.php                 24-May-2024 16:04                4085
function.stream-get-wrappers.php                   24-May-2024 16:04                4849
function.stream-is-local.php                       24-May-2024 16:04                4323
function.stream-isatty.php                         24-May-2024 16:04                4059
function.stream-notification-callback.php          24-May-2024 16:04               22392
function.stream-register-wrapper.php               24-May-2024 16:04                1948
function.stream-resolve-include-path.php           24-May-2024 16:04                4416
function.stream-select.php                         24-May-2024 16:04               16428
function.stream-set-blocking.php                   24-May-2024 16:04                4881
function.stream-set-chunk-size.php                 24-May-2024 16:04                4344
function.stream-set-read-buffer.php                24-May-2024 16:04                3789
function.stream-set-timeout.php                    24-May-2024 16:04                8159
function.stream-set-write-buffer.php               24-May-2024 16:04                5910
function.stream-socket-accept.php                  24-May-2024 16:04                7697
function.stream-socket-client.php                  24-May-2024 16:04               17786
function.stream-socket-enable-crypto.php           24-May-2024 16:04               13436
function.stream-socket-get-name.php                24-May-2024 16:04                3949
function.stream-socket-pair.php                    24-May-2024 16:04                9930
function.stream-socket-recvfrom.php                24-May-2024 16:04               10855
function.stream-socket-sendto.php                  24-May-2024 16:04                7550
function.stream-socket-server.php                  24-May-2024 16:04               15472
function.stream-socket-shutdown.php                24-May-2024 16:04                6682
function.stream-supports-lock.php                  24-May-2024 16:04                3285
function.stream-wrapper-register.php               24-May-2024 16:04                9422
function.stream-wrapper-restore.php                24-May-2024 16:04                2986
function.stream-wrapper-unregister.php             24-May-2024 16:04                3187
function.strftime.php                              24-May-2024 16:04               10993
function.strip-tags.php                            24-May-2024 16:04                5720
function.stripcslashes.php                         24-May-2024 16:04                2397
function.stripos.php                               24-May-2024 16:04                8268
function.stripslashes.php                          24-May-2024 16:04                7346
function.stristr.php                               24-May-2024 16:04                6253
function.strlen.php                                24-May-2024 16:04                3352
function.strnatcasecmp.php                         24-May-2024 16:04                4027
function.strnatcmp.php                             24-May-2024 16:04                6592
function.strncasecmp.php                           24-May-2024 16:04                3548
function.strncmp.php                               24-May-2024 16:04                3665
function.strpbrk.php                               24-May-2024 16:04                4028
function.strpos.php                                24-May-2024 16:04                8087
function.strptime.php                              24-May-2024 16:04               11890
function.strrchr.php                               24-May-2024 16:04                5168
function.strrev.php                                24-May-2024 16:04                2619
function.strripos.php                              24-May-2024 16:04                7011
function.strrpos.php                               24-May-2024 16:04                6337
function.strspn.php                                24-May-2024 16:04                5093
function.strstr.php                                24-May-2024 16:04                5193
function.strtok.php                                24-May-2024 16:04                8747
function.strtolower.php                            24-May-2024 16:04                3938
function.strtotime.php                             24-May-2024 16:04               15523
function.strtoupper.php                            24-May-2024 16:04                3921
function.strtr.php                                 24-May-2024 16:04                6162
function.strval.php                                24-May-2024 16:04                6434
function.substr-compare.php                        24-May-2024 16:04                7622
function.substr-count.php                          24-May-2024 16:04                3679
function.substr-replace.php                        24-May-2024 16:04                8769
function.substr.php                                24-May-2024 16:04               12126
function.svn-add.php                               24-May-2024 16:04                6546
function.svn-auth-get-parameter.php                24-May-2024 16:04                4096
function.svn-auth-set-parameter.php                24-May-2024 16:04                5543
function.svn-blame.php                             24-May-2024 16:04                5040
function.svn-cat.php                               24-May-2024 16:04                4958
function.svn-checkout.php                          24-May-2024 16:04                7548
function.svn-cleanup.php                           24-May-2024 16:04                5318
function.svn-client-version.php                    24-May-2024 16:04                3618
function.svn-commit.php                            24-May-2024 16:04                8232
function.svn-delete.php                            24-May-2024 16:04                4880
function.svn-diff.php                              24-May-2024 16:04               13527
function.svn-export.php                            24-May-2024 16:04                5423
function.svn-fs-abort-txn.php                      24-May-2024 16:04                3356
function.svn-fs-apply-text.php                     24-May-2024 16:04                2915
function.svn-fs-begin-txn2.php                     24-May-2024 16:04                2858
function.svn-fs-change-node-prop.php               24-May-2024 16:04                3386
function.svn-fs-check-path.php                     24-May-2024 16:04                2960
function.svn-fs-contents-changed.php               24-May-2024 16:04                3391
function.svn-fs-copy.php                           24-May-2024 16:04                4349
function.svn-fs-delete.php                         24-May-2024 16:04                3634
function.svn-fs-dir-entries.php                    24-May-2024 16:04                2973
function.svn-fs-file-contents.php                  24-May-2024 16:04                2996
function.svn-fs-file-length.php                    24-May-2024 16:04                2919
function.svn-fs-is-dir.php                         24-May-2024 16:04                3672
function.svn-fs-is-file.php                        24-May-2024 16:04                3660
function.svn-fs-make-dir.php                       24-May-2024 16:04                3658
function.svn-fs-make-file.php                      24-May-2024 16:04                3675
function.svn-fs-node-created-rev.php               24-May-2024 16:04                2962
function.svn-fs-node-prop.php                      24-May-2024 16:04                3060
function.svn-fs-props-changed.php                  24-May-2024 16:04                3378
function.svn-fs-revision-prop.php                  24-May-2024 16:04                3073
function.svn-fs-revision-root.php                  24-May-2024 16:04                2941
function.svn-fs-txn-root.php                       24-May-2024 16:04                2706
function.svn-fs-youngest-rev.php                   24-May-2024 16:04                2748
function.svn-import.php                            24-May-2024 16:04                6208
function.svn-log.php                               24-May-2024 16:04                9223
function.svn-ls.php                                24-May-2024 16:04                7477
function.svn-mkdir.php                             24-May-2024 16:04                3339
function.svn-repos-create.php                      24-May-2024 16:04                3126
function.svn-repos-fs-begin-txn-for-commit.php     24-May-2024 16:04                3446
function.svn-repos-fs-commit-txn.php               24-May-2024 16:04                2803
function.svn-repos-fs.php                          24-May-2024 16:04                2703
function.svn-repos-hotcopy.php                     24-May-2024 16:04                3072
function.svn-repos-open.php                        24-May-2024 16:04                2675
function.svn-repos-recover.php                     24-May-2024 16:04                2719
function.svn-revert.php                            24-May-2024 16:04                3676
function.svn-status.php                            24-May-2024 16:04               14883
function.svn-update.php                            24-May-2024 16:04                6346
function.swoole-async-dns-lookup.php               24-May-2024 16:04                3918
function.swoole-async-read.php                     24-May-2024 16:04                4518
function.swoole-async-readfile.php                 24-May-2024 16:04                3941
function.swoole-async-set.php                      24-May-2024 16:04                2475
function.swoole-async-write.php                    24-May-2024 16:04                3821
function.swoole-async-writefile.php                24-May-2024 16:04                3849
function.swoole-clear-error.php                    24-May-2024 16:04                2340
function.swoole-client-select.php                  24-May-2024 16:04                3550
function.swoole-cpu-num.php                        24-May-2024 16:04                2184
function.swoole-errno.php                          24-May-2024 16:04                2161
function.swoole-error-log.php                      24-May-2024 16:04                3626
function.swoole-event-add.php                      24-May-2024 16:04                3557
function.swoole-event-defer.php                    24-May-2024 16:04                2704
function.swoole-event-del.php                      24-May-2024 16:04                2670
function.swoole-event-exit.php                     24-May-2024 16:04                2227
function.swoole-event-set.php                      24-May-2024 16:04                3545
function.swoole-event-wait.php                     24-May-2024 16:04                2198
function.swoole-event-write.php                    24-May-2024 16:04                2942
function.swoole-get-local-ip.php                   24-May-2024 16:04                2255
function.swoole-last-error.php                     24-May-2024 16:04                2210
function.swoole-load-module.php                    24-May-2024 16:04                2368
function.swoole-select.php                         24-May-2024 16:04                3517
function.swoole-set-process-name.php               24-May-2024 16:04                2690
function.swoole-strerror.php                       24-May-2024 16:04                2644
function.swoole-timer-after.php                    24-May-2024 16:04                3068
function.swoole-timer-exists.php                   24-May-2024 16:04                2481
function.swoole-timer-tick.php                     24-May-2024 16:04                2945
function.swoole-version.php                        24-May-2024 16:04                2189
function.symlink.php                               24-May-2024 16:04                3068
function.sys-get-temp-dir.php                      24-May-2024 16:03                4188
function.sys-getloadavg.php                        24-May-2024 16:04                4203
function.syslog.php                                24-May-2024 16:04                7176
function.system.php                                24-May-2024 16:04                7766
function.taint.php                                 24-May-2024 16:04                2768
function.tan.php                                   24-May-2024 16:04                3130
function.tanh.php                                  24-May-2024 16:04                2405
function.tcpwrap-check.php                         24-May-2024 16:04                5870
function.tempnam.php                               24-May-2024 16:04                6125
function.textdomain.php                            24-May-2024 16:04                3285
function.tidy-access-count.php                     24-May-2024 16:04                6447
function.tidy-config-count.php                     24-May-2024 16:04                4360
function.tidy-error-count.php                      24-May-2024 16:04                5381
function.tidy-get-output.php                       24-May-2024 16:04                4327
function.tidy-warning-count.php                    24-May-2024 16:04                4936
function.time-nanosleep.php                        24-May-2024 16:04                8639
function.time-sleep-until.php                      24-May-2024 16:04                5816
function.time.php                                  24-May-2024 16:04                2026
function.timezone-abbreviations-list.php           24-May-2024 16:04                1947
function.timezone-identifiers-list.php             24-May-2024 16:04                1963
function.timezone-location-get.php                 24-May-2024 16:04                1919
function.timezone-name-from-abbr.php               24-May-2024 16:04                6310
function.timezone-name-get.php                     24-May-2024 16:04                1863
function.timezone-offset-get.php                   24-May-2024 16:04                1861
function.timezone-open.php                         24-May-2024 16:04                1849
function.timezone-transitions-get.php              24-May-2024 16:04                1922
function.timezone-version-get.php                  24-May-2024 16:04                4417
function.tmpfile.php                               24-May-2024 16:04                4501
function.token-get-all.php                         24-May-2024 16:04               11963
function.token-name.php                            24-May-2024 16:04                4195
function.touch.php                                 24-May-2024 16:04                4013
function.trader-acos.php                           24-May-2024 16:04                2523
function.trader-ad.php                             24-May-2024 16:04                3438
function.trader-add.php                            24-May-2024 16:04                2855
function.trader-adosc.php                          24-May-2024 16:04                4298
function.trader-adx.php                            24-May-2024 16:04                3524
function.trader-adxr.php                           24-May-2024 16:04                3535
function.trader-apo.php                            24-May-2024 16:04                3724
function.trader-aroon.php                          24-May-2024 16:04                3092
function.trader-aroonosc.php                       24-May-2024 16:04                3129
function.trader-asin.php                           24-May-2024 16:04                2539
function.trader-atan.php                           24-May-2024 16:04                2532
function.trader-atr.php                            24-May-2024 16:04                3514
function.trader-avgprice.php                       24-May-2024 16:04                3495
function.trader-bbands.php                         24-May-2024 16:04                4483
function.trader-beta.php                           24-May-2024 16:04                3060
function.trader-bop.php                            24-May-2024 16:04                3444
function.trader-cci.php                            24-May-2024 16:04                3519
function.trader-cdl2crows.php                      24-May-2024 16:04                3517
function.trader-cdl3blackcrows.php                 24-May-2024 16:04                3579
function.trader-cdl3inside.php                     24-May-2024 16:04                3560
function.trader-cdl3linestrike.php                 24-May-2024 16:04                3583
function.trader-cdl3outside.php                    24-May-2024 16:04                3575
function.trader-cdl3starsinsouth.php               24-May-2024 16:04                3624
function.trader-cdl3whitesoldiers.php              24-May-2024 16:04                3648
function.trader-cdlabandonedbaby.php               24-May-2024 16:04                4036
function.trader-cdladvanceblock.php                24-May-2024 16:04                3601
function.trader-cdlbelthold.php                    24-May-2024 16:04                3557
function.trader-cdlbreakaway.php                   24-May-2024 16:04                3571
function.trader-cdlclosingmarubozu.php             24-May-2024 16:04                3642
function.trader-cdlconcealbabyswall.php            24-May-2024 16:04                3665
function.trader-cdlcounterattack.php               24-May-2024 16:04                3629
function.trader-cdldarkcloudcover.php              24-May-2024 16:04                4030
function.trader-cdldoji.php                        24-May-2024 16:04                3514
function.trader-cdldojistar.php                    24-May-2024 16:04                3549
function.trader-cdldragonflydoji.php               24-May-2024 16:04                3604
function.trader-cdlengulfing.php                   24-May-2024 16:04                3589
function.trader-cdleveningdojistar.php             24-May-2024 16:04                4047
function.trader-cdleveningstar.php                 24-May-2024 16:04                4024
function.trader-cdlgapsidesidewhite.php            24-May-2024 16:04                3672
function.trader-cdlgravestonedoji.php              24-May-2024 16:04                3625
function.trader-cdlhammer.php                      24-May-2024 16:04                3540
function.trader-cdlhangingman.php                  24-May-2024 16:04                3561
function.trader-cdlharami.php                      24-May-2024 16:04                3542
function.trader-cdlharamicross.php                 24-May-2024 16:04                3584
function.trader-cdlhighwave.php                    24-May-2024 16:04                3558
function.trader-cdlhikkake.php                     24-May-2024 16:04                3547
function.trader-cdlhikkakemod.php                  24-May-2024 16:04                3588
function.trader-cdlhomingpigeon.php                24-May-2024 16:04                3609
function.trader-cdlidentical3crows.php             24-May-2024 16:04                3633
function.trader-cdlinneck.php                      24-May-2024 16:04                3559
function.trader-cdlinvertedhammer.php              24-May-2024 16:04                3607
function.trader-cdlkicking.php                     24-May-2024 16:04                3561
function.trader-cdlkickingbylength.php             24-May-2024 16:04                3667
function.trader-cdlladderbottom.php                24-May-2024 16:04                3617
function.trader-cdllongleggeddoji.php              24-May-2024 16:04                3622
function.trader-cdllongline.php                    24-May-2024 16:04                3566
function.trader-cdlmarubozu.php                    24-May-2024 16:04                3552
function.trader-cdlmatchinglow.php                 24-May-2024 16:04                3578
function.trader-cdlmathold.php                     24-May-2024 16:04                3970
function.trader-cdlmorningdojistar.php             24-May-2024 16:04                4043
function.trader-cdlmorningstar.php                 24-May-2024 16:04                4004
function.trader-cdlonneck.php                      24-May-2024 16:04                3539
function.trader-cdlpiercing.php                    24-May-2024 16:04                3556
function.trader-cdlrickshawman.php                 24-May-2024 16:04                3596
function.trader-cdlrisefall3methods.php            24-May-2024 16:04                3666
function.trader-cdlseparatinglines.php             24-May-2024 16:04                3648
function.trader-cdlshootingstar.php                24-May-2024 16:04                3607
function.trader-cdlshortline.php                   24-May-2024 16:04                3579
function.trader-cdlspinningtop.php                 24-May-2024 16:04                3594
function.trader-cdlstalledpattern.php              24-May-2024 16:04                3629
function.trader-cdlsticksandwich.php               24-May-2024 16:04                3610
function.trader-cdltakuri.php                      24-May-2024 16:04                3581
function.trader-cdltasukigap.php                   24-May-2024 16:04                3556
function.trader-cdlthrusting.php                   24-May-2024 16:04                3565
function.trader-cdltristar.php                     24-May-2024 16:04                3553
function.trader-cdlunique3river.php                24-May-2024 16:04                3604
function.trader-cdlupsidegap2crows.php             24-May-2024 16:04                3652
function.trader-cdlxsidegap3methods.php            24-May-2024 16:04                3651
function.trader-ceil.php                           24-May-2024 16:04                2556
function.trader-cmo.php                            24-May-2024 16:04                2773
function.trader-correl.php                         24-May-2024 16:04                3112
function.trader-cos.php                            24-May-2024 16:04                2522
function.trader-cosh.php                           24-May-2024 16:04                2538
function.trader-dema.php                           24-May-2024 16:04                2784
function.trader-div.php                            24-May-2024 16:04                2871
function.trader-dx.php                             24-May-2024 16:04                3500
function.trader-ema.php                            24-May-2024 16:04                2767
function.trader-errno.php                          24-May-2024 16:04                2254
function.trader-exp.php                            24-May-2024 16:04                2566
function.trader-floor.php                          24-May-2024 16:04                2548
function.trader-get-compat.php                     24-May-2024 16:04                2444
function.trader-get-unstable-period.php            24-May-2024 16:04                2770
function.trader-ht-dcperiod.php                    24-May-2024 16:04                2536
function.trader-ht-dcphase.php                     24-May-2024 16:04                2507
function.trader-ht-phasor.php                      24-May-2024 16:04                2488
function.trader-ht-sine.php                        24-May-2024 16:04                2467
function.trader-ht-trendline.php                   24-May-2024 16:04                2528
function.trader-ht-trendmode.php                   24-May-2024 16:04                2518
function.trader-kama.php                           24-May-2024 16:04                2822
function.trader-linearreg-angle.php                24-May-2024 16:04                2916
function.trader-linearreg-intercept.php            24-May-2024 16:04                2974
function.trader-linearreg-slope.php                24-May-2024 16:04                2926
function.trader-linearreg.php                      24-May-2024 16:04                2838
function.trader-ln.php                             24-May-2024 16:04                2524
function.trader-log10.php                          24-May-2024 16:04                2528
function.trader-ma.php                             24-May-2024 16:04                3188
function.trader-macd.php                           24-May-2024 16:04                3709
function.trader-macdext.php                        24-May-2024 16:04                5202
function.trader-macdfix.php                        24-May-2024 16:04                2868
function.trader-mama.php                           24-May-2024 16:04                3209
function.trader-mavp.php                           24-May-2024 16:04                4116
function.trader-max.php                            24-May-2024 16:04                2788
function.trader-maxindex.php                       24-May-2024 16:04                2845
function.trader-medprice.php                       24-May-2024 16:04                2759
function.trader-mfi.php                            24-May-2024 16:04                3863
function.trader-midpoint.php                       24-May-2024 16:04                2819
function.trader-midprice.php                       24-May-2024 16:04                3143
function.trader-min.php                            24-May-2024 16:04                2795
function.trader-minindex.php                       24-May-2024 16:04                2840
function.trader-minmax.php                         24-May-2024 16:04                2844
function.trader-minmaxindex.php                    24-May-2024 16:04                2895
function.trader-minus-di.php                       24-May-2024 16:04                3587
function.trader-minus-dm.php                       24-May-2024 16:04                3143
function.trader-mom.php                            24-May-2024 16:04                2759
function.trader-mult.php                           24-May-2024 16:04                2871
function.trader-natr.php                           24-May-2024 16:04                3525
function.trader-obv.php                            24-May-2024 16:04                2712
function.trader-plus-di.php                        24-May-2024 16:04                3558
function.trader-plus-dm.php                        24-May-2024 16:04                3130
function.trader-ppo.php                            24-May-2024 16:04                3728
function.trader-roc.php                            24-May-2024 16:04                2783
function.trader-rocp.php                           24-May-2024 16:04                2811
function.trader-rocr.php                           24-May-2024 16:04                2796
function.trader-rocr100.php                        24-May-2024 16:04                2836
function.trader-rsi.php                            24-May-2024 16:04                2764
function.trader-sar.php                            24-May-2024 16:04                3774
function.trader-sarext.php                         24-May-2024 16:04                7186
function.trader-set-compat.php                     24-May-2024 16:04                2684
function.trader-set-unstable-period.php            24-May-2024 16:04                3272
function.trader-sin.php                            24-May-2024 16:04                2546
function.trader-sinh.php                           24-May-2024 16:04                2534
function.trader-sma.php                            24-May-2024 16:04                2764
function.trader-sqrt.php                           24-May-2024 16:04                2527
function.trader-stddev.php                         24-May-2024 16:04                3108
function.trader-stoch.php                          24-May-2024 16:04                5392
function.trader-stochf.php                         24-May-2024 16:04                4499
function.trader-stochrsi.php                       24-May-2024 16:04                4241
function.trader-sub.php                            24-May-2024 16:04                2876
function.trader-sum.php                            24-May-2024 16:04                2746
function.trader-t3.php                             24-May-2024 16:04                3125
function.trader-tan.php                            24-May-2024 16:04                2515
function.trader-tanh.php                           24-May-2024 16:04                2539
function.trader-tema.php                           24-May-2024 16:04                2790
function.trader-trange.php                         24-May-2024 16:04                3047
function.trader-trima.php                          24-May-2024 16:04                2792
function.trader-trix.php                           24-May-2024 16:04                2802
function.trader-tsf.php                            24-May-2024 16:04                2771
function.trader-typprice.php                       24-May-2024 16:04                3070
function.trader-ultosc.php                         24-May-2024 16:04                4382
function.trader-var.php                            24-May-2024 16:04                3078
function.trader-wclprice.php                       24-May-2024 16:04                3075
function.trader-willr.php                          24-May-2024 16:04                3531
function.trader-wma.php                            24-May-2024 16:04                2782
function.trait-exists.php                          24-May-2024 16:04                3117
function.trigger-error.php                         24-May-2024 16:03                4024
function.trim.php                                  24-May-2024 16:04               10127
function.uasort.php                                24-May-2024 16:04                3722
function.ucfirst.php                               24-May-2024 16:04                4341
function.ucwords.php                               24-May-2024 16:04                4590
function.ui-draw-text-font-fontfamilies.php        24-May-2024 16:04                2456
function.ui-quit.php                               24-May-2024 16:04                2094
function.ui-run.php                                24-May-2024 16:04                2470
function.uksort.php                                24-May-2024 16:04                6906
function.umask.php                                 24-May-2024 16:04                2362
function.uniqid.php                                24-May-2024 16:04                7670
function.unixtojd.php                              24-May-2024 16:04                2311
function.unlink.php                                24-May-2024 16:04                3445
function.unpack.php                                24-May-2024 16:04               10571
function.unregister-tick-function.php              24-May-2024 16:04                3220
function.unserialize.php                           24-May-2024 16:04               11598
function.unset.php                                 24-May-2024 16:04               14838
function.untaint.php                               24-May-2024 16:04                2591
function.uopz-add-function.php                     24-May-2024 16:03                7200
function.uopz-allow-exit.php                       24-May-2024 16:03                4682
function.uopz-backup.php                           24-May-2024 16:03                4626
function.uopz-compose.php                          24-May-2024 16:03                6898
function.uopz-copy.php                             24-May-2024 16:03                5213
function.uopz-del-function.php                     24-May-2024 16:03                6638
function.uopz-delete.php                           24-May-2024 16:03                6038
function.uopz-extend.php                           24-May-2024 16:03                5089
function.uopz-flags.php                            24-May-2024 16:03               11015
function.uopz-function.php                         24-May-2024 16:03                7370
function.uopz-get-exit-status.php                  24-May-2024 16:03                4233
function.uopz-get-hook.php                         24-May-2024 16:03                5388
function.uopz-get-mock.php                         24-May-2024 16:03                5006
function.uopz-get-property.php                     24-May-2024 16:03                6251
function.uopz-get-return.php                       24-May-2024 16:03                4492
function.uopz-get-static.php                       24-May-2024 16:03                5206
function.uopz-implement.php                        24-May-2024 16:03                5114
function.uopz-overload.php                         24-May-2024 16:03                3979
function.uopz-redefine.php                         24-May-2024 16:03                5199
function.uopz-rename.php                           24-May-2024 16:03                6823
function.uopz-restore.php                          24-May-2024 16:03                4993
function.uopz-set-hook.php                         24-May-2024 16:03                5722
function.uopz-set-mock.php                         24-May-2024 16:03               10877
function.uopz-set-property.php                     24-May-2024 16:03                7559
function.uopz-set-return.php                       24-May-2024 16:03                9694
function.uopz-set-static.php                       24-May-2024 16:03                5812
function.uopz-undefine.php                         24-May-2024 16:03                4757
function.uopz-unset-hook.php                       24-May-2024 16:03                5613
function.uopz-unset-mock.php                       24-May-2024 16:03                5371
function.uopz-unset-return.php                     24-May-2024 16:03                4968
function.urldecode.php                             24-May-2024 16:04                6311
function.urlencode.php                             24-May-2024 16:04                9655
function.use-soap-error-handler.php                24-May-2024 16:04                4011
function.user-error.php                            24-May-2024 16:03                1741
function.usleep.php                                24-May-2024 16:04                5582
function.usort.php                                 24-May-2024 16:04               15571
function.utf8-decode.php                           24-May-2024 16:04               18723
function.utf8-encode.php                           24-May-2024 16:04               15283
function.var-dump.php                              24-May-2024 16:04                6967
function.var-export.php                            24-May-2024 16:04               14756
function.var-representation.php                    24-May-2024 16:04               13376
function.variant-abs.php                           24-May-2024 16:04                4153
function.variant-add.php                           24-May-2024 16:04                5519
function.variant-and.php                           24-May-2024 16:04                7572
function.variant-cast.php                          24-May-2024 16:04                3578
function.variant-cat.php                           24-May-2024 16:04                4700
function.variant-cmp.php                           24-May-2024 16:04                7983
function.variant-date-from-timestamp.php           24-May-2024 16:04                3713
function.variant-date-to-timestamp.php             24-May-2024 16:04                3867
function.variant-div.php                           24-May-2024 16:04                6391
function.variant-eqv.php                           24-May-2024 16:04                4418
function.variant-fix.php                           24-May-2024 16:04                5512
function.variant-get-type.php                      24-May-2024 16:04                3568
function.variant-idiv.php                          24-May-2024 16:04                5757
function.variant-imp.php                           24-May-2024 16:04                7119
function.variant-int.php                           24-May-2024 16:04                5012
function.variant-mod.php                           24-May-2024 16:04                4760
function.variant-mul.php                           24-May-2024 16:04                5872
function.variant-neg.php                           24-May-2024 16:04                3820
function.variant-not.php                           24-May-2024 16:04                4086
function.variant-or.php                            24-May-2024 16:04                7728
function.variant-pow.php                           24-May-2024 16:04                4607
function.variant-round.php                         24-May-2024 16:04                4490
function.variant-set-type.php                      24-May-2024 16:04                3717
function.variant-set.php                           24-May-2024 16:04                2946
function.variant-sub.php                           24-May-2024 16:04                5442
function.variant-xor.php                           24-May-2024 16:04                6467
function.version-compare.php                       24-May-2024 16:03                6466
function.vfprintf.php                              24-May-2024 16:04                5056
function.virtual.php                               24-May-2024 16:04                5430
function.vprintf.php                               24-May-2024 16:04                2973
function.vsprintf.php                              24-May-2024 16:04                2794
function.wddx-add-vars.php                         24-May-2024 16:04                3825
function.wddx-deserialize.php                      24-May-2024 16:04                3571
function.wddx-packet-end.php                       24-May-2024 16:04                2886
function.wddx-packet-start.php                     24-May-2024 16:04                3065
function.wddx-serialize-value.php                  24-May-2024 16:04                3295
function.wddx-serialize-vars.php                   24-May-2024 16:04                6025
function.win32-continue-service.php                24-May-2024 16:04                6776
function.win32-create-service.php                  24-May-2024 16:04               28864
function.win32-delete-service.php                  24-May-2024 16:04                7234
function.win32-get-last-control-message.php        24-May-2024 16:04                8611
function.win32-pause-service.php                   24-May-2024 16:04                6775
function.win32-query-service-status.php            24-May-2024 16:04                8851
function.win32-send-custom-control.php             24-May-2024 16:04                7439
function.win32-set-service-exit-code.php           24-May-2024 16:04                5932
function.win32-set-service-exit-mode.php           24-May-2024 16:04                6080
function.win32-set-service-status.php              24-May-2024 16:04                9380
function.win32-start-service-ctrl-dispatcher.php   24-May-2024 16:04               11412
function.win32-start-service.php                   24-May-2024 16:04                6779
function.win32-stop-service.php                    24-May-2024 16:04                6701
function.wincache-fcache-fileinfo.php              24-May-2024 16:03                9329
function.wincache-fcache-meminfo.php               24-May-2024 16:03                7157
function.wincache-lock.php                         24-May-2024 16:03                8593
function.wincache-ocache-fileinfo.php              24-May-2024 16:03                9991
function.wincache-ocache-meminfo.php               24-May-2024 16:03                7343
function.wincache-refresh-if-changed.php           24-May-2024 16:03                7896
function.wincache-rplist-fileinfo.php              24-May-2024 16:03                7697
function.wincache-rplist-meminfo.php               24-May-2024 16:03                7272
function.wincache-scache-info.php                  24-May-2024 16:03                9615
function.wincache-scache-meminfo.php               24-May-2024 16:03                6759
function.wincache-ucache-add.php                   24-May-2024 16:03               13642
function.wincache-ucache-cas.php                   24-May-2024 16:03                6583
function.wincache-ucache-clear.php                 24-May-2024 16:03                7661
function.wincache-ucache-dec.php                   24-May-2024 16:03                6490
function.wincache-ucache-delete.php                24-May-2024 16:03               11479
function.wincache-ucache-exists.php                24-May-2024 16:03                6244
function.wincache-ucache-get.php                   24-May-2024 16:03               10645
function.wincache-ucache-inc.php                   24-May-2024 16:03                6482
function.wincache-ucache-info.php                  24-May-2024 16:03               11436
function.wincache-ucache-meminfo.php               24-May-2024 16:03                6948
function.wincache-ucache-set.php                   24-May-2024 16:03               13708
function.wincache-unlock.php                       24-May-2024 16:03                7855
function.wordwrap.php                              24-May-2024 16:04                6858
function.xattr-get.php                             24-May-2024 16:04                6120
function.xattr-list.php                            24-May-2024 16:04                6572
function.xattr-remove.php                          24-May-2024 16:04                6376
function.xattr-set.php                             24-May-2024 16:04                8121
function.xattr-supported.php                       24-May-2024 16:04                5386
function.xdiff-file-bdiff-size.php                 24-May-2024 16:04                4896
function.xdiff-file-bdiff.php                      24-May-2024 16:04                6015
function.xdiff-file-bpatch.php                     24-May-2024 16:04                6572
function.xdiff-file-diff-binary.php                24-May-2024 16:04                6437
function.xdiff-file-diff.php                       24-May-2024 16:04                7452
function.xdiff-file-merge3.php                     24-May-2024 16:04                6859
function.xdiff-file-patch-binary.php               24-May-2024 16:04                6725
function.xdiff-file-patch.php                      24-May-2024 16:04                8967
function.xdiff-file-rabdiff.php                    24-May-2024 16:04                6571
function.xdiff-string-bdiff-size.php               24-May-2024 16:04                5212
function.xdiff-string-bdiff.php                    24-May-2024 16:04                3915
function.xdiff-string-bpatch.php                   24-May-2024 16:04                4013
function.xdiff-string-diff-binary.php              24-May-2024 16:04                4405
function.xdiff-string-diff.php                     24-May-2024 16:04                7682
function.xdiff-string-merge3.php                   24-May-2024 16:04                4862
function.xdiff-string-patch-binary.php             24-May-2024 16:04                4547
function.xdiff-string-patch.php                    24-May-2024 16:04                8333
function.xdiff-string-rabdiff.php                  24-May-2024 16:04                4522
function.xhprof-disable.php                        24-May-2024 16:03                4038
function.xhprof-enable.php                         24-May-2024 16:03                7203
function.xhprof-sample-disable.php                 24-May-2024 16:03                4721
function.xhprof-sample-enable.php                  24-May-2024 16:03                3562
function.xml-error-string.php                      24-May-2024 16:04                3340
function.xml-get-current-byte-index.php            24-May-2024 16:04                4123
function.xml-get-current-column-number.php         24-May-2024 16:04                3887
function.xml-get-current-line-number.php           24-May-2024 16:04                3709
function.xml-get-error-code.php                    24-May-2024 16:04                3388
function.xml-parse-into-struct.php                 24-May-2024 16:04               18970
function.xml-parse.php                             24-May-2024 16:04                5063
function.xml-parser-create-ns.php                  24-May-2024 16:04                4703
function.xml-parser-create.php                     24-May-2024 16:04                4226
function.xml-parser-free.php                       24-May-2024 16:04                2896
function.xml-parser-get-option.php                 24-May-2024 16:04                3834
function.xml-parser-set-option.php                 24-May-2024 16:04                5993
function.xml-set-character-data-handler.php        24-May-2024 16:04                5575
function.xml-set-default-handler.php               24-May-2024 16:04                5457
function.xml-set-element-handler.php               24-May-2024 16:04                8477
function.xml-set-end-namespace-decl-handler.php    24-May-2024 16:04                6871
function.xml-set-external-entity-ref-handler.php   24-May-2024 16:04                8083
function.xml-set-notation-decl-handler.php         24-May-2024 16:04                7612
function.xml-set-object.php                        24-May-2024 16:04                8761
function.xml-set-processing-instruction-handler..> 24-May-2024 16:04                6703
function.xml-set-start-namespace-decl-handler.php  24-May-2024 16:04                7061
function.xml-set-unparsed-entity-decl-handler.php  24-May-2024 16:04                8271
function.xmlrpc-decode-request.php                 24-May-2024 16:04                2914
function.xmlrpc-decode.php                         24-May-2024 16:04                4232
function.xmlrpc-encode-request.php                 24-May-2024 16:04                8697
function.xmlrpc-encode.php                         24-May-2024 16:04                2488
function.xmlrpc-get-type.php                       24-May-2024 16:04                6451
function.xmlrpc-is-fault.php                       24-May-2024 16:04                4075
function.xmlrpc-parse-method-descriptions.php      24-May-2024 16:04                2693
function.xmlrpc-server-add-introspection-data.php  24-May-2024 16:04                2889
function.xmlrpc-server-call-method.php             24-May-2024 16:04                3304
function.xmlrpc-server-create.php                  24-May-2024 16:04                2403
function.xmlrpc-server-destroy.php                 24-May-2024 16:04                2620
function.xmlrpc-server-register-introspection-c..> 24-May-2024 16:04                2975
function.xmlrpc-server-register-method.php         24-May-2024 16:04                3055
function.xmlrpc-set-type.php                       24-May-2024 16:04                5648
function.yaml-emit-file.php                        24-May-2024 16:04                6793
function.yaml-emit.php                             24-May-2024 16:04               12383
function.yaml-parse-file.php                       24-May-2024 16:04                6115
function.yaml-parse-url.php                        24-May-2024 16:04                6440
function.yaml-parse.php                            24-May-2024 16:04                9971
function.yaz-addinfo.php                           24-May-2024 16:04                3446
function.yaz-ccl-conf.php                          24-May-2024 16:04                5746
function.yaz-ccl-parse.php                         24-May-2024 16:04                6805
function.yaz-close.php                             24-May-2024 16:04                3611
function.yaz-connect.php                           24-May-2024 16:04                9166
function.yaz-database.php                          24-May-2024 16:04                3494
function.yaz-element.php                           24-May-2024 16:04                3926
function.yaz-errno.php                             24-May-2024 16:04                3682
function.yaz-error.php                             24-May-2024 16:04                3437
function.yaz-es-result.php                         24-May-2024 16:04                3355
function.yaz-es.php                                24-May-2024 16:04                7204
function.yaz-get-option.php                        24-May-2024 16:04                3432
function.yaz-hits.php                              24-May-2024 16:04                4915
function.yaz-itemorder.php                         24-May-2024 16:04                7111
function.yaz-present.php                           24-May-2024 16:04                3070
function.yaz-range.php                             24-May-2024 16:04                3672
function.yaz-record.php                            24-May-2024 16:04               14267
function.yaz-scan-result.php                       24-May-2024 16:04                4066
function.yaz-scan.php                              24-May-2024 16:04                9405
function.yaz-schema.php                            24-May-2024 16:04                3508
function.yaz-search.php                            24-May-2024 16:04                8752
function.yaz-set-option.php                        24-May-2024 16:04                7071
function.yaz-sort.php                              24-May-2024 16:04                5629
function.yaz-syntax.php                            24-May-2024 16:04                3466
function.yaz-wait.php                              24-May-2024 16:04                4207
function.zend-thread-id.php                        24-May-2024 16:03                3784
function.zend-version.php                          24-May-2024 16:03                3069
function.zip-close.php                             24-May-2024 16:03                3088
function.zip-entry-close.php                       24-May-2024 16:03                3441
function.zip-entry-compressedsize.php              24-May-2024 16:03                3364
function.zip-entry-compressionmethod.php           24-May-2024 16:03                3455
function.zip-entry-filesize.php                    24-May-2024 16:03                3310
function.zip-entry-name.php                        24-May-2024 16:03                3245
function.zip-entry-open.php                        24-May-2024 16:03                5134
function.zip-entry-read.php                        24-May-2024 16:03                4122
function.zip-open.php                              24-May-2024 16:03                3365
function.zip-read.php                              24-May-2024 16:03                3726
function.zlib-decode.php                           24-May-2024 16:03                3508
function.zlib-encode.php                           24-May-2024 16:03                5433
function.zlib-get-coding-type.php                  24-May-2024 16:03                2947
function.zookeeper-dispatch.php                    24-May-2024 16:04                8369
functional.parallel.php                            24-May-2024 16:04                2614
functions.anonymous.php                            24-May-2024 16:03               24379
functions.arguments.php                            24-May-2024 16:03               37932
functions.arrow.php                                24-May-2024 16:03               10275
functions.first_class_callable_syntax.php          24-May-2024 16:03               11385
functions.internal.php                             24-May-2024 16:03                5287
functions.returning-values.php                     24-May-2024 16:03                6387
functions.user-defined.php                         24-May-2024 16:03                9580
functions.variable-functions.php                   24-May-2024 16:03               11518
gearman.configuration.php                          24-May-2024 16:04                1307
gearman.constants.php                              24-May-2024 16:04               23876
gearman.examples-reverse-bg.php                    24-May-2024 16:04               10719
gearman.examples-reverse-task.php                  24-May-2024 16:04               17368
gearman.examples-reverse.php                       24-May-2024 16:04               12792
gearman.examples.php                               24-May-2024 16:04                1628
gearman.installation.php                           24-May-2024 16:04                1664
gearman.requirements.php                           24-May-2024 16:04                1538
gearman.resources.php                              24-May-2024 16:04                1276
gearman.setup.php                                  24-May-2024 16:04                1651
gearmanclient.addoptions.php                       24-May-2024 16:04                3383
gearmanclient.addserver.php                        24-May-2024 16:04                5521
gearmanclient.addservers.php                       24-May-2024 16:04                4963
gearmanclient.addtask.php                          24-May-2024 16:04               15164
gearmanclient.addtaskbackground.php                24-May-2024 16:04               20922
gearmanclient.addtaskhigh.php                      24-May-2024 16:04               11670
gearmanclient.addtaskhighbackground.php            24-May-2024 16:04                6584
gearmanclient.addtasklow.php                       24-May-2024 16:04               11652
gearmanclient.addtasklowbackground.php             24-May-2024 16:04                6577
gearmanclient.addtaskstatus.php                    24-May-2024 16:04                9860
gearmanclient.clearcallbacks.php                   24-May-2024 16:04                4401
gearmanclient.clone.php                            24-May-2024 16:04                2697
gearmanclient.construct.php                        24-May-2024 16:04                2875
gearmanclient.context.php                          24-May-2024 16:04                2943
gearmanclient.data.php                             24-May-2024 16:04                3208
gearmanclient.do.php                               24-May-2024 16:04               22189
gearmanclient.dobackground.php                     24-May-2024 16:04                9677
gearmanclient.dohigh.php                           24-May-2024 16:04                5134
gearmanclient.dohighbackground.php                 24-May-2024 16:04                4961
gearmanclient.dojobhandle.php                      24-May-2024 16:04                3000
gearmanclient.dolow.php                            24-May-2024 16:04                5120
gearmanclient.dolowbackground.php                  24-May-2024 16:04                4943
gearmanclient.donormal.php                         24-May-2024 16:04               22757
gearmanclient.dostatus.php                         24-May-2024 16:04                8178
gearmanclient.echo.php                             24-May-2024 16:04                3039
gearmanclient.error.php                            24-May-2024 16:04                2935
gearmanclient.geterrno.php                         24-May-2024 16:04                2710
gearmanclient.jobstatus.php                        24-May-2024 16:04                8370
gearmanclient.ping.php                             24-May-2024 16:04                3012
gearmanclient.removeoptions.php                    24-May-2024 16:04                2731
gearmanclient.returncode.php                       24-May-2024 16:04                2353
gearmanclient.runtasks.php                         24-May-2024 16:04                3770
gearmanclient.setclientcallback.php                24-May-2024 16:04                5415
gearmanclient.setcompletecallback.php              24-May-2024 16:04                5301
gearmanclient.setcontext.php                       24-May-2024 16:04                3276
gearmanclient.setcreatedcallback.php               24-May-2024 16:04                4840
gearmanclient.setdata.php                          24-May-2024 16:04                3474
gearmanclient.setdatacallback.php                  24-May-2024 16:04                4825
gearmanclient.setexceptioncallback.php             24-May-2024 16:04                4745
gearmanclient.setfailcallback.php                  24-May-2024 16:04                4831
gearmanclient.setoptions.php                       24-May-2024 16:04                2717
gearmanclient.setstatuscallback.php                24-May-2024 16:04                4831
gearmanclient.settimeout.php                       24-May-2024 16:04                2761
gearmanclient.setwarningcallback.php               24-May-2024 16:04                4834
gearmanclient.setworkloadcallback.php              24-May-2024 16:04                4988
gearmanclient.timeout.php                          24-May-2024 16:04                2805
gearmanclient.wait.php                             24-May-2024 16:04                2852
gearmanjob.complete.php                            24-May-2024 16:04                3638
gearmanjob.construct.php                           24-May-2024 16:04                2387
gearmanjob.data.php                                24-May-2024 16:04                3598
gearmanjob.exception.php                           24-May-2024 16:04                3805
gearmanjob.fail.php                                24-May-2024 16:04                3731
gearmanjob.functionname.php                        24-May-2024 16:04                2981
gearmanjob.handle.php                              24-May-2024 16:04                2868
gearmanjob.returncode.php                          24-May-2024 16:04                2665
gearmanjob.sendcomplete.php                        24-May-2024 16:04                3359
gearmanjob.senddata.php                            24-May-2024 16:04                3326
gearmanjob.sendexception.php                       24-May-2024 16:04                3539
gearmanjob.sendfail.php                            24-May-2024 16:04                3450
gearmanjob.sendstatus.php                          24-May-2024 16:04                4054
gearmanjob.sendwarning.php                         24-May-2024 16:04                3535
gearmanjob.setreturn.php                           24-May-2024 16:04                2603
gearmanjob.status.php                              24-May-2024 16:04                4335
gearmanjob.unique.php                              24-May-2024 16:04                3105
gearmanjob.warning.php                             24-May-2024 16:04                3816
gearmanjob.workload.php                            24-May-2024 16:04                2863
gearmanjob.workloadsize.php                        24-May-2024 16:04                2681
gearmantask.construct.php                          24-May-2024 16:04                2412
gearmantask.create.php                             24-May-2024 16:04                2846
gearmantask.data.php                               24-May-2024 16:04                2842
gearmantask.datasize.php                           24-May-2024 16:04                2865
gearmantask.function.php                           24-May-2024 16:04                2697
gearmantask.functionname.php                       24-May-2024 16:04                2634
gearmantask.isknown.php                            24-May-2024 16:04                2510
gearmantask.isrunning.php                          24-May-2024 16:04                2510
gearmantask.jobhandle.php                          24-May-2024 16:04                3014
gearmantask.recvdata.php                           24-May-2024 16:04                3613
gearmantask.returncode.php                         24-May-2024 16:04                2692
gearmantask.senddata.php                           24-May-2024 16:04                3426
gearmantask.sendworkload.php                       24-May-2024 16:04                3575
gearmantask.taskdenominator.php                    24-May-2024 16:04                3058
gearmantask.tasknumerator.php                      24-May-2024 16:04                3030
gearmantask.unique.php                             24-May-2024 16:04                3275
gearmantask.uuid.php                               24-May-2024 16:04                3448
gearmanworker.addfunction.php                      24-May-2024 16:04                7949
gearmanworker.addoptions.php                       24-May-2024 16:04                3434
gearmanworker.addserver.php                        24-May-2024 16:04                5248
gearmanworker.addservers.php                       24-May-2024 16:04                4685
gearmanworker.clone.php                            24-May-2024 16:04                2368
gearmanworker.construct.php                        24-May-2024 16:04                2848
gearmanworker.echo.php                             24-May-2024 16:04                3070
gearmanworker.error.php                            24-May-2024 16:04                2902
gearmanworker.geterrno.php                         24-May-2024 16:04                2677
gearmanworker.options.php                          24-May-2024 16:04                2684
gearmanworker.register.php                         24-May-2024 16:04                3827
gearmanworker.removeoptions.php                    24-May-2024 16:04                3456
gearmanworker.returncode.php                       24-May-2024 16:04                2872
gearmanworker.setid.php                            24-May-2024 16:04                4139
gearmanworker.setoptions.php                       24-May-2024 16:04                3589
gearmanworker.settimeout.php                       24-May-2024 16:04                7834
gearmanworker.timeout.php                          24-May-2024 16:04                2784
gearmanworker.unregister.php                       24-May-2024 16:04                3391
gearmanworker.unregisterall.php                    24-May-2024 16:04                3048
gearmanworker.wait.php                             24-May-2024 16:04                7927
gearmanworker.work.php                             24-May-2024 16:04                5629
gender-gender.connect.php                          24-May-2024 16:04                2601
gender-gender.construct.php                        24-May-2024 16:04                2452
gender-gender.country.php                          24-May-2024 16:04                3853
gender-gender.get.php                              24-May-2024 16:04                2917
gender-gender.isnick.php                           24-May-2024 16:04                3530
gender-gender.similarnames.php                     24-May-2024 16:04                3030
gender.example.admin.php                           24-May-2024 16:04                8097
gender.examples.php                                24-May-2024 16:04                1406
gender.installation.php                            24-May-2024 16:04                2057
gender.setup.php                                   24-May-2024 16:04                1437
generator.current.php                              24-May-2024 16:03                2153
generator.getreturn.php                            24-May-2024 16:03                3878
generator.key.php                                  24-May-2024 16:03                3944
generator.next.php                                 24-May-2024 16:03                2491
generator.rewind.php                               24-May-2024 16:03                2243
generator.send.php                                 24-May-2024 16:03                5572
generator.throw.php                                24-May-2024 16:03                5142
generator.valid.php                                24-May-2024 16:03                2359
generator.wakeup.php                               24-May-2024 16:03                2236
geoip.configuration.php                            24-May-2024 16:04                2525
geoip.constants.php                                24-May-2024 16:04                6327
geoip.installation.php                             24-May-2024 16:04                1798
geoip.requirements.php                             24-May-2024 16:04                1741
geoip.resources.php                                24-May-2024 16:04                1232
geoip.setup.php                                    24-May-2024 16:04                1612
gettext.configuration.php                          24-May-2024 16:04                1307
gettext.constants.php                              24-May-2024 16:04                1207
gettext.installation.php                           24-May-2024 16:04                1426
gettext.requirements.php                           24-May-2024 16:04                1415
gettext.resources.php                              24-May-2024 16:04                1246
gettext.setup.php                                  24-May-2024 16:04                1655
getting-started.php                                24-May-2024 16:03                2065
globiterator.construct.php                         24-May-2024 16:04                7732
globiterator.count.php                             24-May-2024 16:04                4491
gmagick.addimage.php                               24-May-2024 16:04                2894
gmagick.addnoiseimage.php                          24-May-2024 16:04                2949
gmagick.annotateimage.php                          24-May-2024 16:04                4484
gmagick.blurimage.php                              24-May-2024 16:04                3345
gmagick.borderimage.php                            24-May-2024 16:04                3794
gmagick.charcoalimage.php                          24-May-2024 16:04                3295
gmagick.chopimage.php                              24-May-2024 16:04                3947
gmagick.clear.php                                  24-May-2024 16:04                2643
gmagick.commentimage.php                           24-May-2024 16:04                2896
gmagick.compositeimage.php                         24-May-2024 16:04                4110
gmagick.configuration.php                          24-May-2024 16:04                1312
gmagick.constants.php                              24-May-2024 16:04              103189
gmagick.construct.php                              24-May-2024 16:04                2650
gmagick.cropimage.php                              24-May-2024 16:04                4082
gmagick.cropthumbnailimage.php                     24-May-2024 16:04                3332
gmagick.current.php                                24-May-2024 16:04                2544
gmagick.cyclecolormapimage.php                     24-May-2024 16:04                3022
gmagick.deconstructimages.php                      24-May-2024 16:04                2792
gmagick.despeckleimage.php                         24-May-2024 16:04                3485
gmagick.destroy.php                                24-May-2024 16:04                2784
gmagick.drawimage.php                              24-May-2024 16:04                3018
gmagick.edgeimage.php                              24-May-2024 16:04                2965
gmagick.embossimage.php                            24-May-2024 16:04                3473
gmagick.enhanceimage.php                           24-May-2024 16:04                2654
gmagick.equalizeimage.php                          24-May-2024 16:04                2613
gmagick.examples.php                               24-May-2024 16:04                3435
gmagick.flipimage.php                              24-May-2024 16:04                2952
gmagick.flopimage.php                              24-May-2024 16:04                2949
gmagick.frameimage.php                             24-May-2024 16:04                4619
gmagick.gammaimage.php                             24-May-2024 16:04                3176
gmagick.getcopyright.php                           24-May-2024 16:04                2635
gmagick.getfilename.php                            24-May-2024 16:04                2585
gmagick.getimagebackgroundcolor.php                24-May-2024 16:04                2722
gmagick.getimageblueprimary.php                    24-May-2024 16:04                3024
gmagick.getimagebordercolor.php                    24-May-2024 16:04                2766
gmagick.getimagechanneldepth.php                   24-May-2024 16:04                2827
gmagick.getimagecolors.php                         24-May-2024 16:04                2621
gmagick.getimagecolorspace.php                     24-May-2024 16:04                2579
gmagick.getimagecompose.php                        24-May-2024 16:04                2659
gmagick.getimagedelay.php                          24-May-2024 16:04                2556
gmagick.getimagedepth.php                          24-May-2024 16:04                2526
gmagick.getimagedispose.php                        24-May-2024 16:04                2580
gmagick.getimageextrema.php                        24-May-2024 16:04                2786
gmagick.getimagefilename.php                       24-May-2024 16:04                2664
gmagick.getimageformat.php                         24-May-2024 16:04                2647
gmagick.getimagegamma.php                          24-May-2024 16:04                2547
gmagick.getimagegreenprimary.php                   24-May-2024 16:04                2766
gmagick.getimageheight.php                         24-May-2024 16:04                2578
gmagick.getimagehistogram.php                      24-May-2024 16:04                2939
gmagick.getimageindex.php                          24-May-2024 16:04                2709
gmagick.getimageinterlacescheme.php                24-May-2024 16:04                2697
gmagick.getimageiterations.php                     24-May-2024 16:04                2624
gmagick.getimagematte.php                          24-May-2024 16:04                2964
gmagick.getimagemattecolor.php                     24-May-2024 16:04                2672
gmagick.getimageprofile.php                        24-May-2024 16:04                2779
gmagick.getimageredprimary.php                     24-May-2024 16:04                2787
gmagick.getimagerenderingintent.php                24-May-2024 16:04                2708
gmagick.getimageresolution.php                     24-May-2024 16:04                2640
gmagick.getimagescene.php                          24-May-2024 16:04                2543
gmagick.getimagesignature.php                      24-May-2024 16:04                2658
gmagick.getimagetype.php                           24-May-2024 16:04                2550
gmagick.getimageunits.php                          24-May-2024 16:04                2318
gmagick.getimagewhitepoint.php                     24-May-2024 16:04                2763
gmagick.getimagewidth.php                          24-May-2024 16:04                2557
gmagick.getpackagename.php                         24-May-2024 16:04                2611
gmagick.getquantumdepth.php                        24-May-2024 16:04                2788
gmagick.getreleasedate.php                         24-May-2024 16:04                2645
gmagick.getsamplingfactors.php                     24-May-2024 16:04                2698
gmagick.getsize.php                                24-May-2024 16:04                2847
gmagick.getversion.php                             24-May-2024 16:04                2588
gmagick.hasnextimage.php                           24-May-2024 16:04                2945
gmagick.haspreviousimage.php                       24-May-2024 16:04                2989
gmagick.implodeimage.php                           24-May-2024 16:04                3005
gmagick.installation.php                           24-May-2024 16:04                2019
gmagick.labelimage.php                             24-May-2024 16:04                2774
gmagick.levelimage.php                             24-May-2024 16:04                4725
gmagick.magnifyimage.php                           24-May-2024 16:04                2639
gmagick.mapimage.php                               24-May-2024 16:04                3310
gmagick.medianfilterimage.php                      24-May-2024 16:04                3094
gmagick.minifyimage.php                            24-May-2024 16:04                2673
gmagick.modulateimage.php                          24-May-2024 16:04                3923
gmagick.motionblurimage.php                        24-May-2024 16:04                3948
gmagick.newimage.php                               24-May-2024 16:04                3970
gmagick.nextimage.php                              24-May-2024 16:04                2805
gmagick.normalizeimage.php                         24-May-2024 16:04                3050
gmagick.oilpaintimage.php                          24-May-2024 16:04                3066
gmagick.previousimage.php                          24-May-2024 16:04                2800
gmagick.profileimage.php                           24-May-2024 16:04                3624
gmagick.quantizeimage.php                          24-May-2024 16:04                5393
gmagick.quantizeimages.php                         24-May-2024 16:04                5396
gmagick.queryfontmetrics.php                       24-May-2024 16:04                2966
gmagick.queryfonts.php                             24-May-2024 16:04                2742
gmagick.queryformats.php                           24-May-2024 16:04                3144
gmagick.radialblurimage.php                        24-May-2024 16:04                3270
gmagick.raiseimage.php                             24-May-2024 16:04                4461
gmagick.read.php                                   24-May-2024 16:04                2789
gmagick.readimage.php                              24-May-2024 16:04                2839
gmagick.readimageblob.php                          24-May-2024 16:04                3262
gmagick.readimagefile.php                          24-May-2024 16:04                3139
gmagick.reducenoiseimage.php                       24-May-2024 16:04                3244
gmagick.removeimage.php                            24-May-2024 16:04                2621
gmagick.removeimageprofile.php                     24-May-2024 16:04                2951
gmagick.requirements.php                           24-May-2024 16:04                1701
gmagick.resampleimage.php                          24-May-2024 16:04                3973
gmagick.resizeimage.php                            24-May-2024 16:04                4310
gmagick.rollimage.php                              24-May-2024 16:04                3049
gmagick.rotateimage.php                            24-May-2024 16:04                3224
gmagick.scaleimage.php                             24-May-2024 16:04                3592
gmagick.separateimagechannel.php                   24-May-2024 16:04                3236
gmagick.setcompressionquality.php                  24-May-2024 16:04                4241
gmagick.setfilename.php                            24-May-2024 16:04                2969
gmagick.setimagebackgroundcolor.php                24-May-2024 16:04                3038
gmagick.setimageblueprimary.php                    24-May-2024 16:04                3332
gmagick.setimagebordercolor.php                    24-May-2024 16:04                3000
gmagick.setimagechanneldepth.php                   24-May-2024 16:04                3479
gmagick.setimagecolorspace.php                     24-May-2024 16:04                3121
gmagick.setimagecompose.php                        24-May-2024 16:04                2887
gmagick.setimagedelay.php                          24-May-2024 16:04                2901
gmagick.setimagedepth.php                          24-May-2024 16:04                2899
gmagick.setimagedispose.php                        24-May-2024 16:04                2943
gmagick.setimagefilename.php                       24-May-2024 16:04                2993
gmagick.setimageformat.php                         24-May-2024 16:04                2956
gmagick.setimagegamma.php                          24-May-2024 16:04                2893
gmagick.setimagegreenprimary.php                   24-May-2024 16:04                3340
gmagick.setimageindex.php                          24-May-2024 16:04                3040
gmagick.setimageinterlacescheme.php                24-May-2024 16:04                3187
gmagick.setimageiterations.php                     24-May-2024 16:04                2996
gmagick.setimageprofile.php                        24-May-2024 16:04                3429
gmagick.setimageredprimary.php                     24-May-2024 16:04                3243
gmagick.setimagerenderingintent.php                24-May-2024 16:04                3218
gmagick.setimageresolution.php                     24-May-2024 16:04                3237
gmagick.setimagescene.php                          24-May-2024 16:04                2889
gmagick.setimagetype.php                           24-May-2024 16:04                3014
gmagick.setimageunits.php                          24-May-2024 16:04                3073
gmagick.setimagewhitepoint.php                     24-May-2024 16:04                3269
gmagick.setsamplingfactors.php                     24-May-2024 16:04                3115
gmagick.setsize.php                                24-May-2024 16:04                3585
gmagick.setup.php                                  24-May-2024 16:04                1578
gmagick.shearimage.php                             24-May-2024 16:04                3967
gmagick.solarizeimage.php                          24-May-2024 16:04                3147
gmagick.spreadimage.php                            24-May-2024 16:04                2991
gmagick.stripimage.php                             24-May-2024 16:04                2601
gmagick.swirlimage.php                             24-May-2024 16:04                3072
gmagick.thumbnailimage.php                         24-May-2024 16:04                3903
gmagick.trimimage.php                              24-May-2024 16:04                3136
gmagick.write.php                                  24-May-2024 16:04                1752
gmagick.writeimage.php                             24-May-2024 16:04                3548
gmagickdraw.annotate.php                           24-May-2024 16:04                3231
gmagickdraw.arc.php                                24-May-2024 16:04                4391
gmagickdraw.bezier.php                             24-May-2024 16:04                2670
gmagickdraw.ellipse.php                            24-May-2024 16:04                4312
gmagickdraw.getfillcolor.php                       24-May-2024 16:04                2488
gmagickdraw.getfillopacity.php                     24-May-2024 16:04                2439
gmagickdraw.getfont.php                            24-May-2024 16:04                2430
gmagickdraw.getfontsize.php                        24-May-2024 16:04                2481
gmagickdraw.getfontstyle.php                       24-May-2024 16:04                2557
gmagickdraw.getfontweight.php                      24-May-2024 16:04                2402
gmagickdraw.getstrokecolor.php                     24-May-2024 16:04                2543
gmagickdraw.getstrokeopacity.php                   24-May-2024 16:04                2516
gmagickdraw.getstrokewidth.php                     24-May-2024 16:04                2535
gmagickdraw.gettextdecoration.php                  24-May-2024 16:04                2469
gmagickdraw.gettextencoding.php                    24-May-2024 16:04                2558
gmagickdraw.line.php                               24-May-2024 16:04                3675
gmagickdraw.point.php                              24-May-2024 16:04                2962
gmagickdraw.polygon.php                            24-May-2024 16:04                2737
gmagickdraw.polyline.php                           24-May-2024 16:04                2772
gmagickdraw.rectangle.php                          24-May-2024 16:04                3779
gmagickdraw.rotate.php                             24-May-2024 16:04                2728
gmagickdraw.roundrectangle.php                     24-May-2024 16:04                4556
gmagickdraw.scale.php                              24-May-2024 16:04                3026
gmagickdraw.setfillcolor.php                       24-May-2024 16:04                2988
gmagickdraw.setfillopacity.php                     24-May-2024 16:04                2826
gmagickdraw.setfont.php                            24-May-2024 16:04                2726
gmagickdraw.setfontsize.php                        24-May-2024 16:04                2756
gmagickdraw.setfontstyle.php                       24-May-2024 16:04                2887
gmagickdraw.setfontweight.php                      24-May-2024 16:04                2758
gmagickdraw.setstrokecolor.php                     24-May-2024 16:04                3012
gmagickdraw.setstrokeopacity.php                   24-May-2024 16:04                2844
gmagickdraw.setstrokewidth.php                     24-May-2024 16:04                2804
gmagickdraw.settextdecoration.php                  24-May-2024 16:04                2890
gmagickdraw.settextencoding.php                    24-May-2024 16:04                3098
gmagickpixel.construct.php                         24-May-2024 16:04                2598
gmagickpixel.getcolor.php                          24-May-2024 16:04                4390
gmagickpixel.getcolorcount.php                     24-May-2024 16:04                2530
gmagickpixel.getcolorvalue.php                     24-May-2024 16:04                2934
gmagickpixel.setcolor.php                          24-May-2024 16:04                3065
gmagickpixel.setcolorvalue.php                     24-May-2024 16:04                3344
gmp.configuration.php                              24-May-2024 16:04                1279
gmp.constants.php                                  24-May-2024 16:04                4195
gmp.examples.php                                   24-May-2024 16:04                3097
gmp.installation.php                               24-May-2024 16:04                1372
gmp.requirements.php                               24-May-2024 16:04                1722
gmp.resources.php                                  24-May-2024 16:04                1431
gmp.setup.php                                      24-May-2024 16:04                1603
gnupg.configuration.php                            24-May-2024 16:04                1291
gnupg.constants.php                                24-May-2024 16:04                9425
gnupg.examples-clearsign.php                       24-May-2024 16:04                6351
gnupg.examples.php                                 24-May-2024 16:04                1410
gnupg.installation.php                             24-May-2024 16:04                1645
gnupg.requirements.php                             24-May-2024 16:04                1305
gnupg.resources.php                                24-May-2024 16:04                1232
gnupg.setup.php                                    24-May-2024 16:04                1630
hash.configuration.php                             24-May-2024 16:03                1286
hash.constants.php                                 24-May-2024 16:03                1849
hash.installation.php                              24-May-2024 16:03                1662
hash.requirements.php                              24-May-2024 16:03                1256
hash.resources.php                                 24-May-2024 16:03                1339
hash.setup.php                                     24-May-2024 16:03                1611
hashcontext.construct.php                          24-May-2024 16:03                1955
hashcontext.serialize.php                          24-May-2024 16:03                2451
hashcontext.unserialize.php                        24-May-2024 16:03                2755
history.php                                        24-May-2024 16:04                2200
history.php.books.php                              24-May-2024 16:04                2606
history.php.php                                    24-May-2024 16:04               10820
history.php.publications.php                       24-May-2024 16:04                1843
history.php.related.php                            24-May-2024 16:04                6005
hrtime-performancecounter.getfrequency.php         24-May-2024 16:04                2786
hrtime-performancecounter.getticks.php             24-May-2024 16:04                2659
hrtime-performancecounter.gettickssince.php        24-May-2024 16:04                2963
hrtime-stopwatch.getelapsedticks.php               24-May-2024 16:04                2561
hrtime-stopwatch.getelapsedtime.php                24-May-2024 16:04                2958
hrtime-stopwatch.getlastelapsedticks.php           24-May-2024 16:04                2629
hrtime-stopwatch.getlastelapsedtime.php            24-May-2024 16:04                2982
hrtime-stopwatch.isrunning.php                     24-May-2024 16:04                2522
hrtime-stopwatch.start.php                         24-May-2024 16:04                2423
hrtime-stopwatch.stop.php                          24-May-2024 16:04                2302
hrtime.example.basic.php                           24-May-2024 16:04                5475
hrtime.examples.php                                24-May-2024 16:04                1400
hrtime.installation.php                            24-May-2024 16:04                2057
hrtime.setup.php                                   24-May-2024 16:04                1434
ibase.configuration.php                            24-May-2024 16:03                8001
ibase.constants.php                                24-May-2024 16:03               21372
ibase.installation.php                             24-May-2024 16:03                3420
ibase.requirements.php                             24-May-2024 16:03                1229
ibase.resources.php                                24-May-2024 16:03                1232
ibase.setup.php                                    24-May-2024 16:03                1648
ibm-db2.configuration.php                          24-May-2024 16:03               20866
ibm-db2.constants.php                              24-May-2024 16:03                9115
ibm-db2.installation.php                           24-May-2024 16:03                3533
ibm-db2.requirements.php                           24-May-2024 16:03                3244
ibm-db2.resources.php                              24-May-2024 16:03                1300
ibm-db2.setup.php                                  24-May-2024 16:03                1660
iconv.configuration.php                            24-May-2024 16:04                4845
iconv.constants.php                                24-May-2024 16:04                3909
iconv.installation.php                             24-May-2024 16:04                1601
iconv.requirements.php                             24-May-2024 16:04                1521
iconv.resources.php                                24-May-2024 16:04                1232
iconv.setup.php                                    24-May-2024 16:04                1637
igbinary.configuration.php                         24-May-2024 16:04                3494
igbinary.installation.php                          24-May-2024 16:04                2048
igbinary.requirements.php                          24-May-2024 16:04                1250
igbinary.setup.php                                 24-May-2024 16:04                1585
image.configuration.php                            24-May-2024 16:04                3390
image.constants.php                                24-May-2024 16:04               54246
image.examples-png.php                             24-May-2024 16:04                4745
image.examples-watermark.php                       24-May-2024 16:04                5820
image.examples.merged-watermark.php                24-May-2024 16:04                8579
image.examples.php                                 24-May-2024 16:04                1626
image.installation.php                             24-May-2024 16:04                5994
image.requirements.php                             24-May-2024 16:04                4437
image.resources.php                                24-May-2024 16:04                2070
image.setup.php                                    24-May-2024 16:04                1633
imagick.adaptiveblurimage.php                      24-May-2024 16:04                7014
imagick.adaptiveresizeimage.php                    24-May-2024 16:04                9127
imagick.adaptivesharpenimage.php                   24-May-2024 16:04                6521
imagick.adaptivethresholdimage.php                 24-May-2024 16:04                6281
imagick.addimage.php                               24-May-2024 16:04                2971
imagick.addnoiseimage.php                          24-May-2024 16:04                5640
imagick.affinetransformimage.php                   24-May-2024 16:04                6677
imagick.animateimages.php                          24-May-2024 16:04                3227
imagick.annotateimage.php                          24-May-2024 16:04                8719
imagick.appendimages.php                           24-May-2024 16:04                6739
imagick.autolevelimage.php                         24-May-2024 16:04                4508
imagick.averageimages.php                          24-May-2024 16:04                2764
imagick.blackthresholdimage.php                    24-May-2024 16:04                5349
imagick.blueshiftimage.php                         24-May-2024 16:04                4553
imagick.blurimage.php                              24-May-2024 16:04                5810
imagick.borderimage.php                            24-May-2024 16:04                6099
imagick.brightnesscontrastimage.php                24-May-2024 16:04                5713
imagick.charcoalimage.php                          24-May-2024 16:04                5046
imagick.chopimage.php                              24-May-2024 16:04                7065
imagick.clampimage.php                             24-May-2024 16:04                2775
imagick.clear.php                                  24-May-2024 16:04                2324
imagick.clipimage.php                              24-May-2024 16:04                2571
imagick.clipimagepath.php                          24-May-2024 16:04                3198
imagick.clippathimage.php                          24-May-2024 16:04                3573
imagick.clone.php                                  24-May-2024 16:04                4181
imagick.clutimage.php                              24-May-2024 16:04                6085
imagick.coalesceimages.php                         24-May-2024 16:04                2858
imagick.colorfloodfillimage.php                    24-May-2024 16:04                5497
imagick.colorizeimage.php                          24-May-2024 16:04                6929
imagick.colormatriximage.php                       24-May-2024 16:04                7676
imagick.combineimages.php                          24-May-2024 16:04                3415
imagick.commentimage.php                           24-May-2024 16:04                5025
imagick.compareimagechannels.php                   24-May-2024 16:04                3997
imagick.compareimagelayers.php                     24-May-2024 16:04                5531
imagick.compareimages.php                          24-May-2024 16:04                5690
imagick.compositeimage.php                         24-May-2024 16:04                8057
imagick.configuration.php                          24-May-2024 16:04                4467
imagick.constants.php                              24-May-2024 16:04              161014
imagick.construct.php                              24-May-2024 16:04                2631
imagick.contrastimage.php                          24-May-2024 16:04                5086
imagick.contraststretchimage.php                   24-May-2024 16:04                4014
imagick.convolveimage.php                          24-May-2024 16:04                6002
imagick.count.php                                  24-May-2024 16:04                2755
imagick.cropimage.php                              24-May-2024 16:04                6203
imagick.cropthumbnailimage.php                     24-May-2024 16:04                3585
imagick.current.php                                24-May-2024 16:04                2519
imagick.cyclecolormapimage.php                     24-May-2024 16:04                3054
imagick.decipherimage.php                          24-May-2024 16:04                3319
imagick.deconstructimages.php                      24-May-2024 16:04                2674
imagick.deleteimageartifact.php                    24-May-2024 16:04                3727
imagick.deleteimageproperty.php                    24-May-2024 16:04                2702
imagick.deskewimage.php                            24-May-2024 16:04               11067
imagick.despeckleimage.php                         24-May-2024 16:04                4312
imagick.destroy.php                                24-May-2024 16:04                2462
imagick.displayimage.php                           24-May-2024 16:04                2855
imagick.displayimages.php                          24-May-2024 16:04                2899
imagick.distortimage.php                           24-May-2024 16:04               11913
imagick.drawimage.php                              24-May-2024 16:04                2690
imagick.edgeimage.php                              24-May-2024 16:04                4724
imagick.embossimage.php                            24-May-2024 16:04                5421
imagick.encipherimage.php                          24-May-2024 16:04                3315
imagick.enhanceimage.php                           24-May-2024 16:04                4279
imagick.equalizeimage.php                          24-May-2024 16:04                4246
imagick.evaluateimage.php                          24-May-2024 16:04                5978
imagick.examples-1.php                             24-May-2024 16:04               29926
imagick.examples.php                               24-May-2024 16:04                1412
imagick.exportimagepixels.php                      24-May-2024 16:04                7988
imagick.extentimage.php                            24-May-2024 16:04                5318
imagick.filter.php                                 24-May-2024 16:04                7654
imagick.flattenimages.php                          24-May-2024 16:04                2882
imagick.flipimage.php                              24-May-2024 16:04                4580
imagick.floodfillpaintimage.php                    24-May-2024 16:04               11651
imagick.flopimage.php                              24-May-2024 16:04                4612
imagick.forwardfouriertransformimage.php           24-May-2024 16:04               12140
imagick.frameimage.php                             24-May-2024 16:04                8381
imagick.functionimage.php                          24-May-2024 16:04               13795
imagick.fximage.php                                24-May-2024 16:04                6102
imagick.gammaimage.php                             24-May-2024 16:04                5763
imagick.gaussianblurimage.php                      24-May-2024 16:04                6299
imagick.getcolorspace.php                          24-May-2024 16:04                2501
imagick.getcompression.php                         24-May-2024 16:04                2324
imagick.getcompressionquality.php                  24-May-2024 16:04                2398
imagick.getcopyright.php                           24-May-2024 16:04                2427
imagick.getfilename.php                            24-May-2024 16:04                2496
imagick.getfont.php                                24-May-2024 16:04                3134
imagick.getformat.php                              24-May-2024 16:04                2458
imagick.getgravity.php                             24-May-2024 16:04                2480
imagick.gethomeurl.php                             24-May-2024 16:04                2304
imagick.getimage.php                               24-May-2024 16:04                2500
imagick.getimagealphachannel.php                   24-May-2024 16:04                3597
imagick.getimageartifact.php                       24-May-2024 16:04                3613
imagick.getimageattribute.php                      24-May-2024 16:04                2851
imagick.getimagebackgroundcolor.php                24-May-2024 16:04                2666
imagick.getimageblob.php                           24-May-2024 16:04                2752
imagick.getimageblueprimary.php                    24-May-2024 16:04                2943
imagick.getimagebordercolor.php                    24-May-2024 16:04                2687
imagick.getimagechanneldepth.php                   24-May-2024 16:04                3279
imagick.getimagechanneldistortion.php              24-May-2024 16:04                4145
imagick.getimagechanneldistortions.php             24-May-2024 16:04                4547
imagick.getimagechannelextrema.php                 24-May-2024 16:04                3691
imagick.getimagechannelkurtosis.php                24-May-2024 16:04                3682
imagick.getimagechannelmean.php                    24-May-2024 16:04                3309
imagick.getimagechannelrange.php                   24-May-2024 16:04                3535
imagick.getimagechannelstatistics.php              24-May-2024 16:04                2667
imagick.getimageclipmask.php                       24-May-2024 16:04                3019
imagick.getimagecolormapcolor.php                  24-May-2024 16:04                3022
imagick.getimagecolors.php                         24-May-2024 16:04                2468
imagick.getimagecolorspace.php                     24-May-2024 16:04                2451
imagick.getimagecompose.php                        24-May-2024 16:04                2473
imagick.getimagecompression.php                    24-May-2024 16:04                2412
imagick.getimagecompressionquality.php             24-May-2024 16:04                2506
imagick.getimagedelay.php                          24-May-2024 16:04                2489
imagick.getimagedepth.php                          24-May-2024 16:04                2257
imagick.getimagedispose.php                        24-May-2024 16:04                2529
imagick.getimagedistortion.php                     24-May-2024 16:04                3314
imagick.getimageextrema.php                        24-May-2024 16:04                2927
imagick.getimagefilename.php                       24-May-2024 16:04                2603
imagick.getimageformat.php                         24-May-2024 16:04                2585
imagick.getimagegamma.php                          24-May-2024 16:04                2484
imagick.getimagegeometry.php                       24-May-2024 16:04                4204
imagick.getimagegravity.php                        24-May-2024 16:04                2773
imagick.getimagegreenprimary.php                   24-May-2024 16:04                2754
imagick.getimageheight.php                         24-May-2024 16:04                2515
imagick.getimagehistogram.php                      24-May-2024 16:04               17244
imagick.getimageindex.php                          24-May-2024 16:04                3034
imagick.getimageinterlacescheme.php                24-May-2024 16:04                2549
imagick.getimageinterpolatemethod.php              24-May-2024 16:04                2788
imagick.getimageiterations.php                     24-May-2024 16:04                2577
imagick.getimagelength.php                         24-May-2024 16:04                3426
imagick.getimagematte.php                          24-May-2024 16:04                2884
imagick.getimagemattecolor.php                     24-May-2024 16:04                2842
imagick.getimagemimetype.php                       24-May-2024 16:04                2322
imagick.getimageorientation.php                    24-May-2024 16:04                2681
imagick.getimagepage.php                           24-May-2024 16:04                2746
imagick.getimagepixelcolor.php                     24-May-2024 16:04                3209
imagick.getimageprofile.php                        24-May-2024 16:04                2853
imagick.getimageprofiles.php                       24-May-2024 16:04                3601
imagick.getimageproperties.php                     24-May-2024 16:04                5843
imagick.getimageproperty.php                       24-May-2024 16:04                4992
imagick.getimageredprimary.php                     24-May-2024 16:04                2822
imagick.getimageregion.php                         24-May-2024 16:04                4009
imagick.getimagerenderingintent.php                24-May-2024 16:04                2705
imagick.getimageresolution.php                     24-May-2024 16:04                2581
imagick.getimagesblob.php                          24-May-2024 16:04                2582
imagick.getimagescene.php                          24-May-2024 16:04                2471
imagick.getimagesignature.php                      24-May-2024 16:04                2600
imagick.getimagesize.php                           24-May-2024 16:04                2700
imagick.getimagetickspersecond.php                 24-May-2024 16:04                2617
imagick.getimagetotalinkdensity.php                24-May-2024 16:04                2535
imagick.getimagetype.php                           24-May-2024 16:04                4924
imagick.getimageunits.php                          24-May-2024 16:04                2533
imagick.getimagevirtualpixelmethod.php             24-May-2024 16:04                2684
imagick.getimagewhitepoint.php                     24-May-2024 16:04                2734
imagick.getimagewidth.php                          24-May-2024 16:04                2489
imagick.getinterlacescheme.php                     24-May-2024 16:04                2635
imagick.getiteratorindex.php                       24-May-2024 16:04                6141
imagick.getnumberimages.php                        24-May-2024 16:04                2584
imagick.getoption.php                              24-May-2024 16:04                2827
imagick.getpackagename.php                         24-May-2024 16:04                2557
imagick.getpage.php                                24-May-2024 16:04                2558
imagick.getpixeliterator.php                       24-May-2024 16:04                6030
imagick.getpixelregioniterator.php                 24-May-2024 16:04                6777
imagick.getpointsize.php                           24-May-2024 16:04                2850
imagick.getquantum.php                             24-May-2024 16:04                2350
imagick.getquantumdepth.php                        24-May-2024 16:04                2668
imagick.getquantumrange.php                        24-May-2024 16:04                2930
imagick.getregistry.php                            24-May-2024 16:04                2564
imagick.getreleasedate.php                         24-May-2024 16:04                2581
imagick.getresource.php                            24-May-2024 16:04                2984
imagick.getresourcelimit.php                       24-May-2024 16:04                3402
imagick.getsamplingfactors.php                     24-May-2024 16:04                2645
imagick.getsize.php                                24-May-2024 16:04                5886
imagick.getsizeoffset.php                          24-May-2024 16:04                2633
imagick.getversion.php                             24-May-2024 16:04                2567
imagick.haldclutimage.php                          24-May-2024 16:04                6167
imagick.hasnextimage.php                           24-May-2024 16:04                2700
imagick.haspreviousimage.php                       24-May-2024 16:04                2738
imagick.identifyformat.php                         24-May-2024 16:04                4513
imagick.identifyimage.php                          24-May-2024 16:04                4147
imagick.implodeimage.php                           24-May-2024 16:04                4714
imagick.importimagepixels.php                      24-May-2024 16:04               11459
imagick.installation.php                           24-May-2024 16:04                3053
imagick.inversefouriertransformimage.php           24-May-2024 16:04                3561
imagick.labelimage.php                             24-May-2024 16:04                2646
imagick.levelimage.php                             24-May-2024 16:04                7829
imagick.linearstretchimage.php                     24-May-2024 16:04                5729
imagick.liquidrescaleimage.php                     24-May-2024 16:04                4578
imagick.listregistry.php                           24-May-2024 16:04                2409
imagick.magnifyimage.php                           24-May-2024 16:04                4278
imagick.mapimage.php                               24-May-2024 16:04                3298
imagick.mattefloodfillimage.php                    24-May-2024 16:04                5834
imagick.medianfilterimage.php                      24-May-2024 16:04                5186
imagick.mergeimagelayers.php                       24-May-2024 16:04                6501
imagick.minifyimage.php                            24-May-2024 16:04                2442
imagick.modulateimage.php                          24-May-2024 16:04                5677
imagick.montageimage.php                           24-May-2024 16:04                4610
imagick.morphimages.php                            24-May-2024 16:04                2842
imagick.morphology.php                             24-May-2024 16:04               66608
imagick.mosaicimages.php                           24-May-2024 16:04                2775
imagick.motionblurimage.php                        24-May-2024 16:04                6848
imagick.negateimage.php                            24-May-2024 16:04                5613
imagick.newimage.php                               24-May-2024 16:04                6349
imagick.newpseudoimage.php                         24-May-2024 16:04                5871
imagick.nextimage.php                              24-May-2024 16:04                2374
imagick.normalizeimage.php                         24-May-2024 16:04                6450
imagick.oilpaintimage.php                          24-May-2024 16:04                4655
imagick.opaquepaintimage.php                       24-May-2024 16:04                5086
imagick.optimizeimagelayers.php                    24-May-2024 16:04                5378
imagick.orderedposterizeimage.php                  24-May-2024 16:04                6862
imagick.paintfloodfillimage.php                    24-May-2024 16:04                5824
imagick.paintopaqueimage.php                       24-May-2024 16:04                5445
imagick.painttransparentimage.php                  24-May-2024 16:04                4710
imagick.pingimage.php                              24-May-2024 16:04                2768
imagick.pingimageblob.php                          24-May-2024 16:04                6017
imagick.pingimagefile.php                          24-May-2024 16:04                5849
imagick.polaroidimage.php                          24-May-2024 16:04                4805
imagick.posterizeimage.php                         24-May-2024 16:04                5688
imagick.previewimages.php                          24-May-2024 16:04                3177
imagick.previousimage.php                          24-May-2024 16:04                2429
imagick.profileimage.php                           24-May-2024 16:04                3265
imagick.quantizeimage.php                          24-May-2024 16:04                6753
imagick.quantizeimages.php                         24-May-2024 16:04                4094
imagick.queryfontmetrics.php                       24-May-2024 16:04                5628
imagick.queryfonts.php                             24-May-2024 16:04                4774
imagick.queryformats.php                           24-May-2024 16:04                7149
imagick.radialblurimage.php                        24-May-2024 16:04                5581
imagick.raiseimage.php                             24-May-2024 16:04                6572
imagick.randomthresholdimage.php                   24-May-2024 16:04                6487
imagick.readimage.php                              24-May-2024 16:04                2610
imagick.readimageblob.php                          24-May-2024 16:04                5492
imagick.readimagefile.php                          24-May-2024 16:04                3263
imagick.readimages.php                             24-May-2024 16:04                2657
imagick.recolorimage.php                           24-May-2024 16:04                6387
imagick.reducenoiseimage.php                       24-May-2024 16:04                5236
imagick.remapimage.php                             24-May-2024 16:04                3512
imagick.removeimage.php                            24-May-2024 16:04                2577
imagick.removeimageprofile.php                     24-May-2024 16:04                2848
imagick.render.php                                 24-May-2024 16:04                2337
imagick.requirements.php                           24-May-2024 16:04                1584
imagick.resampleimage.php                          24-May-2024 16:04                5681
imagick.resetimagepage.php                         24-May-2024 16:04                2868
imagick.resizeimage.php                            24-May-2024 16:04               11335
imagick.resources.php                              24-May-2024 16:04                1246
imagick.rollimage.php                              24-May-2024 16:04                4853
imagick.rotateimage.php                            24-May-2024 16:04                5739
imagick.rotationalblurimage.php                    24-May-2024 16:04                5810
imagick.roundcorners.php                           24-May-2024 16:04                6761
imagick.sampleimage.php                            24-May-2024 16:04                3033
imagick.scaleimage.php                             24-May-2024 16:04                7015
imagick.segmentimage.php                           24-May-2024 16:04                6813
imagick.selectiveblurimage.php                     24-May-2024 16:04                6673
imagick.separateimagechannel.php                   24-May-2024 16:04                5449
imagick.sepiatoneimage.php                         24-May-2024 16:04                4945
imagick.setbackgroundcolor.php                     24-May-2024 16:04                3323
imagick.setcolorspace.php                          24-May-2024 16:04                3069
imagick.setcompression.php                         24-May-2024 16:04                2827
imagick.setcompressionquality.php                  24-May-2024 16:04                6977
imagick.setfilename.php                            24-May-2024 16:04                2697
imagick.setfirstiterator.php                       24-May-2024 16:04                2423
imagick.setfont.php                                24-May-2024 16:04                5578
imagick.setformat.php                              24-May-2024 16:04                2599
imagick.setgravity.php                             24-May-2024 16:04                2788
imagick.setimage.php                               24-May-2024 16:04                4756
imagick.setimagealphachannel.php                   24-May-2024 16:04                3734
imagick.setimageartifact.php                       24-May-2024 16:04                7383
imagick.setimageattribute.php                      24-May-2024 16:04                3210
imagick.setimagebackgroundcolor.php                24-May-2024 16:04                3564
imagick.setimagebias.php                           24-May-2024 16:04                6799
imagick.setimagebiasquantum.php                    24-May-2024 16:04                2926
imagick.setimageblueprimary.php                    24-May-2024 16:04                3224
imagick.setimagebordercolor.php                    24-May-2024 16:04                3542
imagick.setimagechanneldepth.php                   24-May-2024 16:04                3241
imagick.setimageclipmask.php                       24-May-2024 16:04                8761
imagick.setimagecolormapcolor.php                  24-May-2024 16:04                3264
imagick.setimagecolorspace.php                     24-May-2024 16:04                3285
imagick.setimagecompose.php                        24-May-2024 16:04                3004
imagick.setimagecompression.php                    24-May-2024 16:04                2976
imagick.setimagecompressionquality.php             24-May-2024 16:04                4937
imagick.setimagedelay.php                          24-May-2024 16:04                6218
imagick.setimagedepth.php                          24-May-2024 16:04                2822
imagick.setimagedispose.php                        24-May-2024 16:04                2866
imagick.setimageextent.php                         24-May-2024 16:04                3141
imagick.setimagefilename.php                       24-May-2024 16:04                2918
imagick.setimageformat.php                         24-May-2024 16:04                2798
imagick.setimagegamma.php                          24-May-2024 16:04                2826
imagick.setimagegravity.php                        24-May-2024 16:04                2953
imagick.setimagegreenprimary.php                   24-May-2024 16:04                3217
imagick.setimageindex.php                          24-May-2024 16:04                3418
imagick.setimageinterlacescheme.php                24-May-2024 16:04                2986
imagick.setimageinterpolatemethod.php              24-May-2024 16:04                2901
imagick.setimageiterations.php                     24-May-2024 16:04                5064
imagick.setimagematte.php                          24-May-2024 16:04                2826
imagick.setimagemattecolor.php                     24-May-2024 16:04                3749
imagick.setimageopacity.php                        24-May-2024 16:04                5077
imagick.setimageorientation.php                    24-May-2024 16:04                4764
imagick.setimagepage.php                           24-May-2024 16:04                3780
imagick.setimageprofile.php                        24-May-2024 16:04                3360
imagick.setimageproperty.php                       24-May-2024 16:04                5223
imagick.setimageredprimary.php                     24-May-2024 16:04                3213
imagick.setimagerenderingintent.php                24-May-2024 16:04                2992
imagick.setimageresolution.php                     24-May-2024 16:04                5058
imagick.setimagescene.php                          24-May-2024 16:04                2846
imagick.setimagetickspersecond.php                 24-May-2024 16:04                7787
imagick.setimagetype.php                           24-May-2024 16:04                2632
imagick.setimageunits.php                          24-May-2024 16:04                2668
imagick.setimagevirtualpixelmethod.php             24-May-2024 16:04                2788
imagick.setimagewhitepoint.php                     24-May-2024 16:04                3211
imagick.setinterlacescheme.php                     24-May-2024 16:04                2716
imagick.setiteratorindex.php                       24-May-2024 16:04                6300
imagick.setlastiterator.php                        24-May-2024 16:04                2437
imagick.setoption.php                              24-May-2024 16:04               11578
imagick.setpage.php                                24-May-2024 16:04                3521
imagick.setpointsize.php                           24-May-2024 16:04                5281
imagick.setprogressmonitor.php                     24-May-2024 16:04               10289
imagick.setregistry.php                            24-May-2024 16:04                3114
imagick.setresolution.php                          24-May-2024 16:04                3813
imagick.setresourcelimit.php                       24-May-2024 16:04                3734
imagick.setsamplingfactors.php                     24-May-2024 16:04                6818
imagick.setsize.php                                24-May-2024 16:04                2947
imagick.setsizeoffset.php                          24-May-2024 16:04                3462
imagick.settype.php                                24-May-2024 16:04                2578
imagick.setup.php                                  24-May-2024 16:04                1655
imagick.shadeimage.php                             24-May-2024 16:04                5699
imagick.shadowimage.php                            24-May-2024 16:04                5492
imagick.sharpenimage.php                           24-May-2024 16:04                5662
imagick.shaveimage.php                             24-May-2024 16:04                4795
imagick.shearimage.php                             24-May-2024 16:04                6519
imagick.sigmoidalcontrastimage.php                 24-May-2024 16:04                8035
imagick.sketchimage.php                            24-May-2024 16:04                5902
imagick.smushimages.php                            24-May-2024 16:04                5832
imagick.solarizeimage.php                          24-May-2024 16:04                4898
imagick.sparsecolorimage.php                       24-May-2024 16:04               26736
imagick.spliceimage.php                            24-May-2024 16:04                5860
imagick.spreadimage.php                            24-May-2024 16:04                4720
imagick.statisticimage.php                         24-May-2024 16:04                6782
imagick.steganoimage.php                           24-May-2024 16:04                3099
imagick.stereoimage.php                            24-May-2024 16:04                2897
imagick.stripimage.php                             24-May-2024 16:04                2574
imagick.subimagematch.php                          24-May-2024 16:04                7546
imagick.swirlimage.php                             24-May-2024 16:04                4772
imagick.textureimage.php                           24-May-2024 16:04                6173
imagick.thresholdimage.php                         24-May-2024 16:04                5314
imagick.thumbnailimage.php                         24-May-2024 16:04                7572
imagick.tintimage.php                              24-May-2024 16:04                7868
imagick.tostring.php                               24-May-2024 16:04                2983
imagick.transformimage.php                         24-May-2024 16:04                6059
imagick.transformimagecolorspace.php               24-May-2024 16:04                5773
imagick.transparentpaintimage.php                  24-May-2024 16:04                7288
imagick.transposeimage.php                         24-May-2024 16:04                4649
imagick.transverseimage.php                        24-May-2024 16:04                4637
imagick.trimimage.php                              24-May-2024 16:04                5779
imagick.uniqueimagecolors.php                      24-May-2024 16:04                5580
imagick.unsharpmaskimage.php                       24-May-2024 16:04                6762
imagick.valid.php                                  24-May-2024 16:04                2317
imagick.vignetteimage.php                          24-May-2024 16:04                6654
imagick.waveimage.php                              24-May-2024 16:04                6387
imagick.whitethresholdimage.php                    24-May-2024 16:04                5261
imagick.writeimage.php                             24-May-2024 16:04                3077
imagick.writeimagefile.php                         24-May-2024 16:04                3828
imagick.writeimages.php                            24-May-2024 16:04                2931
imagick.writeimagesfile.php                        24-May-2024 16:04                3878
imagickdraw.affine.php                             24-May-2024 16:04               16984
imagickdraw.annotation.php                         24-May-2024 16:04                3384
imagickdraw.arc.php                                24-May-2024 16:04                9701
imagickdraw.bezier.php                             24-May-2024 16:04               16874
imagickdraw.circle.php                             24-May-2024 16:04                9096
imagickdraw.clear.php                              24-May-2024 16:04                2394
imagickdraw.clone.php                              24-May-2024 16:04                2487
imagickdraw.color.php                              24-May-2024 16:04                3544
imagickdraw.comment.php                            24-May-2024 16:04                2770
imagickdraw.composite.php                          24-May-2024 16:04               11977
imagickdraw.construct.php                          24-May-2024 16:04                2275
imagickdraw.destroy.php                            24-May-2024 16:04                2376
imagickdraw.ellipse.php                            24-May-2024 16:04               12282
imagickdraw.getclippath.php                        24-May-2024 16:04                2362
imagickdraw.getcliprule.php                        24-May-2024 16:04                2483
imagickdraw.getclipunits.php                       24-May-2024 16:04                2427
imagickdraw.getfillcolor.php                       24-May-2024 16:04                2436
imagickdraw.getfillopacity.php                     24-May-2024 16:04                2396
imagickdraw.getfillrule.php                        24-May-2024 16:04                2445
imagickdraw.getfont.php                            24-May-2024 16:04                2329
imagickdraw.getfontfamily.php                      24-May-2024 16:04                2389
imagickdraw.getfontsize.php                        24-May-2024 16:04                2465
imagickdraw.getfontstretch.php                     24-May-2024 16:04                2417
imagickdraw.getfontstyle.php                       24-May-2024 16:04                2608
imagickdraw.getfontweight.php                      24-May-2024 16:04                2447
imagickdraw.getgravity.php                         24-May-2024 16:04                2513
imagickdraw.getstrokeantialias.php                 24-May-2024 16:04                2785
imagickdraw.getstrokecolor.php                     24-May-2024 16:04                2839
imagickdraw.getstrokedasharray.php                 24-May-2024 16:04                2523
imagickdraw.getstrokedashoffset.php                24-May-2024 16:04                2497
imagickdraw.getstrokelinecap.php                   24-May-2024 16:04                2638
imagickdraw.getstrokelinejoin.php                  24-May-2024 16:04                2667
imagickdraw.getstrokemiterlimit.php                24-May-2024 16:04                2759
imagickdraw.getstrokeopacity.php                   24-May-2024 16:04                2500
imagickdraw.getstrokewidth.php                     24-May-2024 16:04                2509
imagickdraw.gettextalignment.php                   24-May-2024 16:04                2529
imagickdraw.gettextantialias.php                   24-May-2024 16:04                2666
imagickdraw.gettextdecoration.php                  24-May-2024 16:04                2566
imagickdraw.gettextencoding.php                    24-May-2024 16:04                2491
imagickdraw.gettextinterlinespacing.php            24-May-2024 16:04                2454
imagickdraw.gettextinterwordspacing.php            24-May-2024 16:04                2478
imagickdraw.gettextkerning.php                     24-May-2024 16:04                2373
imagickdraw.gettextundercolor.php                  24-May-2024 16:04                2539
imagickdraw.getvectorgraphics.php                  24-May-2024 16:04                2589
imagickdraw.line.php                               24-May-2024 16:04                8395
imagickdraw.matte.php                              24-May-2024 16:04                8419
imagickdraw.pathclose.php                          24-May-2024 16:04                2499
imagickdraw.pathcurvetoabsolute.php                24-May-2024 16:04                4968
imagickdraw.pathcurvetoquadraticbezierabsolute.php 24-May-2024 16:04               11215
imagickdraw.pathcurvetoquadraticbezierrelative.php 24-May-2024 16:04                4349
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 24-May-2024 16:04               10357
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 24-May-2024 16:04               10506
imagickdraw.pathcurvetorelative.php                24-May-2024 16:04                4984
imagickdraw.pathcurvetosmoothabsolute.php          24-May-2024 16:04                4721
imagickdraw.pathcurvetosmoothrelative.php          24-May-2024 16:04                4728
imagickdraw.pathellipticarcabsolute.php            24-May-2024 16:04                5741
imagickdraw.pathellipticarcrelative.php            24-May-2024 16:04                5711
imagickdraw.pathfinish.php                         24-May-2024 16:04                2332
imagickdraw.pathlinetoabsolute.php                 24-May-2024 16:04                3274
imagickdraw.pathlinetohorizontalabsolute.php       24-May-2024 16:04                3124
imagickdraw.pathlinetohorizontalrelative.php       24-May-2024 16:04                3119
imagickdraw.pathlinetorelative.php                 24-May-2024 16:04                3324
imagickdraw.pathlinetoverticalabsolute.php         24-May-2024 16:04                3088
imagickdraw.pathlinetoverticalrelative.php         24-May-2024 16:04                3093
imagickdraw.pathmovetoabsolute.php                 24-May-2024 16:04                3321
imagickdraw.pathmovetorelative.php                 24-May-2024 16:04                3257
imagickdraw.pathstart.php                          24-May-2024 16:04               11830
imagickdraw.point.php                              24-May-2024 16:04                6929
imagickdraw.polygon.php                            24-May-2024 16:04                9013
imagickdraw.polyline.php                           24-May-2024 16:04                9017
imagickdraw.pop.php                                24-May-2024 16:04                2745
imagickdraw.popclippath.php                        24-May-2024 16:04                2291
imagickdraw.popdefs.php                            24-May-2024 16:04                7770
imagickdraw.poppattern.php                         24-May-2024 16:04                2478
imagickdraw.push.php                               24-May-2024 16:04                8492
imagickdraw.pushclippath.php                       24-May-2024 16:04                2997
imagickdraw.pushdefs.php                           24-May-2024 16:04                2590
imagickdraw.pushpattern.php                        24-May-2024 16:04               14672
imagickdraw.rectangle.php                          24-May-2024 16:04                8601
imagickdraw.render.php                             24-May-2024 16:04                2520
imagickdraw.resetvectorgraphics.php                24-May-2024 16:04                2475
imagickdraw.rotate.php                             24-May-2024 16:04                7796
imagickdraw.roundrectangle.php                     24-May-2024 16:04                9451
imagickdraw.scale.php                              24-May-2024 16:04                8142
imagickdraw.setclippath.php                        24-May-2024 16:04                8473
imagickdraw.setcliprule.php                        24-May-2024 16:04                9484
imagickdraw.setclipunits.php                       24-May-2024 16:04                8861
imagickdraw.setfillalpha.php                       24-May-2024 16:04                7817
imagickdraw.setfillcolor.php                       24-May-2024 16:04                7819
imagickdraw.setfillopacity.php                     24-May-2024 16:04                7875
imagickdraw.setfillpatternurl.php                  24-May-2024 16:04                3321
imagickdraw.setfillrule.php                        24-May-2024 16:04               13021
imagickdraw.setfont.php                            24-May-2024 16:04                9328
imagickdraw.setfontfamily.php                      24-May-2024 16:04                9940
imagickdraw.setfontsize.php                        24-May-2024 16:04                8323
imagickdraw.setfontstretch.php                     24-May-2024 16:04                9750
imagickdraw.setfontstyle.php                       24-May-2024 16:04                9040
imagickdraw.setfontweight.php                      24-May-2024 16:04                9178
imagickdraw.setgravity.php                         24-May-2024 16:04               10607
imagickdraw.setresolution.php                      24-May-2024 16:04                2956
imagickdraw.setstrokealpha.php                     24-May-2024 16:04                8477
imagickdraw.setstrokeantialias.php                 24-May-2024 16:04                9016
imagickdraw.setstrokecolor.php                     24-May-2024 16:04                8536
imagickdraw.setstrokedasharray.php                 24-May-2024 16:04               13458
imagickdraw.setstrokedashoffset.php                24-May-2024 16:04                9908
imagickdraw.setstrokelinecap.php                   24-May-2024 16:04                8624
imagickdraw.setstrokelinejoin.php                  24-May-2024 16:04               11510
imagickdraw.setstrokemiterlimit.php                24-May-2024 16:04               11327
imagickdraw.setstrokeopacity.php                   24-May-2024 16:04               10273
imagickdraw.setstrokepatternurl.php                24-May-2024 16:04                3022
imagickdraw.setstrokewidth.php                     24-May-2024 16:04                8508
imagickdraw.settextalignment.php                   24-May-2024 16:04                9489
imagickdraw.settextantialias.php                   24-May-2024 16:04                8903
imagickdraw.settextdecoration.php                  24-May-2024 16:04                7525
imagickdraw.settextencoding.php                    24-May-2024 16:04                3204
imagickdraw.settextinterlinespacing.php            24-May-2024 16:04                2997
imagickdraw.settextinterwordspacing.php            24-May-2024 16:04                2820
imagickdraw.settextkerning.php                     24-May-2024 16:04                2906
imagickdraw.settextundercolor.php                  24-May-2024 16:04                7841
imagickdraw.setvectorgraphics.php                  24-May-2024 16:04                9006
imagickdraw.setviewbox.php                         24-May-2024 16:04               10386
imagickdraw.skewx.php                              24-May-2024 16:04                8207
imagickdraw.skewy.php                              24-May-2024 16:04                8196
imagickdraw.translate.php                          24-May-2024 16:04                8534
imagickkernel.addkernel.php                        24-May-2024 16:04                7062
imagickkernel.addunitykernel.php                   24-May-2024 16:04               13714
imagickkernel.frombuiltin.php                      24-May-2024 16:04               26267
imagickkernel.frommatrix.php                       24-May-2024 16:04               23199
imagickkernel.getmatrix.php                        24-May-2024 16:04                7122
imagickkernel.scale.php                            24-May-2024 16:04               13229
imagickkernel.separate.php                         24-May-2024 16:04                9750
imagickpixel.clear.php                             24-May-2024 16:04                2438
imagickpixel.construct.php                         24-May-2024 16:04               11862
imagickpixel.destroy.php                           24-May-2024 16:04                2527
imagickpixel.getcolor.php                          24-May-2024 16:04                7911
imagickpixel.getcolorasstring.php                  24-May-2024 16:04                4891
imagickpixel.getcolorcount.php                     24-May-2024 16:04                4951
imagickpixel.getcolorquantum.php                   24-May-2024 16:04                2944
imagickpixel.getcolorvalue.php                     24-May-2024 16:04                8682
imagickpixel.getcolorvaluequantum.php              24-May-2024 16:04                6138
imagickpixel.gethsl.php                            24-May-2024 16:04                4394
imagickpixel.getindex.php                          24-May-2024 16:04                2320
imagickpixel.ispixelsimilar.php                    24-May-2024 16:04                3677
imagickpixel.ispixelsimilarquantum.php             24-May-2024 16:04                3269
imagickpixel.issimilar.php                         24-May-2024 16:04               16585
imagickpixel.setcolor.php                          24-May-2024 16:04                7540
imagickpixel.setcolorcount.php                     24-May-2024 16:04                2729
imagickpixel.setcolorvalue.php                     24-May-2024 16:04                5214
imagickpixel.setcolorvaluequantum.php              24-May-2024 16:04                8513
imagickpixel.sethsl.php                            24-May-2024 16:04                7566
imagickpixel.setindex.php                          24-May-2024 16:04                2658
imagickpixeliterator.clear.php                     24-May-2024 16:04                6350
imagickpixeliterator.construct.php                 24-May-2024 16:04                6023
imagickpixeliterator.destroy.php                   24-May-2024 16:04                2568
imagickpixeliterator.getcurrentiteratorrow.php     24-May-2024 16:04                2662
imagickpixeliterator.getiteratorrow.php            24-May-2024 16:04                2587
imagickpixeliterator.getnextiteratorrow.php        24-May-2024 16:04                6768
imagickpixeliterator.getpreviousiteratorrow.php    24-May-2024 16:04                2731
imagickpixeliterator.newpixeliterator.php          24-May-2024 16:04                2821
imagickpixeliterator.newpixelregioniterator.php    24-May-2024 16:04                4334
imagickpixeliterator.resetiterator.php             24-May-2024 16:04                8758
imagickpixeliterator.setiteratorfirstrow.php       24-May-2024 16:04                2662
imagickpixeliterator.setiteratorlastrow.php        24-May-2024 16:04                2655
imagickpixeliterator.setiteratorrow.php            24-May-2024 16:04                7175
imagickpixeliterator.synciterator.php              24-May-2024 16:04                2510
imap.configuration.php                             24-May-2024 16:04                3268
imap.constants.php                                 24-May-2024 16:04               24854
imap.installation.php                              24-May-2024 16:04                2664
imap.requirements.php                              24-May-2024 16:04                3057
imap.resources.php                                 24-May-2024 16:04                1423
imap.setup.php                                     24-May-2024 16:04                1624
index.php                                          24-May-2024 16:04               14837
indexes.examples.php                               24-May-2024 16:04              682265
indexes.functions.php                              24-May-2024 16:04             1157543
indexes.php                                        24-May-2024 16:04                1463
infiniteiterator.construct.php                     24-May-2024 16:04                5081
infiniteiterator.next.php                          24-May-2024 16:04                3342
info.configuration.php                             24-May-2024 16:03               19435
info.constants.php                                 24-May-2024 16:03               23615
info.installation.php                              24-May-2024 16:03                1265
info.requirements.php                              24-May-2024 16:03                1222
info.resources.php                                 24-May-2024 16:03                1225
info.setup.php                                     24-May-2024 16:03                1613
ini.core.php                                       24-May-2024 16:04               73117
ini.list.php                                       24-May-2024 16:04              100274
ini.php                                            24-May-2024 16:04                1620
ini.sections.php                                   24-May-2024 16:04                4217
inotify.configuration.php                          24-May-2024 16:04                1317
inotify.constants.php                              24-May-2024 16:04               10420
inotify.install.php                                24-May-2024 16:04                1836
inotify.requirements.php                           24-May-2024 16:04                1259
inotify.resources.php                              24-May-2024 16:04                1357
inotify.setup.php                                  24-May-2024 16:04                1660
install.cloud.azure.php                            24-May-2024 16:03                4335
install.cloud.ec2.php                              24-May-2024 16:03                1473
install.cloud.php                                  24-May-2024 16:03                1680
install.fpm.configuration.php                      24-May-2024 16:03               36134
install.fpm.install.php                            24-May-2024 16:03                3346
install.fpm.php                                    24-May-2024 16:03                3638
install.general.php                                24-May-2024 16:03                4396
install.macosx.bundled.php                         24-May-2024 16:03               10081
install.macosx.compile.php                         24-May-2024 16:03                1367
install.macosx.packages.php                        24-May-2024 16:03                2826
install.macosx.php                                 24-May-2024 16:03                1952
install.pecl.downloads.php                         24-May-2024 16:03                3573
install.pecl.intro.php                             24-May-2024 16:03                3089
install.pecl.pear.php                              24-May-2024 16:03                2953
install.pecl.php                                   24-May-2024 16:03                2016
install.pecl.php-config.php                        24-May-2024 16:03                4152
install.pecl.phpize.php                            24-May-2024 16:03                3037
install.pecl.static.php                            24-May-2024 16:03                3431
install.pecl.windows.php                           24-May-2024 16:03                9062
install.php                                        24-May-2024 16:03                5468
install.problems.bugs.php                          24-May-2024 16:03                1965
install.problems.faq.php                           24-May-2024 16:03                1313
install.problems.php                               24-May-2024 16:03                1598
install.problems.support.php                       24-May-2024 16:03                2374
install.unix.apache2.php                           24-May-2024 16:03               12671
install.unix.commandline.php                       24-May-2024 16:03                3760
install.unix.debian.php                            24-May-2024 16:03                6651
install.unix.lighttpd-14.php                       24-May-2024 16:03                6363
install.unix.litespeed.php                         24-May-2024 16:03                8998
install.unix.nginx.php                             24-May-2024 16:03                8367
install.unix.openbsd.php                           24-May-2024 16:03                5683
install.unix.php                                   24-May-2024 16:03                7672
install.unix.solaris.php                           24-May-2024 16:03                3791
install.windows.apache2.php                        24-May-2024 16:03                6872
install.windows.building.php                       24-May-2024 16:03                1695
install.windows.commandline.php                    24-May-2024 16:03                8203
install.windows.manual.php                         24-May-2024 16:03                5250
install.windows.pecl.php                           24-May-2024 16:03                1592
install.windows.php                                24-May-2024 16:03                3137
install.windows.recommended.php                    24-May-2024 16:03                4624
install.windows.requirements.php                   24-May-2024 16:03                2238
install.windows.tools.php                          24-May-2024 16:03                1803
install.windows.troubleshooting.php                24-May-2024 16:03                1716
internaliterator.construct.php                     24-May-2024 16:03                2014
internaliterator.current.php                       24-May-2024 16:03                2323
internaliterator.key.php                           24-May-2024 16:03                2312
internaliterator.next.php                          24-May-2024 16:03                2306
internaliterator.rewind.php                        24-May-2024 16:03                2341
internaliterator.valid.php                         24-May-2024 16:03                2312
intl.configuration.php                             24-May-2024 16:04                5361
intl.constants.php                                 24-May-2024 16:04               12800
intl.examples.basic.php                            24-May-2024 16:04                4346
intl.examples.php                                  24-May-2024 16:04                1424
intl.installation.php                              24-May-2024 16:04                1778
intl.requirements.php                              24-May-2024 16:04                1388
intl.resources.php                                 24-May-2024 16:04                1225
intl.setup.php                                     24-May-2024 16:04                1623
intlbreakiterator.construct.php                    24-May-2024 16:04                4099
intlbreakiterator.createcharacterinstance.php      24-May-2024 16:04                3387
intlbreakiterator.createcodepointinstance.php      24-May-2024 16:04                2832
intlbreakiterator.createlineinstance.php           24-May-2024 16:04                3348
intlbreakiterator.createsentenceinstance.php       24-May-2024 16:04                3350
intlbreakiterator.createtitleinstance.php          24-May-2024 16:04                3330
intlbreakiterator.createwordinstance.php           24-May-2024 16:04                3284
intlbreakiterator.current.php                      24-May-2024 16:04                2521
intlbreakiterator.first.php                        24-May-2024 16:04                2505
intlbreakiterator.following.php                    24-May-2024 16:04                2805
intlbreakiterator.geterrorcode.php                 24-May-2024 16:04                3056
intlbreakiterator.geterrormessage.php              24-May-2024 16:04                3105
intlbreakiterator.getlocale.php                    24-May-2024 16:04                2915
intlbreakiterator.getpartsiterator.php             24-May-2024 16:04                3742
intlbreakiterator.gettext.php                      24-May-2024 16:04                2638
intlbreakiterator.isboundary.php                   24-May-2024 16:04                2775
intlbreakiterator.last.php                         24-May-2024 16:04                2504
intlbreakiterator.next.php                         24-May-2024 16:04                2939
intlbreakiterator.preceding.php                    24-May-2024 16:04                2783
intlbreakiterator.previous.php                     24-May-2024 16:04                2560
intlbreakiterator.settext.php                      24-May-2024 16:04                3657
intlcalendar.add.php                               24-May-2024 16:04                8870
intlcalendar.after.php                             24-May-2024 16:04                6865
intlcalendar.before.php                            24-May-2024 16:04                4252
intlcalendar.clear.php                             24-May-2024 16:04               19139
intlcalendar.construct.php                         24-May-2024 16:04                2372
intlcalendar.createinstance.php                    24-May-2024 16:04               13617
intlcalendar.equals.php                            24-May-2024 16:04               10960
intlcalendar.fielddifference.php                   24-May-2024 16:04               11396
intlcalendar.fromdatetime.php                      24-May-2024 16:04                8086
intlcalendar.get.php                               24-May-2024 16:04                8895
intlcalendar.getactualmaximum.php                  24-May-2024 16:04                8802
intlcalendar.getactualminimum.php                  24-May-2024 16:04                5985
intlcalendar.getavailablelocales.php               24-May-2024 16:04                4494
intlcalendar.getdayofweektype.php                  24-May-2024 16:04               10719
intlcalendar.geterrorcode.php                      24-May-2024 16:04                9135
intlcalendar.geterrormessage.php                   24-May-2024 16:04                6232
intlcalendar.getfirstdayofweek.php                 24-May-2024 16:04                8815
intlcalendar.getgreatestminimum.php                24-May-2024 16:04                4867
intlcalendar.getkeywordvaluesforlocale.php         24-May-2024 16:04                7567
intlcalendar.getleastmaximum.php                   24-May-2024 16:04                8449
intlcalendar.getlocale.php                         24-May-2024 16:04                6399
intlcalendar.getmaximum.php                        24-May-2024 16:04                5518
intlcalendar.getminimaldaysinfirstweek.php         24-May-2024 16:04                9107
intlcalendar.getminimum.php                        24-May-2024 16:04                4811
intlcalendar.getnow.php                            24-May-2024 16:04                5411
intlcalendar.getrepeatedwalltimeoption.php         24-May-2024 16:04               10389
intlcalendar.getskippedwalltimeoption.php          24-May-2024 16:04               12728
intlcalendar.gettime.php                           24-May-2024 16:04                6668
intlcalendar.gettimezone.php                       24-May-2024 16:04                7626
intlcalendar.gettype.php                           24-May-2024 16:04                5804
intlcalendar.getweekendtransition.php              24-May-2024 16:04                5473
intlcalendar.indaylighttime.php                    24-May-2024 16:04                8789
intlcalendar.isequivalentto.php                    24-May-2024 16:04                8550
intlcalendar.islenient.php                         24-May-2024 16:04                8450
intlcalendar.isset.php                             24-May-2024 16:04                4911
intlcalendar.isweekend.php                         24-May-2024 16:04                9038
intlcalendar.roll.php                              24-May-2024 16:04                9586
intlcalendar.set.php                               24-May-2024 16:04               16115
intlcalendar.setdate.php                           24-May-2024 16:04                4905
intlcalendar.setdatetime.php                       24-May-2024 16:04                6828
intlcalendar.setfirstdayofweek.php                 24-May-2024 16:04                8965
intlcalendar.setlenient.php                        24-May-2024 16:04                5152
intlcalendar.setminimaldaysinfirstweek.php         24-May-2024 16:04                5490
intlcalendar.setrepeatedwalltimeoption.php         24-May-2024 16:04                6621
intlcalendar.setskippedwalltimeoption.php          24-May-2024 16:04                7488
intlcalendar.settime.php                           24-May-2024 16:04                8782
intlcalendar.settimezone.php                       24-May-2024 16:04               11353
intlcalendar.todatetime.php                        24-May-2024 16:04                7234
intlchar.charage.php                               24-May-2024 16:04                5933
intlchar.chardigitvalue.php                        24-May-2024 16:04                5594
intlchar.chardirection.php                         24-May-2024 16:04               10746
intlchar.charfromname.php                          24-May-2024 16:04                7319
intlchar.charmirror.php                            24-May-2024 16:04                6635
intlchar.charname.php                              24-May-2024 16:04                7705
intlchar.chartype.php                              24-May-2024 16:04               11639
intlchar.chr.php                                   24-May-2024 16:04                5675
intlchar.digit.php                                 24-May-2024 16:04                8489
intlchar.enumcharnames.php                         24-May-2024 16:04                9149
intlchar.enumchartypes.php                         24-May-2024 16:04                5885
intlchar.foldcase.php                              24-May-2024 16:04                4128
intlchar.fordigit.php                              24-May-2024 16:04                7146
intlchar.getbidipairedbracket.php                  24-May-2024 16:04                6395
intlchar.getblockcode.php                          24-May-2024 16:04                5652
intlchar.getcombiningclass.php                     24-May-2024 16:04                4996
intlchar.getfc-nfkc-closure.php                    24-May-2024 16:04                5017
intlchar.getintpropertymaxvalue.php                24-May-2024 16:04                6423
intlchar.getintpropertyminvalue.php                24-May-2024 16:04                6416
intlchar.getintpropertyvalue.php                   24-May-2024 16:04                8127
intlchar.getnumericvalue.php                       24-May-2024 16:04                5702
intlchar.getpropertyenum.php                       24-May-2024 16:04                6770
intlchar.getpropertyname.php                       24-May-2024 16:04                9121
intlchar.getpropertyvalueenum.php                  24-May-2024 16:04                8018
intlchar.getpropertyvaluename.php                  24-May-2024 16:04               10933
intlchar.getunicodeversion.php                     24-May-2024 16:04                4013
intlchar.hasbinaryproperty.php                     24-May-2024 16:04                9088
intlchar.isalnum.php                               24-May-2024 16:04                6025
intlchar.isalpha.php                               24-May-2024 16:04                5911
intlchar.isbase.php                                24-May-2024 16:04                6221
intlchar.isblank.php                               24-May-2024 16:04                6889
intlchar.iscntrl.php                               24-May-2024 16:04                6985
intlchar.isdefined.php                             24-May-2024 16:04                6898
intlchar.isdigit.php                               24-May-2024 16:04                6232
intlchar.isgraph.php                               24-May-2024 16:04                6170
intlchar.isidignorable.php                         24-May-2024 16:04                6430
intlchar.isidpart.php                              24-May-2024 16:04                7071
intlchar.isidstart.php                             24-May-2024 16:04                6502
intlchar.isisocontrol.php                          24-May-2024 16:04                5709
intlchar.isjavaidpart.php                          24-May-2024 16:04                6994
intlchar.isjavaidstart.php                         24-May-2024 16:04                6724
intlchar.isjavaspacechar.php                       24-May-2024 16:04                6957
intlchar.islower.php                               24-May-2024 16:04                7384
intlchar.ismirrored.php                            24-May-2024 16:04                5833
intlchar.isprint.php                               24-May-2024 16:04                6305
intlchar.ispunct.php                               24-May-2024 16:04                5959
intlchar.isspace.php                               24-May-2024 16:04                6703
intlchar.istitle.php                               24-May-2024 16:04                7599
intlchar.isualphabetic.php                         24-May-2024 16:04                6046
intlchar.isulowercase.php                          24-May-2024 16:04                7076
intlchar.isupper.php                               24-May-2024 16:04                7382
intlchar.isuuppercase.php                          24-May-2024 16:04                7114
intlchar.isuwhitespace.php                         24-May-2024 16:04                7536
intlchar.iswhitespace.php                          24-May-2024 16:04                7431
intlchar.isxdigit.php                              24-May-2024 16:04                7302
intlchar.ord.php                                   24-May-2024 16:04                5508
intlchar.tolower.php                               24-May-2024 16:04                7806
intlchar.totitle.php                               24-May-2024 16:04                7951
intlchar.toupper.php                               24-May-2024 16:04                7717
intlcodepointbreakiterator.getlastcodepoint.php    24-May-2024 16:04                2763
intldateformatter.create.php                       24-May-2024 16:04               29340
intldateformatter.format.php                       24-May-2024 16:04               26655
intldateformatter.formatobject.php                 24-May-2024 16:04               14716
intldateformatter.getcalendar.php                  24-May-2024 16:04               11194
intldateformatter.getcalendarobject.php            24-May-2024 16:04                7712
intldateformatter.getdatetype.php                  24-May-2024 16:04               11650
intldateformatter.geterrorcode.php                 24-May-2024 16:04                8615
intldateformatter.geterrormessage.php              24-May-2024 16:04                8593
intldateformatter.getlocale.php                    24-May-2024 16:04               12322
intldateformatter.getpattern.php                   24-May-2024 16:04               10375
intldateformatter.gettimetype.php                  24-May-2024 16:04               11644
intldateformatter.gettimezone.php                  24-May-2024 16:04                8714
intldateformatter.gettimezoneid.php                24-May-2024 16:04                8932
intldateformatter.islenient.php                    24-May-2024 16:04               14738
intldateformatter.localtime.php                    24-May-2024 16:04               11596
intldateformatter.parse.php                        24-May-2024 16:04               12462
intldateformatter.setcalendar.php                  24-May-2024 16:04               14510
intldateformatter.setlenient.php                   24-May-2024 16:04               15588
intldateformatter.setpattern.php                   24-May-2024 16:04               11611
intldateformatter.settimezone.php                  24-May-2024 16:04               12593
intldatepatterngenerator.create.php                24-May-2024 16:04                4434
intldatepatterngenerator.getbestpattern.php        24-May-2024 16:04                6943
intlgregoriancalendar.construct.php                24-May-2024 16:04                5700
intlgregoriancalendar.createfromdate.php           24-May-2024 16:04                7447
intlgregoriancalendar.createfromdatetime.php       24-May-2024 16:04                9156
intlgregoriancalendar.getgregorianchange.php       24-May-2024 16:04                2743
intlgregoriancalendar.isleapyear.php               24-May-2024 16:04                3107
intlgregoriancalendar.setgregorianchange.php       24-May-2024 16:04                3138
intliterator.current.php                           24-May-2024 16:04                2395
intliterator.key.php                               24-May-2024 16:04                2364
intliterator.next.php                              24-May-2024 16:04                2380
intliterator.rewind.php                            24-May-2024 16:04                2408
intliterator.valid.php                             24-May-2024 16:04                2383
intlpartsiterator.getbreakiterator.php             24-May-2024 16:04                2606
intlrulebasedbreakiterator.construct.php           24-May-2024 16:04                3241
intlrulebasedbreakiterator.getbinaryrules.php      24-May-2024 16:04                2863
intlrulebasedbreakiterator.getrules.php            24-May-2024 16:04                2827
intlrulebasedbreakiterator.getrulestatus.php       24-May-2024 16:04                2799
intlrulebasedbreakiterator.getrulestatusvec.php    24-May-2024 16:04                2921
intltimezone.construct.php                         24-May-2024 16:04                2013
intltimezone.countequivalentids.php                24-May-2024 16:04                3735
intltimezone.createdefault.php                     24-May-2024 16:04                3063
intltimezone.createenumeration.php                 24-May-2024 16:04                4821
intltimezone.createtimezone.php                    24-May-2024 16:04                3711
intltimezone.createtimezoneidenumeration.php       24-May-2024 16:04                5895
intltimezone.fromdatetimezone.php                  24-May-2024 16:04                3832
intltimezone.getcanonicalid.php                    24-May-2024 16:04                4458
intltimezone.getdisplayname.php                    24-May-2024 16:04                5639
intltimezone.getdstsavings.php                     24-May-2024 16:04                3195
intltimezone.getequivalentid.php                   24-May-2024 16:04                4141
intltimezone.geterrorcode.php                      24-May-2024 16:04                3367
intltimezone.geterrormessage.php                   24-May-2024 16:04                3395
intltimezone.getgmt.php                            24-May-2024 16:04                2912
intltimezone.getid.php                             24-May-2024 16:04                3247
intltimezone.getidforwindowsid.php                 24-May-2024 16:04                5907
intltimezone.getoffset.php                         24-May-2024 16:04                5159
intltimezone.getrawoffset.php                      24-May-2024 16:04                3146
intltimezone.getregion.php                         24-May-2024 16:04                3736
intltimezone.gettzdataversion.php                  24-May-2024 16:04                3286
intltimezone.getunknown.php                        24-May-2024 16:04                3178
intltimezone.getwindowsid.php                      24-May-2024 16:04                4478
intltimezone.hassamerules.php                      24-May-2024 16:04                3573
intltimezone.todatetimezone.php                    24-May-2024 16:04                3496
intltimezone.usedaylighttime.php                   24-May-2024 16:04                3172
intro-whatcando.php                                24-May-2024 16:03                8262
intro-whatis.php                                   24-May-2024 16:03                4272
intro.apache.php                                   24-May-2024 16:04                1210
intro.apcu.php                                     24-May-2024 16:03                1850
intro.array.php                                    24-May-2024 16:04                1963
intro.bc.php                                       24-May-2024 16:04                1271
intro.bzip2.php                                    24-May-2024 16:03                1214
intro.calendar.php                                 24-May-2024 16:04                2065
intro.classobj.php                                 24-May-2024 16:04                1816
intro.cmark.php                                    24-May-2024 16:04                7363
intro.com.php                                      24-May-2024 16:04                3108
intro.componere.php                                24-May-2024 16:03                6689
intro.ctype.php                                    24-May-2024 16:04                3599
intro.cubrid.php                                   24-May-2024 16:03                1496
intro.curl.php                                     24-May-2024 16:04                1627
intro.datetime.php                                 24-May-2024 16:04                2700
intro.dba.php                                      24-May-2024 16:03                1516
intro.dbase.php                                    24-May-2024 16:03                6804
intro.dio.php                                      24-May-2024 16:04                1715
intro.dom.php                                      24-May-2024 16:04                1692
intro.ds.php                                       24-May-2024 16:04                1476
intro.eio.php                                      24-May-2024 16:04               14402
intro.enchant.php                                  24-May-2024 16:04                2629
intro.errorfunc.php                                24-May-2024 16:03                1911
intro.ev.php                                       24-May-2024 16:04                2299
intro.event.php                                    24-May-2024 16:04                1979
intro.exec.php                                     24-May-2024 16:04                1748
intro.exif.php                                     24-May-2024 16:04                1491
intro.expect.php                                   24-May-2024 16:04                1450
intro.fann.php                                     24-May-2024 16:04                1429
intro.fdf.php                                      24-May-2024 16:04                3845
intro.ffi.php                                      24-May-2024 16:03                2877
intro.fileinfo.php                                 24-May-2024 16:04                1415
intro.filesystem.php                               24-May-2024 16:04                1460
intro.filter.php                                   24-May-2024 16:04                2839
intro.fpm.php                                      24-May-2024 16:04                1330
intro.ftp.php                                      24-May-2024 16:04                1794
intro.funchand.php                                 24-May-2024 16:04                1249
intro.gearman.php                                  24-May-2024 16:04                1680
intro.gender.php                                   24-May-2024 16:04                1348
intro.geoip.php                                    24-May-2024 16:04                1587
intro.gettext.php                                  24-May-2024 16:04                1563
intro.gmagick.php                                  24-May-2024 16:04                1710
intro.gmp.php                                      24-May-2024 16:04                3697
intro.gnupg.php                                    24-May-2024 16:04                1237
intro.hash.php                                     24-May-2024 16:03                1252
intro.hrtime.php                                   24-May-2024 16:04                1680
intro.ibase.php                                    24-May-2024 16:03                3234
intro.ibm-db2.php                                  24-May-2024 16:03                1297
intro.iconv.php                                    24-May-2024 16:04                1973
intro.igbinary.php                                 24-May-2024 16:04                1692
intro.image.php                                    24-May-2024 16:04                6991
intro.imagick.php                                  24-May-2024 16:04                1773
intro.imap.php                                     24-May-2024 16:04                1705
intro.info.php                                     24-May-2024 16:03                1512
intro.inotify.php                                  24-May-2024 16:04                2359
intro.intl.php                                     24-May-2024 16:04                5031
intro.json.php                                     24-May-2024 16:04                1652
intro.ldap.php                                     24-May-2024 16:04                4097
intro.libxml.php                                   24-May-2024 16:04                1785
intro.lua.php                                      24-May-2024 16:04                1285
intro.luasandbox.php                               24-May-2024 16:04                2382
intro.lzf.php                                      24-May-2024 16:03                1438
intro.mail.php                                     24-May-2024 16:04                1234
intro.mailparse.php                                24-May-2024 16:04                1954
intro.math.php                                     24-May-2024 16:04                2026
intro.mbstring.php                                 24-May-2024 16:04                2877
intro.mcrypt.php                                   24-May-2024 16:03                2259
intro.memcache.php                                 24-May-2024 16:04                1701
intro.memcached.php                                24-May-2024 16:04                1894
intro.mhash.php                                    24-May-2024 16:03                2855
intro.misc.php                                     24-May-2024 16:04                1200
intro.mqseries.php                                 24-May-2024 16:04                1761
intro.mysql-xdevapi.php                            24-May-2024 16:03                1897
intro.mysql.php                                    24-May-2024 16:04                1928
intro.mysqli.php                                   24-May-2024 16:03                2179
intro.mysqlnd.php                                  24-May-2024 16:04                1957
intro.network.php                                  24-May-2024 16:04                1176
intro.oauth.php                                    24-May-2024 16:04                1351
intro.oci8.php                                     24-May-2024 16:04                1493
intro.opcache.php                                  24-May-2024 16:03                1547
intro.openal.php                                   24-May-2024 16:03                1270
intro.openssl.php                                  24-May-2024 16:03                1597
intro.outcontrol.php                               24-May-2024 16:03                1827
intro.parallel.php                                 24-May-2024 16:04                6907
intro.parle.php                                    24-May-2024 16:04                3456
intro.password.php                                 24-May-2024 16:03                1434
intro.pcntl.php                                    24-May-2024 16:04                2641
intro.pcre.php                                     24-May-2024 16:04                2855
intro.pdo.php                                      24-May-2024 16:03                2071
intro.pgsql.php                                    24-May-2024 16:04                1595
intro.phar.php                                     24-May-2024 16:03               10038
intro.phpdbg.php                                   24-May-2024 16:03                6058
intro.posix.php                                    24-May-2024 16:04                1747
intro.ps.php                                       24-May-2024 16:04                1779
intro.pspell.php                                   24-May-2024 16:04                1212
intro.pthreads.php                                 24-May-2024 16:04                9166
intro.quickhash.php                                24-May-2024 16:04                1284
intro.radius.php                                   24-May-2024 16:03                2182
intro.random.php                                   24-May-2024 16:04                1126
intro.rar.php                                      24-May-2024 16:03                1558
intro.readline.php                                 24-May-2024 16:03                1983
intro.recode.php                                   24-May-2024 16:04                2289
intro.reflection.php                               24-May-2024 16:04                1792
intro.rnp.php                                      24-May-2024 16:03                1297
intro.rpminfo.php                                  24-May-2024 16:04                1414
intro.rrd.php                                      24-May-2024 16:04                1453
intro.runkit7.php                                  24-May-2024 16:03                1496
intro.scoutapm.php                                 24-May-2024 16:04                1492
intro.seaslog.php                                  24-May-2024 16:04                3950
intro.sem.php                                      24-May-2024 16:04                3240
intro.session.php                                  24-May-2024 16:04                4762
intro.shmop.php                                    24-May-2024 16:04                1258
intro.simdjson.php                                 24-May-2024 16:04                1246
intro.simplexml.php                                24-May-2024 16:04                1336
intro.snmp.php                                     24-May-2024 16:04                1676
intro.soap.php                                     24-May-2024 16:04                1481
intro.sockets.php                                  24-May-2024 16:04                2605
intro.sodium.php                                   24-May-2024 16:03                1347
intro.solr.php                                     24-May-2024 16:04                1802
intro.spl.php                                      24-May-2024 16:04                1592
intro.sqlite3.php                                  24-May-2024 16:04                1177
intro.sqlsrv.php                                   24-May-2024 16:04                2183
intro.ssdeep.php                                   24-May-2024 16:04                1776
intro.ssh2.php                                     24-May-2024 16:04                1358
intro.stats.php                                    24-May-2024 16:04                1528
intro.stomp.php                                    24-May-2024 16:04                1361
intro.stream.php                                   24-May-2024 16:04                3953
intro.strings.php                                  24-May-2024 16:04                1660
intro.svm.php                                      24-May-2024 16:04                1259
intro.svn.php                                      24-May-2024 16:04                1820
intro.swoole.php                                   24-May-2024 16:04                1665
intro.sync.php                                     24-May-2024 16:04                2369
intro.taint.php                                    24-May-2024 16:04                4315
intro.tcpwrap.php                                  24-May-2024 16:04                1290
intro.tidy.php                                     24-May-2024 16:04                1426
intro.tokenizer.php                                24-May-2024 16:04                1530
intro.trader.php                                   24-May-2024 16:04                2405
intro.ui.php                                       24-May-2024 16:04                1218
intro.uodbc.php                                    24-May-2024 16:03                2773
intro.uopz.php                                     24-May-2024 16:03                2302
intro.url.php                                      24-May-2024 16:04                1174
intro.v8js.php                                     24-May-2024 16:04                1245
intro.var.php                                      24-May-2024 16:04                1339
intro.var_representation.php                       24-May-2024 16:04                1446
intro.varnish.php                                  24-May-2024 16:04                1335
intro.wddx.php                                     24-May-2024 16:04                2162
intro.win32service.php                             24-May-2024 16:04                1418
intro.wincache.php                                 24-May-2024 16:03                4907
intro.wkhtmltox.php                                24-May-2024 16:04                1294
intro.xattr.php                                    24-May-2024 16:04                1207
intro.xdiff.php                                    24-May-2024 16:04                2629
intro.xhprof.php                                   24-May-2024 16:03                2811
intro.xlswriter.php                                24-May-2024 16:04                1207
intro.xml.php                                      24-May-2024 16:04                2271
intro.xmldiff.php                                  24-May-2024 16:04                1428
intro.xmlreader.php                                24-May-2024 16:04                1604
intro.xmlrpc.php                                   24-May-2024 16:04                1902
intro.xmlwriter.php                                24-May-2024 16:04                1566
intro.xsl.php                                      24-May-2024 16:04                1355
intro.yac.php                                      24-May-2024 16:03                1219
intro.yaconf.php                                   24-May-2024 16:04                2566
intro.yaf.php                                      24-May-2024 16:04                1567
intro.yaml.php                                     24-May-2024 16:04                1444
intro.yar.php                                      24-May-2024 16:04                1288
intro.yaz.php                                      24-May-2024 16:04                2551
intro.zip.php                                      24-May-2024 16:03                1221
intro.zlib.php                                     24-May-2024 16:03                2753
intro.zmq.php                                      24-May-2024 16:04                1404
intro.zookeeper.php                                24-May-2024 16:04                1465
introduction.php                                   24-May-2024 16:03                1517
iterator.current.php                               24-May-2024 16:03                2181
iterator.key.php                                   24-May-2024 16:03                2565
iterator.next.php                                  24-May-2024 16:03                2425
iterator.rewind.php                                24-May-2024 16:03                2600
iterator.valid.php                                 24-May-2024 16:03                2807
iteratoraggregate.getiterator.php                  24-May-2024 16:03                2871
iteratoriterator.construct.php                     24-May-2024 16:04                3479
iteratoriterator.current.php                       24-May-2024 16:04                2756
iteratoriterator.getinneriterator.php              24-May-2024 16:04                3203
iteratoriterator.key.php                           24-May-2024 16:04                2704
iteratoriterator.next.php                          24-May-2024 16:04                2871
iteratoriterator.rewind.php                        24-May-2024 16:04                2890
iteratoriterator.valid.php                         24-May-2024 16:04                3075
json.configuration.php                             24-May-2024 16:04                1286
json.constants.php                                 24-May-2024 16:04               17006
json.installation.php                              24-May-2024 16:04                1850
json.requirements.php                              24-May-2024 16:04                1256
json.resources.php                                 24-May-2024 16:04                1225
json.setup.php                                     24-May-2024 16:04                1595
jsonserializable.jsonserialize.php                 24-May-2024 16:04               12588
langref.php                                        24-May-2024 16:03               20269
language.attributes.classes.php                    24-May-2024 16:03                6581
language.attributes.overview.php                   24-May-2024 16:03               10212
language.attributes.php                            24-May-2024 16:03                1764
language.attributes.reflection.php                 24-May-2024 16:03                8209
language.attributes.syntax.php                     24-May-2024 16:03                6091
language.basic-syntax.comments.php                 24-May-2024 16:03                3853
language.basic-syntax.instruction-separation.php   24-May-2024 16:03                4318
language.basic-syntax.php                          24-May-2024 16:03                1720
language.basic-syntax.phpmode.php                  24-May-2024 16:03                4755
language.basic-syntax.phptags.php                  24-May-2024 16:03                4968
language.constants.magic.php                       24-May-2024 16:03                5640
language.constants.php                             24-May-2024 16:03                6334
language.constants.predefined.php                  24-May-2024 16:03                1597
language.constants.syntax.php                      24-May-2024 16:03               10097
language.control-structures.php                    24-May-2024 16:03                2801
language.enumerations.backed.php                   24-May-2024 16:03                9882
language.enumerations.basics.php                   24-May-2024 16:03                8057
language.enumerations.constants.php                24-May-2024 16:03                2386
language.enumerations.examples.php                 24-May-2024 16:03                7303
language.enumerations.expressions.php              24-May-2024 16:03                6590
language.enumerations.listing.php                  24-May-2024 16:03                2222
language.enumerations.methods.php                  24-May-2024 16:03               13501
language.enumerations.object-differences.inheri..> 24-May-2024 16:03                6025
language.enumerations.object-differences.php       24-May-2024 16:03                4764
language.enumerations.overview.php                 24-May-2024 16:03                2339
language.enumerations.php                          24-May-2024 16:03                2472
language.enumerations.serialization.php            24-May-2024 16:03                4891
language.enumerations.static-methods.php           24-May-2024 16:03                3239
language.enumerations.traits.php                   24-May-2024 16:03                4339
language.errors.basics.php                         24-May-2024 16:03                4822
language.errors.php                                24-May-2024 16:03                1872
language.errors.php7.php                           24-May-2024 16:03                5754
language.exceptions.extending.php                  24-May-2024 16:03               19360
language.exceptions.php                            24-May-2024 16:03               27425
language.expressions.php                           24-May-2024 16:03               15556
language.fibers.php                                24-May-2024 16:03                6166
language.functions.php                             24-May-2024 16:03                2007
language.generators.comparison.php                 24-May-2024 16:03                8879
language.generators.overview.php                   24-May-2024 16:03                9102
language.generators.php                            24-May-2024 16:03                1622
language.generators.syntax.php                     24-May-2024 16:03               23664
language.namespaces.basics.php                     24-May-2024 16:03               10747
language.namespaces.definition.php                 24-May-2024 16:03                4200
language.namespaces.definitionmultiple.php         24-May-2024 16:03                8941
language.namespaces.dynamic.php                    24-May-2024 16:03                8105
language.namespaces.fallback.php                   24-May-2024 16:03                5920
language.namespaces.faq.php                        24-May-2024 16:03               31199
language.namespaces.global.php                     24-May-2024 16:03                2708
language.namespaces.importing.php                  24-May-2024 16:03               14808
language.namespaces.nested.php                     24-May-2024 16:03                2779
language.namespaces.nsconstants.php                24-May-2024 16:03                8634
language.namespaces.php                            24-May-2024 16:03                2315
language.namespaces.rationale.php                  24-May-2024 16:03                6168
language.namespaces.rules.php                      24-May-2024 16:03               11757
language.oop5.abstract.php                         24-May-2024 16:03               11673
language.oop5.anonymous.php                        24-May-2024 16:03               10415
language.oop5.autoload.php                         24-May-2024 16:03               11707
language.oop5.basic.php                            24-May-2024 16:03               49281
language.oop5.changelog.php                        24-May-2024 16:03               13245
language.oop5.cloning.php                          24-May-2024 16:03                8035
language.oop5.constants.php                        24-May-2024 16:03                7948
language.oop5.decon.php                            24-May-2024 16:03               27870
language.oop5.final.php                            24-May-2024 16:03                5959
language.oop5.inheritance.php                      24-May-2024 16:03               12884
language.oop5.interfaces.php                       24-May-2024 16:03               22643
language.oop5.iterations.php                       24-May-2024 16:03                5833
language.oop5.late-static-bindings.php             24-May-2024 16:03               14258
language.oop5.magic.php                            24-May-2024 16:03               43296
language.oop5.object-comparison.php                24-May-2024 16:03                8740
language.oop5.overloading.php                      24-May-2024 16:03               23752
language.oop5.paamayim-nekudotayim.php             24-May-2024 16:03                8375
language.oop5.php                                  24-May-2024 16:03                3326
language.oop5.properties.php                       24-May-2024 16:03               27010
language.oop5.references.php                       24-May-2024 16:03                5718
language.oop5.serialization.php                    24-May-2024 16:03                7005
language.oop5.static.php                           24-May-2024 16:03                9134
language.oop5.traits.php                           24-May-2024 16:03               34692
language.oop5.variance.php                         24-May-2024 16:03               15718
language.oop5.visibility.php                       24-May-2024 16:03               24285
language.operators.arithmetic.php                  24-May-2024 16:03                6046
language.operators.array.php                       24-May-2024 16:03                9112
language.operators.assignment.php                  24-May-2024 16:03               11676
language.operators.bitwise.php                     24-May-2024 16:03               41457
language.operators.comparison.php                  24-May-2024 16:03               43125
language.operators.errorcontrol.php                24-May-2024 16:03                6131
language.operators.execution.php                   24-May-2024 16:03                3457
language.operators.increment.php                   24-May-2024 16:03               10963
language.operators.logical.php                     24-May-2024 16:03                7793
language.operators.php                             24-May-2024 16:03                4126
language.operators.precedence.php                  24-May-2024 16:03               20644
language.operators.string.php                      24-May-2024 16:03                3169
language.operators.type.php                        24-May-2024 16:03               18618
language.references.arent.php                      24-May-2024 16:03                3293
language.references.pass.php                       24-May-2024 16:03                6899
language.references.php                            24-May-2024 16:03                2014
language.references.return.php                     24-May-2024 16:03                7512
language.references.spot.php                       24-May-2024 16:03                2810
language.references.unset.php                      24-May-2024 16:03                2350
language.references.whatare.php                    24-May-2024 16:03                2146
language.references.whatdo.php                     24-May-2024 16:03               19346
language.types.array.php                           24-May-2024 16:03              100105
language.types.boolean.php                         24-May-2024 16:03                9580
language.types.callable.php                        24-May-2024 16:03               12060
language.types.declarations.php                    24-May-2024 16:03               53299
language.types.enumerations.php                    24-May-2024 16:03                3662
language.types.float.php                           24-May-2024 16:03                9764
language.types.integer.php                         24-May-2024 16:03               18354
language.types.intro.php                           24-May-2024 16:03                8607
language.types.iterable.php                        24-May-2024 16:03                2969
language.types.mixed.php                           24-May-2024 16:03                1724
language.types.never.php                           24-May-2024 16:03                1943
language.types.null.php                            24-May-2024 16:03                3768
language.types.numeric-strings.php                 24-May-2024 16:03               10945
language.types.object.php                          24-May-2024 16:03                5621
language.types.php                                 24-May-2024 16:03                2790
language.types.relative-class-types.php            24-May-2024 16:03                2384
language.types.resource.php                        24-May-2024 16:03                3157
language.types.string.php                          24-May-2024 16:03               79789
language.types.type-juggling.php                   24-May-2024 16:03               26579
language.types.type-system.php                     24-May-2024 16:03                8419
language.types.value.php                           24-May-2024 16:03                2171
language.types.void.php                            24-May-2024 16:03                1970
language.variables.basics.php                      24-May-2024 16:03               13412
language.variables.external.php                    24-May-2024 16:03               17143
language.variables.php                             24-May-2024 16:03                1753
language.variables.predefined.php                  24-May-2024 16:03                2838
language.variables.scope.php                       24-May-2024 16:03               27708
language.variables.superglobals.php                24-May-2024 16:03                4247
language.variables.variable.php                    24-May-2024 16:03               10072
ldap.configuration.php                             24-May-2024 16:04                2434
ldap.constants.php                                 24-May-2024 16:04               32818
ldap.controls.php                                  24-May-2024 16:04                9922
ldap.examples-basic.php                            24-May-2024 16:04                8117
ldap.examples-controls.php                         24-May-2024 16:04               15992
ldap.examples.php                                  24-May-2024 16:04                1443
ldap.installation.php                              24-May-2024 16:04                2857
ldap.requirements.php                              24-May-2024 16:04                1543
ldap.resources.php                                 24-May-2024 16:04                1436
ldap.setup.php                                     24-May-2024 16:04                1622
ldap.using.php                                     24-May-2024 16:04                2249
libxml.configuration.php                           24-May-2024 16:04                1300
libxml.constants.php                               24-May-2024 16:04               13606
libxml.installation.php                            24-May-2024 16:04                2610
libxml.requirements.php                            24-May-2024 16:04                1299
libxml.resources.php                               24-May-2024 16:04                1239
libxml.setup.php                                   24-May-2024 16:04                1637
limititerator.construct.php                        24-May-2024 16:04                7344
limititerator.current.php                          24-May-2024 16:04                3589
limititerator.getposition.php                      24-May-2024 16:04                5771
limititerator.key.php                              24-May-2024 16:04                3639
limititerator.next.php                             24-May-2024 16:04                3329
limititerator.rewind.php                           24-May-2024 16:04                3497
limititerator.seek.php                             24-May-2024 16:04                4149
limititerator.valid.php                            24-May-2024 16:04                3555
locale.acceptfromhttp.php                          24-May-2024 16:04                6254
locale.canonicalize.php                            24-May-2024 16:04                3216
locale.composelocale.php                           24-May-2024 16:04               13475
locale.filtermatches.php                           24-May-2024 16:04                9312
locale.getallvariants.php                          24-May-2024 16:04                6710
locale.getdefault.php                              24-May-2024 16:04                5887
locale.getdisplaylanguage.php                      24-May-2024 16:04                9923
locale.getdisplayname.php                          24-May-2024 16:04                9905
locale.getdisplayregion.php                        24-May-2024 16:04                9871
locale.getdisplayscript.php                        24-May-2024 16:04                9878
locale.getdisplayvariant.php                       24-May-2024 16:04                9917
locale.getkeywords.php                             24-May-2024 16:04                7322
locale.getprimarylanguage.php                      24-May-2024 16:04                6111
locale.getregion.php                               24-May-2024 16:04                6052
locale.getscript.php                               24-May-2024 16:04                5730
locale.lookup.php                                  24-May-2024 16:04               10209
locale.parselocale.php                             24-May-2024 16:04                7433
locale.setdefault.php                              24-May-2024 16:04                5397
lua.assign.php                                     24-May-2024 16:04                4658
lua.call.php                                       24-May-2024 16:04                7548
lua.configuration.php                              24-May-2024 16:04                1279
lua.construct.php                                  24-May-2024 16:04                2448
lua.eval.php                                       24-May-2024 16:04                3809
lua.getversion.php                                 24-May-2024 16:04                2326
lua.include.php                                    24-May-2024 16:04                2752
lua.installation.php                               24-May-2024 16:04                2090
lua.registercallback.php                           24-May-2024 16:04                4606
lua.requirements.php                               24-May-2024 16:04                1306
lua.resources.php                                  24-May-2024 16:04                1223
lua.setup.php                                      24-May-2024 16:04                1582
luaclosure.invoke.php                              24-May-2024 16:04                4166
luasandbox.callfunction.php                        24-May-2024 16:04                5091
luasandbox.configuration.php                       24-May-2024 16:04                1328
luasandbox.disableprofiler.php                     24-May-2024 16:04                2915
luasandbox.enableprofiler.php                      24-May-2024 16:04                3543
luasandbox.examples-basic.php                      24-May-2024 16:04                6646
luasandbox.examples.php                            24-May-2024 16:04                1503
luasandbox.getcpuusage.php                         24-May-2024 16:04                3658
luasandbox.getmemoryusage.php                      24-May-2024 16:04                3238
luasandbox.getpeakmemoryusage.php                  24-May-2024 16:04                3288
luasandbox.getprofilerfunctionreport.php           24-May-2024 16:04                6035
luasandbox.getversioninfo.php                      24-May-2024 16:04                3148
luasandbox.installation.php                        24-May-2024 16:04                2188
luasandbox.loadbinary.php                          24-May-2024 16:04                3672
luasandbox.loadstring.php                          24-May-2024 16:04                5663
luasandbox.pauseusagetimer.php                     24-May-2024 16:04                9461
luasandbox.registerlibrary.php                     24-May-2024 16:04                6676
luasandbox.requirements.php                        24-May-2024 16:04                1792
luasandbox.resources.php                           24-May-2024 16:04                1288
luasandbox.setcpulimit.php                         24-May-2024 16:04                6187
luasandbox.setmemorylimit.php                      24-May-2024 16:04                5592
luasandbox.setup.php                               24-May-2024 16:04                1673
luasandbox.unpauseusagetimer.php                   24-May-2024 16:04                3211
luasandbox.wrapphpfunction.php                     24-May-2024 16:04                4410
luasandboxfunction.call.php                        24-May-2024 16:04                8070
luasandboxfunction.construct.php                   24-May-2024 16:04                2725
luasandboxfunction.dump.php                        24-May-2024 16:04                2489
lzf.configuration.php                              24-May-2024 16:03                1279
lzf.constants.php                                  24-May-2024 16:03                1171
lzf.installation.php                               24-May-2024 16:03                2538
lzf.requirements.php                               24-May-2024 16:03                1215
lzf.resources.php                                  24-May-2024 16:03                1218
lzf.setup.php                                      24-May-2024 16:03                1603
mail.configuration.php                             24-May-2024 16:04                8217
mail.constants.php                                 24-May-2024 16:04                1180
mail.installation.php                              24-May-2024 16:04                1265
mail.requirements.php                              24-May-2024 16:04                1903
mail.resources.php                                 24-May-2024 16:04                1225
mail.setup.php                                     24-May-2024 16:04                1617
mailparse.configuration.php                        24-May-2024 16:04                2561
mailparse.constants.php                            24-May-2024 16:04                2398
mailparse.installation.php                         24-May-2024 16:04                2548
mailparse.requirements.php                         24-May-2024 16:04                1257
mailparse.resources.php                            24-May-2024 16:04                1579
mailparse.setup.php                                24-May-2024 16:04                1681
manual.php                                         24-May-2024 16:03                1291
math.configuration.php                             24-May-2024 16:04                1286
math.constants.php                                 24-May-2024 16:04                7223
math.installation.php                              24-May-2024 16:04                1265
math.requirements.php                              24-May-2024 16:04                1222
math.resources.php                                 24-May-2024 16:04                1225
math.setup.php                                     24-May-2024 16:04                1611
mbstring.configuration.php                         24-May-2024 16:04               16271
mbstring.constants.php                             24-May-2024 16:04                6846
mbstring.encodings.php                             24-May-2024 16:04               15449
mbstring.http.php                                  24-May-2024 16:04                5106
mbstring.installation.php                          24-May-2024 16:04                3355
mbstring.ja-basic.php                              24-May-2024 16:04                3730
mbstring.overload.php                              24-May-2024 16:04                7224
mbstring.php4.req.php                              24-May-2024 16:04                4031
mbstring.requirements.php                          24-May-2024 16:04                1250
mbstring.resources.php                             24-May-2024 16:04                1253
mbstring.setup.php                                 24-May-2024 16:04                1681
mbstring.supported-encodings.php                   24-May-2024 16:04                8221
mcrypt.ciphers.php                                 24-May-2024 16:03                6263
mcrypt.configuration.php                           24-May-2024 16:03                3699
mcrypt.constants.php                               24-May-2024 16:03                6473
mcrypt.installation.php                            24-May-2024 16:03                1860
mcrypt.requirements.php                            24-May-2024 16:03                2153
mcrypt.resources.php                               24-May-2024 16:03                1339
mcrypt.setup.php                                   24-May-2024 16:03                1648
memcache.add.php                                   24-May-2024 16:04                7280
memcache.addserver.php                             24-May-2024 16:04               13820
memcache.close.php                                 24-May-2024 16:04                5220
memcache.connect.php                               24-May-2024 16:04                7480
memcache.constants.php                             24-May-2024 16:04                5193
memcache.decrement.php                             24-May-2024 16:04                7294
memcache.delete.php                                24-May-2024 16:04                6588
memcache.examples-overview.php                     24-May-2024 16:04                6452
memcache.examples.php                              24-May-2024 16:04                1432
memcache.flush.php                                 24-May-2024 16:04                4635
memcache.get.php                                   24-May-2024 16:04                8880
memcache.getextendedstats.php                      24-May-2024 16:04                8246
memcache.getserverstatus.php                       24-May-2024 16:04                6218
memcache.getstats.php                              24-May-2024 16:04                4870
memcache.getversion.php                            24-May-2024 16:04                5085
memcache.increment.php                             24-May-2024 16:04                7092
memcache.ini.php                                   24-May-2024 16:04               10716
memcache.installation.php                          24-May-2024 16:04                2194
memcache.pconnect.php                              24-May-2024 16:04                6322
memcache.replace.php                               24-May-2024 16:04                7383
memcache.requirements.php                          24-May-2024 16:04                1382
memcache.resources.php                             24-May-2024 16:04                1317
memcache.set.php                                   24-May-2024 16:04                9741
memcache.setcompressthreshold.php                  24-May-2024 16:04                6069
memcache.setserverparams.php                       24-May-2024 16:04               11241
memcache.setup.php                                 24-May-2024 16:04                1663
memcached.add.php                                  24-May-2024 16:04                4712
memcached.addbykey.php                             24-May-2024 16:04                5708
memcached.addserver.php                            24-May-2024 16:04                7722
memcached.addservers.php                           24-May-2024 16:04                5482
memcached.append.php                               24-May-2024 16:04                7531
memcached.appendbykey.php                          24-May-2024 16:04                5265
memcached.callbacks.php                            24-May-2024 16:04                1550
memcached.callbacks.read-through.php               24-May-2024 16:04                4380
memcached.callbacks.result.php                     24-May-2024 16:04                4880
memcached.cas.php                                  24-May-2024 16:04                9485
memcached.casbykey.php                             24-May-2024 16:04                6034
memcached.configuration.php                        24-May-2024 16:04               28360
memcached.constants.php                            24-May-2024 16:04               29447
memcached.construct.php                            24-May-2024 16:04                5743
memcached.decrement.php                            24-May-2024 16:04                9180
memcached.decrementbykey.php                       24-May-2024 16:04                6070
memcached.delete.php                               24-May-2024 16:04                5701
memcached.deletebykey.php                          24-May-2024 16:04                5685
memcached.deletemulti.php                          24-May-2024 16:04                4858
memcached.deletemultibykey.php                     24-May-2024 16:04                5865
memcached.expiration.php                           24-May-2024 16:04                1949
memcached.fetch.php                                24-May-2024 16:04                6790
memcached.fetchall.php                             24-May-2024 16:04                6550
memcached.flush.php                                24-May-2024 16:04                4720
memcached.get.php                                  24-May-2024 16:04               10500
memcached.getallkeys.php                           24-May-2024 16:04                3097
memcached.getbykey.php                             24-May-2024 16:04                6718
memcached.getdelayed.php                           24-May-2024 16:04                8860
memcached.getdelayedbykey.php                      24-May-2024 16:04                5863
memcached.getmulti.php                             24-May-2024 16:04               20850
memcached.getmultibykey.php                        24-May-2024 16:04                5719
memcached.getoption.php                            24-May-2024 16:04                5206
memcached.getresultcode.php                        24-May-2024 16:04                4296
memcached.getresultmessage.php                     24-May-2024 16:04                4736
memcached.getserverbykey.php                       24-May-2024 16:04                7451
memcached.getserverlist.php                        24-May-2024 16:04                4650
memcached.getstats.php                             24-May-2024 16:04                5787
memcached.getversion.php                           24-May-2024 16:04                4037
memcached.increment.php                            24-May-2024 16:04                8510
memcached.incrementbykey.php                       24-May-2024 16:04                6003
memcached.installation.php                         24-May-2024 16:04                2686
memcached.ispersistent.php                         24-May-2024 16:04                3053
memcached.ispristine.php                           24-May-2024 16:04                2980
memcached.prepend.php                              24-May-2024 16:04                7562
memcached.prependbykey.php                         24-May-2024 16:04                5294
memcached.quit.php                                 24-May-2024 16:04                2506
memcached.replace.php                              24-May-2024 16:04                4784
memcached.replacebykey.php                         24-May-2024 16:04                5795
memcached.requirements.php                         24-May-2024 16:04                1556
memcached.resetserverlist.php                      24-May-2024 16:04                3220
memcached.resources.php                            24-May-2024 16:04                1260
memcached.sessions.php                             24-May-2024 16:04                2452
memcached.set.php                                  24-May-2024 16:04                9193
memcached.setbykey.php                             24-May-2024 16:04                7078
memcached.setmulti.php                             24-May-2024 16:04                6257
memcached.setmultibykey.php                        24-May-2024 16:04                5017
memcached.setoption.php                            24-May-2024 16:04                7377
memcached.setoptions.php                           24-May-2024 16:04                6996
memcached.setsaslauthdata.php                      24-May-2024 16:04                3567
memcached.setup.php                                24-May-2024 16:04                1681
memcached.touch.php                                24-May-2024 16:04                3780
memcached.touchbykey.php                           24-May-2024 16:04                4731
messageformatter.create.php                        24-May-2024 16:04               11070
messageformatter.format.php                        24-May-2024 16:04                9741
messageformatter.formatmessage.php                 24-May-2024 16:04               14488
messageformatter.geterrorcode.php                  24-May-2024 16:04                4024
messageformatter.geterrormessage.php               24-May-2024 16:04                7660
messageformatter.getlocale.php                     24-May-2024 16:04                5517
messageformatter.getpattern.php                    24-May-2024 16:04               10114
messageformatter.parse.php                         24-May-2024 16:04                9854
messageformatter.parsemessage.php                  24-May-2024 16:04               10051
messageformatter.setpattern.php                    24-May-2024 16:04               10658
mhash.configuration.php                            24-May-2024 16:03                1293
mhash.constants.php                                24-May-2024 16:03                7220
mhash.examples.php                                 24-May-2024 16:03                3328
mhash.installation.php                             24-May-2024 16:03                1636
mhash.requirements.php                             24-May-2024 16:03                1363
mhash.resources.php                                24-May-2024 16:03                1232
mhash.setup.php                                    24-May-2024 16:03                1629
migration56.changed-functions.php                  24-May-2024 16:04                6927
migration56.constants.php                          24-May-2024 16:04                6797
migration56.deprecated.php                         24-May-2024 16:04                6284
migration56.extensions.php                         24-May-2024 16:04                4373
migration56.incompatible.php                       24-May-2024 16:04                8515
migration56.new-features.php                       24-May-2024 16:04               28965
migration56.new-functions.php                      24-May-2024 16:04                7555
migration56.openssl.php                            24-May-2024 16:04               26830
migration56.php                                    24-May-2024 16:04                2443
migration70.changed-functions.php                  24-May-2024 16:04                5249
migration70.classes.php                            24-May-2024 16:04                3935
migration70.constants.php                          24-May-2024 16:04                9523
migration70.deprecated.php                         24-May-2024 16:04                5726
migration70.incompatible.php                       24-May-2024 16:04               62243
migration70.new-features.php                       24-May-2024 16:04               42515
migration70.new-functions.php                      24-May-2024 16:04                7393
migration70.other-changes.php                      24-May-2024 16:04                3458
migration70.php                                    24-May-2024 16:04                2833
migration70.removed-exts-sapis.php                 24-May-2024 16:04                3189
migration70.sapi-changes.php                       24-May-2024 16:04                2034
migration71.changed-functions.php                  24-May-2024 16:04                7628
migration71.constants.php                          24-May-2024 16:04                8806
migration71.deprecated.php                         24-May-2024 16:04                2306
migration71.incompatible.php                       24-May-2024 16:04               32299
migration71.new-features.php                       24-May-2024 16:04               27329
migration71.new-functions.php                      24-May-2024 16:04                5090
migration71.other-changes.php                      24-May-2024 16:04                8627
migration71.php                                    24-May-2024 16:04                2497
migration71.windows-support.php                    24-May-2024 16:04                7185
migration72.constants.php                          24-May-2024 16:04               31998
migration72.deprecated.php                         24-May-2024 16:04               10523
migration72.incompatible.php                       24-May-2024 16:04               19732
migration72.new-features.php                       24-May-2024 16:04               19006
migration72.new-functions.php                      24-May-2024 16:04               24434
migration72.other-changes.php                      24-May-2024 16:04                5900
migration72.php                                    24-May-2024 16:04                2396
migration73.constants.php                          24-May-2024 16:04               26178
migration73.deprecated.php                         24-May-2024 16:04                8769
migration73.incompatible.php                       24-May-2024 16:04               18136
migration73.new-features.php                       24-May-2024 16:04               16804
migration73.new-functions.php                      24-May-2024 16:04                7464
migration73.other-changes.php                      24-May-2024 16:04               16576
migration73.php                                    24-May-2024 16:04                2513
migration73.windows-support.php                    24-May-2024 16:04                1861
migration74.constants.php                          24-May-2024 16:04                7802
migration74.deprecated.php                         24-May-2024 16:04               15301
migration74.incompatible.php                       24-May-2024 16:04               18580
migration74.new-classes.php                        24-May-2024 16:04                1541
migration74.new-features.php                       24-May-2024 16:04               21994
migration74.new-functions.php                      24-May-2024 16:04                3757
migration74.other-changes.php                      24-May-2024 16:04               21284
migration74.php                                    24-May-2024 16:04                2728
migration74.removed-extensions.php                 24-May-2024 16:04                1949
migration74.windows-support.php                    24-May-2024 16:04                3814
migration80.deprecated.php                         24-May-2024 16:04               18810
migration80.incompatible.php                       24-May-2024 16:04               99044
migration80.new-features.php                       24-May-2024 16:04               32558
migration80.other-changes.php                      24-May-2024 16:04               15142
migration80.php                                    24-May-2024 16:04                2380
migration81.constants.php                          24-May-2024 16:04                8309
migration81.deprecated.php                         24-May-2024 16:04               19489
migration81.incompatible.php                       24-May-2024 16:04               23298
migration81.new-classes.php                        24-May-2024 16:04                2177
migration81.new-features.php                       24-May-2024 16:04               23965
migration81.new-functions.php                      24-May-2024 16:04                8517
migration81.other-changes.php                      24-May-2024 16:04                9872
migration81.php                                    24-May-2024 16:04                2600
migration82.constants.php                          24-May-2024 16:04               22202
migration82.deprecated.php                         24-May-2024 16:04                5911
migration82.incompatible.php                       24-May-2024 16:04                9681
migration82.new-features.php                       24-May-2024 16:04                7237
migration82.new-functions.php                      24-May-2024 16:04                4328
migration82.other-changes.php                      24-May-2024 16:04               25831
migration82.php                                    24-May-2024 16:04                2646
migration82.windows-support.php                    24-May-2024 16:04                2351
migration83.constants.php                          24-May-2024 16:04               15547
migration83.deprecated.php                         24-May-2024 16:04                7752
migration83.incompatible.php                       24-May-2024 16:04               14742
migration83.new-classes.php                        24-May-2024 16:04                3429
migration83.new-features.php                       24-May-2024 16:04                7289
migration83.new-functions.php                      24-May-2024 16:04                7347
migration83.other-changes.php                      24-May-2024 16:04               32041
migration83.php                                    24-May-2024 16:04                2787
migration83.windows-support.php                    24-May-2024 16:04                1427
misc.configuration.php                             24-May-2024 16:04                6072
misc.constants.php                                 24-May-2024 16:04                2614
misc.installation.php                              24-May-2024 16:04                1265
misc.requirements.php                              24-May-2024 16:04                1222
misc.resources.php                                 24-May-2024 16:04                1225
misc.setup.php                                     24-May-2024 16:04                1601
mongodb-bson-binary.construct.php                  24-May-2024 16:03                7996
mongodb-bson-binary.getdata.php                    24-May-2024 16:03                4467
mongodb-bson-binary.gettype.php                    24-May-2024 16:03                4449
mongodb-bson-binary.jsonserialize.php              24-May-2024 16:03                5438
mongodb-bson-binary.serialize.php                  24-May-2024 16:03                3530
mongodb-bson-binary.tostring.php                   24-May-2024 16:03                4253
mongodb-bson-binary.unserialize.php                24-May-2024 16:03                4379
mongodb-bson-binaryinterface.getdata.php           24-May-2024 16:03                2891
mongodb-bson-binaryinterface.gettype.php           24-May-2024 16:03                2901
mongodb-bson-binaryinterface.tostring.php          24-May-2024 16:03                3356
mongodb-bson-dbpointer.construct.php               24-May-2024 16:03                2714
mongodb-bson-dbpointer.jsonserialize.php           24-May-2024 16:03                5507
mongodb-bson-dbpointer.serialize.php               24-May-2024 16:03                3605
mongodb-bson-dbpointer.tostring.php                24-May-2024 16:03                2733
mongodb-bson-dbpointer.unserialize.php             24-May-2024 16:03                3878
mongodb-bson-decimal128.construct.php              24-May-2024 16:03                5829
mongodb-bson-decimal128.jsonserialize.php          24-May-2024 16:03                5528
mongodb-bson-decimal128.serialize.php              24-May-2024 16:03                3630
mongodb-bson-decimal128.tostring.php               24-May-2024 16:03                4603
mongodb-bson-decimal128.unserialize.php            24-May-2024 16:03                4471
mongodb-bson-decimal128interface.tostring.php      24-May-2024 16:03                3054
mongodb-bson-document.construct.php                24-May-2024 16:03                3328
mongodb-bson-document.frombson.php                 24-May-2024 16:03                4095
mongodb-bson-document.fromjson.php                 24-May-2024 16:03                4608
mongodb-bson-document.fromphp.php                  24-May-2024 16:03                4330
mongodb-bson-document.get.php                      24-May-2024 16:03                4302
mongodb-bson-document.getiterator.php              24-May-2024 16:03                3571
mongodb-bson-document.has.php                      24-May-2024 16:03                3828
mongodb-bson-document.serialize.php                24-May-2024 16:03                3594
mongodb-bson-document.tocanonicalextendedjson.php  24-May-2024 16:03               12775
mongodb-bson-document.tophp.php                    24-May-2024 16:03                5480
mongodb-bson-document.torelaxedextendedjson.php    24-May-2024 16:03               12492
mongodb-bson-document.tostring.php                 24-May-2024 16:03                2807
mongodb-bson-document.unserialize.php              24-May-2024 16:03                4427
mongodb-bson-int64.construct.php                   24-May-2024 16:03                4816
mongodb-bson-int64.jsonserialize.php               24-May-2024 16:03                5182
mongodb-bson-int64.serialize.php                   24-May-2024 16:03                3507
mongodb-bson-int64.tostring.php                    24-May-2024 16:03                3921
mongodb-bson-int64.unserialize.php                 24-May-2024 16:03                4350
mongodb-bson-iterator.construct.php                24-May-2024 16:03                3416
mongodb-bson-iterator.current.php                  24-May-2024 16:03                3664
mongodb-bson-iterator.key.php                      24-May-2024 16:03                3661
mongodb-bson-iterator.next.php                     24-May-2024 16:03                2447
mongodb-bson-iterator.rewind.php                   24-May-2024 16:03                2487
mongodb-bson-iterator.valid.php                    24-May-2024 16:03                2870
mongodb-bson-javascript.construct.php              24-May-2024 16:03                7307
mongodb-bson-javascript.getcode.php                24-May-2024 16:03                4439
mongodb-bson-javascript.getscope.php               24-May-2024 16:03                5415
mongodb-bson-javascript.jsonserialize.php          24-May-2024 16:03                5524
mongodb-bson-javascript.serialize.php              24-May-2024 16:03                3630
mongodb-bson-javascript.tostring.php               24-May-2024 16:03                4247
mongodb-bson-javascript.unserialize.php            24-May-2024 16:03                4463
mongodb-bson-javascriptinterface.getcode.php       24-May-2024 16:03                2985
mongodb-bson-javascriptinterface.getscope.php      24-May-2024 16:03                3150
mongodb-bson-javascriptinterface.tostring.php      24-May-2024 16:03                3454
mongodb-bson-maxkey.construct.php                  24-May-2024 16:03                3692
mongodb-bson-maxkey.jsonserialize.php              24-May-2024 16:03                5444
mongodb-bson-maxkey.serialize.php                  24-May-2024 16:03                3534
mongodb-bson-maxkey.unserialize.php                24-May-2024 16:03                3811
mongodb-bson-minkey.construct.php                  24-May-2024 16:03                3692
mongodb-bson-minkey.jsonserialize.php              24-May-2024 16:03                5444
mongodb-bson-minkey.serialize.php                  24-May-2024 16:03                3534
mongodb-bson-minkey.unserialize.php                24-May-2024 16:03                3815
mongodb-bson-objectid.construct.php                24-May-2024 16:03                5319
mongodb-bson-objectid.gettimestamp.php             24-May-2024 16:03                5543
mongodb-bson-objectid.jsonserialize.php            24-May-2024 16:03                5490
mongodb-bson-objectid.serialize.php                24-May-2024 16:03                3582
mongodb-bson-objectid.tostring.php                 24-May-2024 16:03                4249
mongodb-bson-objectid.unserialize.php              24-May-2024 16:03                4417
mongodb-bson-objectidinterface.gettimestamp.php    24-May-2024 16:03                3054
mongodb-bson-objectidinterface.tostring.php        24-May-2024 16:03                3038
mongodb-bson-packedarray.construct.php             24-May-2024 16:03                2948
mongodb-bson-packedarray.fromphp.php               24-May-2024 16:03                4011
mongodb-bson-packedarray.get.php                   24-May-2024 16:03                4353
mongodb-bson-packedarray.getiterator.php           24-May-2024 16:03                3625
mongodb-bson-packedarray.has.php                   24-May-2024 16:03                3882
mongodb-bson-packedarray.serialize.php             24-May-2024 16:03                3626
mongodb-bson-packedarray.tophp.php                 24-May-2024 16:03                4699
mongodb-bson-packedarray.tostring.php              24-May-2024 16:03                2823
mongodb-bson-packedarray.unserialize.php           24-May-2024 16:03                4483
mongodb-bson-persistable.bsonserialize.php         24-May-2024 16:03                6201
mongodb-bson-regex.construct.php                   24-May-2024 16:03                7068
mongodb-bson-regex.getflags.php                    24-May-2024 16:03                4558
mongodb-bson-regex.getpattern.php                  24-May-2024 16:03                4420
mongodb-bson-regex.jsonserialize.php               24-May-2024 16:03                5423
mongodb-bson-regex.serialize.php                   24-May-2024 16:03                3505
mongodb-bson-regex.tostring.php                    24-May-2024 16:03                3948
mongodb-bson-regex.unserialize.php                 24-May-2024 16:03                4354
mongodb-bson-regexinterface.getflags.php           24-May-2024 16:03                2890
mongodb-bson-regexinterface.getpattern.php         24-May-2024 16:03                2933
mongodb-bson-regexinterface.tostring.php           24-May-2024 16:03                2964
mongodb-bson-serializable.bsonserialize.php        24-May-2024 16:03               16660
mongodb-bson-symbol.construct.php                  24-May-2024 16:03                2654
mongodb-bson-symbol.jsonserialize.php              24-May-2024 16:03                5444
mongodb-bson-symbol.serialize.php                  24-May-2024 16:03                3530
mongodb-bson-symbol.tostring.php                   24-May-2024 16:03                2711
mongodb-bson-symbol.unserialize.php                24-May-2024 16:03                3817
mongodb-bson-timestamp.construct.php               24-May-2024 16:03                4869
mongodb-bson-timestamp.getincrement.php            24-May-2024 16:03                4353
mongodb-bson-timestamp.gettimestamp.php            24-May-2024 16:03                4338
mongodb-bson-timestamp.jsonserialize.php           24-May-2024 16:03                5511
mongodb-bson-timestamp.serialize.php               24-May-2024 16:03                3605
mongodb-bson-timestamp.tostring.php                24-May-2024 16:03                4091
mongodb-bson-timestamp.unserialize.php             24-May-2024 16:03                4450
mongodb-bson-timestampinterface.getincrement.php   24-May-2024 16:03                3417
mongodb-bson-timestampinterface.gettimestamp.php   24-May-2024 16:03                3432
mongodb-bson-timestampinterface.tostring.php       24-May-2024 16:03                3056
mongodb-bson-undefined.construct.php               24-May-2024 16:03                2714
mongodb-bson-undefined.jsonserialize.php           24-May-2024 16:03                5507
mongodb-bson-undefined.serialize.php               24-May-2024 16:03                3605
mongodb-bson-undefined.tostring.php                24-May-2024 16:03                2733
mongodb-bson-undefined.unserialize.php             24-May-2024 16:03                3879
mongodb-bson-unserializable.bsonunserialize.php    24-May-2024 16:03                7120
mongodb-bson-utcdatetime.construct.php             24-May-2024 16:03                8219
mongodb-bson-utcdatetime.jsonserialize.php         24-May-2024 16:03                5549
mongodb-bson-utcdatetime.serialize.php             24-May-2024 16:03                3657
mongodb-bson-utcdatetime.todatetime.php            24-May-2024 16:03                5889
mongodb-bson-utcdatetime.tostring.php              24-May-2024 16:03                4046
mongodb-bson-utcdatetime.unserialize.php           24-May-2024 16:03                4482
mongodb-bson-utcdatetimeinterface.todatetime.php   24-May-2024 16:03                3333
mongodb-bson-utcdatetimeinterface.tostring.php     24-May-2024 16:03                3072
mongodb-driver-bulkwrite.construct.php             24-May-2024 16:03               18710
mongodb-driver-bulkwrite.count.php                 24-May-2024 16:03                6993
mongodb-driver-bulkwrite.delete.php                24-May-2024 16:03               12096
mongodb-driver-bulkwrite.insert.php                24-May-2024 16:03                9668
mongodb-driver-bulkwrite.update.php                24-May-2024 16:03               15706
mongodb-driver-clientencryption.addkeyaltname.php  24-May-2024 16:03                5606
mongodb-driver-clientencryption.construct.php      24-May-2024 16:03               11355
mongodb-driver-clientencryption.createdatakey.php  24-May-2024 16:03               11044
mongodb-driver-clientencryption.decrypt.php        24-May-2024 16:03                4247
mongodb-driver-clientencryption.deletekey.php      24-May-2024 16:03                4347
mongodb-driver-clientencryption.encrypt.php        24-May-2024 16:03               12872
mongodb-driver-clientencryption.encryptexpressi..> 24-May-2024 16:03               14572
mongodb-driver-clientencryption.getkey.php         24-May-2024 16:03                4480
mongodb-driver-clientencryption.getkeybyaltname..> 24-May-2024 16:03                5076
mongodb-driver-clientencryption.getkeys.php        24-May-2024 16:03                3903
mongodb-driver-clientencryption.removekeyaltnam..> 24-May-2024 16:03                5671
mongodb-driver-clientencryption.rewrapmanydatak..> 24-May-2024 16:03               12213
mongodb-driver-command.construct.php               24-May-2024 16:03               14295
mongodb-driver-commandexception.getresultdocume..> 24-May-2024 16:03                3306
mongodb-driver-cursor.construct.php                24-May-2024 16:03                3388
mongodb-driver-cursor.current.php                  24-May-2024 16:03                3152
mongodb-driver-cursor.getid.php                    24-May-2024 16:03                7660
mongodb-driver-cursor.getserver.php                24-May-2024 16:03                7553
mongodb-driver-cursor.isdead.php                   24-May-2024 16:03               10676
mongodb-driver-cursor.key.php                      24-May-2024 16:03                2707
mongodb-driver-cursor.next.php                     24-May-2024 16:03                3555
mongodb-driver-cursor.rewind.php                   24-May-2024 16:03                4011
mongodb-driver-cursor.settypemap.php               24-May-2024 16:03                8027
mongodb-driver-cursor.toarray.php                  24-May-2024 16:03                7746
mongodb-driver-cursor.valid.php                    24-May-2024 16:03                2895
mongodb-driver-cursorid.construct.php              24-May-2024 16:03                2876
mongodb-driver-cursorid.serialize.php              24-May-2024 16:03                3628
mongodb-driver-cursorid.tostring.php               24-May-2024 16:03                7045
mongodb-driver-cursorid.unserialize.php            24-May-2024 16:03                4489
mongodb-driver-cursorinterface.getid.php           24-May-2024 16:03                4065
mongodb-driver-cursorinterface.getserver.php       24-May-2024 16:03                4166
mongodb-driver-cursorinterface.isdead.php          24-May-2024 16:03                4129
mongodb-driver-cursorinterface.settypemap.php      24-May-2024 16:03                4166
mongodb-driver-cursorinterface.toarray.php         24-May-2024 16:03                4028
mongodb-driver-manager.addsubscriber.php           24-May-2024 16:03                5593
mongodb-driver-manager.construct.php               24-May-2024 16:03               80147
mongodb-driver-manager.createclientencryption.php  24-May-2024 16:03               12689
mongodb-driver-manager.executebulkwrite.php        24-May-2024 16:03               23269
mongodb-driver-manager.executecommand.php          24-May-2024 16:03               25043
mongodb-driver-manager.executequery.php            24-May-2024 16:03               16581
mongodb-driver-manager.executereadcommand.php      24-May-2024 16:03               10222
mongodb-driver-manager.executereadwritecommand.php 24-May-2024 16:03               11313
mongodb-driver-manager.executewritecommand.php     24-May-2024 16:03               11400
mongodb-driver-manager.getencryptedfieldsmap.php   24-May-2024 16:03                3963
mongodb-driver-manager.getreadconcern.php          24-May-2024 16:03                5957
mongodb-driver-manager.getreadpreference.php       24-May-2024 16:03                6552
mongodb-driver-manager.getservers.php              24-May-2024 16:03                7993
mongodb-driver-manager.getwriteconcern.php         24-May-2024 16:03                6010
mongodb-driver-manager.removesubscriber.php        24-May-2024 16:03                4985
mongodb-driver-manager.selectserver.php            24-May-2024 16:03                7258
mongodb-driver-manager.startsession.php            24-May-2024 16:03               12655
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                3763
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                3690
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                3862
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                3691
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                4889
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                4082
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                4318
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                4244
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                4084
mongodb-driver-monitoring-commandfailedevent.ge..> 24-May-2024 16:03                3868
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:03                4089
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:03                3799
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:03                3701
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:03                5198
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:03                4779
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:03                4535
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:03                4104
mongodb-driver-monitoring-commandstartedevent.g..> 24-May-2024 16:03                3888
mongodb-driver-monitoring-commandsubscriber.com..> 24-May-2024 16:03                4967
mongodb-driver-monitoring-commandsubscriber.com..> 24-May-2024 16:03                5017
mongodb-driver-monitoring-commandsubscriber.com..> 24-May-2024 16:03                5030
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:03                3820
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:03                3747
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:03                3931
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:03                4976
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:03                4139
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:03                4381
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:03                4749
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:03                4144
mongodb-driver-monitoring-commandsucceededevent..> 24-May-2024 16:03                3914
mongodb-driver-monitoring-logsubscriber.log.php    24-May-2024 16:03                4697
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:03                4850
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:03                4820
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:03                5387
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:03                5432
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:03                5463
mongodb-driver-monitoring-sdamsubscriber.server..> 24-May-2024 16:03                4850
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-May-2024 16:03                4925
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-May-2024 16:03                4862
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-May-2024 16:03                4845
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:03                3233
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:03                3549
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:03                3301
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:03                3626
mongodb-driver-monitoring-serverchangedevent.ge..> 24-May-2024 16:03                3349
mongodb-driver-monitoring-serverclosedevent.get..> 24-May-2024 16:03                3195
mongodb-driver-monitoring-serverclosedevent.get..> 24-May-2024 16:03                3245
mongodb-driver-monitoring-serverclosedevent.get..> 24-May-2024 16:03                3305
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:03                3681
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:03                3533
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:03                3370
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:03                3399
mongodb-driver-monitoring-serverheartbeatfailed..> 24-May-2024 16:03                3755
mongodb-driver-monitoring-serverheartbeatstarte..> 24-May-2024 16:03                3375
mongodb-driver-monitoring-serverheartbeatstarte..> 24-May-2024 16:03                3417
mongodb-driver-monitoring-serverheartbeatstarte..> 24-May-2024 16:03                3775
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:03                3733
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:03                3442
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:03                3451
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:03                4276
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-May-2024 16:03                3791
mongodb-driver-monitoring-serveropeningevent.ge..> 24-May-2024 16:03                3213
mongodb-driver-monitoring-serveropeningevent.ge..> 24-May-2024 16:03                3263
mongodb-driver-monitoring-serveropeningevent.ge..> 24-May-2024 16:03                3337
mongodb-driver-monitoring-topologychangedevent...> 24-May-2024 16:03                3618
mongodb-driver-monitoring-topologychangedevent...> 24-May-2024 16:03                3696
mongodb-driver-monitoring-topologychangedevent...> 24-May-2024 16:03                3357
mongodb-driver-monitoring-topologyclosedevent.g..> 24-May-2024 16:03                3302
mongodb-driver-monitoring-topologyopeningevent...> 24-May-2024 16:03                3312
mongodb-driver-query.construct.php                 24-May-2024 16:03               32887
mongodb-driver-readconcern.bsonserialize.php       24-May-2024 16:03                6838
mongodb-driver-readconcern.construct.php           24-May-2024 16:03                5765
mongodb-driver-readconcern.getlevel.php            24-May-2024 16:03                5844
mongodb-driver-readconcern.isdefault.php           24-May-2024 16:03                8118
mongodb-driver-readconcern.serialize.php           24-May-2024 16:03                3705
mongodb-driver-readconcern.unserialize.php         24-May-2024 16:03                4540
mongodb-driver-readpreference.bsonserialize.php    24-May-2024 16:03               10480
mongodb-driver-readpreference.construct.php        24-May-2024 16:03               18493
mongodb-driver-readpreference.gethedge.php         24-May-2024 16:03                3475
mongodb-driver-readpreference.getmaxstalenessse..> 24-May-2024 16:03                8216
mongodb-driver-readpreference.getmode.php          24-May-2024 16:03                7540
mongodb-driver-readpreference.getmodestring.php    24-May-2024 16:03                7746
mongodb-driver-readpreference.gettagsets.php       24-May-2024 16:03                8101
mongodb-driver-readpreference.serialize.php        24-May-2024 16:03                3782
mongodb-driver-readpreference.unserialize.php      24-May-2024 16:03                4619
mongodb-driver-runtimeexception.haserrorlabel.php  24-May-2024 16:03                4325
mongodb-driver-server.construct.php                24-May-2024 16:03                3420
mongodb-driver-server.executebulkwrite.php         24-May-2024 16:03               11552
mongodb-driver-server.executecommand.php           24-May-2024 16:03               13384
mongodb-driver-server.executequery.php             24-May-2024 16:03                8990
mongodb-driver-server.executereadcommand.php       24-May-2024 16:03               10816
mongodb-driver-server.executereadwritecommand.php  24-May-2024 16:03               11823
mongodb-driver-server.executewritecommand.php      24-May-2024 16:03               11876
mongodb-driver-server.gethost.php                  24-May-2024 16:03                5507
mongodb-driver-server.getinfo.php                  24-May-2024 16:03               10668
mongodb-driver-server.getlatency.php               24-May-2024 16:03                7183
mongodb-driver-server.getport.php                  24-May-2024 16:03                5549
mongodb-driver-server.getserverdescription.php     24-May-2024 16:03                3473
mongodb-driver-server.gettags.php                  24-May-2024 16:03                3836
mongodb-driver-server.gettype.php                  24-May-2024 16:03                3872
mongodb-driver-server.isarbiter.php                24-May-2024 16:03                3689
mongodb-driver-server.ishidden.php                 24-May-2024 16:03                3683
mongodb-driver-server.ispassive.php                24-May-2024 16:03                3751
mongodb-driver-server.isprimary.php                24-May-2024 16:03                3696
mongodb-driver-server.issecondary.php              24-May-2024 16:03                3731
mongodb-driver-serverapi.bsonserialize.php         24-May-2024 16:03                3358
mongodb-driver-serverapi.construct.php             24-May-2024 16:03                5258
mongodb-driver-serverapi.serialize.php             24-May-2024 16:03                3658
mongodb-driver-serverapi.unserialize.php           24-May-2024 16:03                4507
mongodb-driver-serverdescription.gethellorespon..> 24-May-2024 16:03                5247
mongodb-driver-serverdescription.gethost.php       24-May-2024 16:03                3498
mongodb-driver-serverdescription.getlastupdatet..> 24-May-2024 16:03                3648
mongodb-driver-serverdescription.getport.php       24-May-2024 16:03                3553
mongodb-driver-serverdescription.getroundtripti..> 24-May-2024 16:03                3952
mongodb-driver-serverdescription.gettype.php       24-May-2024 16:03                3888
mongodb-driver-session.aborttransaction.php        24-May-2024 16:03                4260
mongodb-driver-session.advanceclustertime.php      24-May-2024 16:03                4934
mongodb-driver-session.advanceoperationtime.php    24-May-2024 16:03                4874
mongodb-driver-session.committransaction.php       24-May-2024 16:03                5616
mongodb-driver-session.construct.php               24-May-2024 16:03                2943
mongodb-driver-session.endsession.php              24-May-2024 16:03                4392
mongodb-driver-session.getclustertime.php          24-May-2024 16:03                4026
mongodb-driver-session.getlogicalsessionid.php     24-May-2024 16:03                3183
mongodb-driver-session.getoperationtime.php        24-May-2024 16:03                4106
mongodb-driver-session.getserver.php               24-May-2024 16:03                3998
mongodb-driver-session.gettransactionoptions.php   24-May-2024 16:03                3881
mongodb-driver-session.gettransactionstate.php     24-May-2024 16:03                3785
mongodb-driver-session.isdirty.php                 24-May-2024 16:03                3068
mongodb-driver-session.isintransaction.php         24-May-2024 16:03                3847
mongodb-driver-session.starttransaction.php        24-May-2024 16:03                9144
mongodb-driver-topologydescription.getservers.php  24-May-2024 16:03                3510
mongodb-driver-topologydescription.gettype.php     24-May-2024 16:03                3558
mongodb-driver-topologydescription.hasreadables..> 24-May-2024 16:03                3997
mongodb-driver-topologydescription.haswritables..> 24-May-2024 16:03                3278
mongodb-driver-writeconcern.bsonserialize.php      24-May-2024 16:03                7283
mongodb-driver-writeconcern.construct.php          24-May-2024 16:03               10572
mongodb-driver-writeconcern.getjournal.php         24-May-2024 16:03                6030
mongodb-driver-writeconcern.getw.php               24-May-2024 16:03                5320
mongodb-driver-writeconcern.getwtimeout.php        24-May-2024 16:03                5952
mongodb-driver-writeconcern.isdefault.php          24-May-2024 16:03                7905
mongodb-driver-writeconcern.serialize.php          24-May-2024 16:03                3730
mongodb-driver-writeconcern.unserialize.php        24-May-2024 16:03                4579
mongodb-driver-writeconcernerror.getcode.php       24-May-2024 16:03                6367
mongodb-driver-writeconcernerror.getinfo.php       24-May-2024 16:03                6693
mongodb-driver-writeconcernerror.getmessage.php    24-May-2024 16:03                6458
mongodb-driver-writeerror.getcode.php              24-May-2024 16:03                5709
mongodb-driver-writeerror.getindex.php             24-May-2024 16:03                6238
mongodb-driver-writeerror.getinfo.php              24-May-2024 16:03                3180
mongodb-driver-writeerror.getmessage.php           24-May-2024 16:03                5845
mongodb-driver-writeexception.getwriteresult.php   24-May-2024 16:03                7970
mongodb-driver-writeresult.getdeletedcount.php     24-May-2024 16:03                8199
mongodb-driver-writeresult.getinsertedcount.php    24-May-2024 16:03                8281
mongodb-driver-writeresult.getmatchedcount.php     24-May-2024 16:03                8844
mongodb-driver-writeresult.getmodifiedcount.php    24-May-2024 16:03                9142
mongodb-driver-writeresult.getserver.php           24-May-2024 16:03                6574
mongodb-driver-writeresult.getupsertedcount.php    24-May-2024 16:03                8370
mongodb-driver-writeresult.getupsertedids.php      24-May-2024 16:03                8855
mongodb-driver-writeresult.getwriteconcernerror..> 24-May-2024 16:03                7245
mongodb-driver-writeresult.getwriteerrors.php      24-May-2024 16:03               13066
mongodb-driver-writeresult.isacknowledged.php      24-May-2024 16:03                8224
mongodb.architecture.php                           24-May-2024 16:03                1982
mongodb.configuration.php                          24-May-2024 16:03                4029
mongodb.connection-handling.php                    24-May-2024 16:03                8736
mongodb.constants.php                              24-May-2024 16:03                2167
mongodb.exceptions.php                             24-May-2024 16:03                5209
mongodb.exceptions.tree.php                        24-May-2024 16:03                5633
mongodb.installation.homebrew.php                  24-May-2024 16:03                2036
mongodb.installation.manual.php                    24-May-2024 16:03                6167
mongodb.installation.pecl.php                      24-May-2024 16:03                5024
mongodb.installation.php                           24-May-2024 16:03                1850
mongodb.installation.windows.php                   24-May-2024 16:03                4392
mongodb.monitoring.php                             24-May-2024 16:03               19444
mongodb.overview.php                               24-May-2024 16:03                4673
mongodb.persistence.deserialization.php            24-May-2024 16:03               21838
mongodb.persistence.php                            24-May-2024 16:03                1885
mongodb.persistence.serialization.php              24-May-2024 16:03               20134
mongodb.requirements.php                           24-May-2024 16:03                3187
mongodb.security.php                               24-May-2024 16:03                1544
mongodb.security.request_injection.php             24-May-2024 16:03                3044
mongodb.security.script_injection.php              24-May-2024 16:03                9233
mongodb.setup.php                                  24-May-2024 16:03                2079
mongodb.tutorial.apm.php                           24-May-2024 16:03               18801
mongodb.tutorial.library.php                       24-May-2024 16:03               10740
mongodb.tutorial.php                               24-May-2024 16:03                1754
mqseries.configure.php                             24-May-2024 16:04                2876
mqseries.constants.php                             24-May-2024 16:04                2709
mqseries.ini.php                                   24-May-2024 16:04                1361
mqseries.requirements.php                          24-May-2024 16:04                1647
mqseries.resources.php                             24-May-2024 16:04                1699
mqseries.setup.php                                 24-May-2024 16:04                1666