Index of /php/manual/fr/feeds/


../
about.atom                                         16-Jul-2024 06:03                2546
about.formats.atom                                 16-Jul-2024 06:03                 557
about.generate.atom                                16-Jul-2024 06:03                 626
about.howtohelp.atom                               16-Jul-2024 06:03                 635
about.more.atom                                    16-Jul-2024 06:03                 597
about.notes.atom                                   16-Jul-2024 06:03                 586
about.phpversions.atom                             16-Jul-2024 06:03                 615
about.prototypes.atom                              16-Jul-2024 06:03                 628
about.translations.atom                            16-Jul-2024 06:03                 576
aliases.atom                                       16-Jul-2024 06:03                 547
allowdynamicproperties.construct.atom              16-Jul-2024 06:03                 677
apache.configuration.atom                          16-Jul-2024 06:03                 625
apache.installation.atom                           16-Jul-2024 06:03                 580
apache.resources.atom                              16-Jul-2024 06:03                 578
apache.setup.atom                                  16-Jul-2024 06:03                1289
apcu.configuration.atom                            16-Jul-2024 06:03                 619
apcu.constants.atom                                16-Jul-2024 06:03                 598
apcu.installation.atom                             16-Jul-2024 06:03                 574
apcu.resources.atom                                16-Jul-2024 06:03                 572
apcu.setup.atom                                    16-Jul-2024 06:03                1271
apcuiterator.construct.atom                        16-Jul-2024 06:03                 642
apcuiterator.current.atom                          16-Jul-2024 06:03                 624
apcuiterator.gettotalcount.atom                    16-Jul-2024 06:03                 613
apcuiterator.gettotalhits.atom                     16-Jul-2024 06:03                 643
apcuiterator.gettotalsize.atom                     16-Jul-2024 06:03                 620
apcuiterator.key.atom                              16-Jul-2024 06:03                 633
apcuiterator.next.atom                             16-Jul-2024 06:03                 641
apcuiterator.rewind.atom                           16-Jul-2024 06:03                 648
apcuiterator.valid.atom                            16-Jul-2024 06:03                 618
appendices.atom                                    16-Jul-2024 06:03                6713
appenditerator.append.atom                         16-Jul-2024 06:03                 624
appenditerator.construct.atom                      16-Jul-2024 06:03                 616
appenditerator.current.atom                        16-Jul-2024 06:03                 599
appenditerator.getarrayiterator.atom               16-Jul-2024 06:03                 651
appenditerator.getiteratorindex.atom               16-Jul-2024 06:03                 651
appenditerator.key.atom                            16-Jul-2024 06:03                 595
appenditerator.next.atom                           16-Jul-2024 06:03                 631
appenditerator.rewind.atom                         16-Jul-2024 06:03                 627
appenditerator.valid.atom                          16-Jul-2024 06:03                 660
array.constants.atom                               16-Jul-2024 06:03                 601
array.resources.atom                               16-Jul-2024 06:03                 575
array.setup.atom                                   16-Jul-2024 06:03                 797
array.sorting.atom                                 16-Jul-2024 06:03                 566
arrayaccess.offsetexists.atom                      16-Jul-2024 06:03                 629
arrayaccess.offsetget.atom                         16-Jul-2024 06:03                 600
arrayaccess.offsetset.atom                         16-Jul-2024 06:03                 636
arrayaccess.offsetunset.atom                       16-Jul-2024 06:03                 665
arrayiterator.append.atom                          16-Jul-2024 06:03                 610
arrayiterator.asort.atom                           16-Jul-2024 06:03                 611
arrayiterator.construct.atom                       16-Jul-2024 06:03                 606
arrayiterator.count.atom                           16-Jul-2024 06:03                 609
arrayiterator.current.atom                         16-Jul-2024 06:03                 627
arrayiterator.getarraycopy.atom                    16-Jul-2024 06:03                 646
arrayiterator.getflags.atom                        16-Jul-2024 06:03                 635
arrayiterator.key.atom                             16-Jul-2024 06:03                 608
arrayiterator.ksort.atom                           16-Jul-2024 06:03                 619
arrayiterator.natcasesort.atom                     16-Jul-2024 06:03                 664
arrayiterator.natsort.atom                         16-Jul-2024 06:03                 615
arrayiterator.next.atom                            16-Jul-2024 06:03                 622
arrayiterator.offsetexists.atom                    16-Jul-2024 06:03                 630
arrayiterator.offsetget.atom                       16-Jul-2024 06:03                 638
arrayiterator.offsetset.atom                       16-Jul-2024 06:03                 628
arrayiterator.offsetunset.atom                     16-Jul-2024 06:03                 622
arrayiterator.rewind.atom                          16-Jul-2024 06:03                 612
arrayiterator.seek.atom                            16-Jul-2024 06:03                 615
arrayiterator.serialize.atom                       16-Jul-2024 06:03                 604
arrayiterator.setflags.atom                        16-Jul-2024 06:03                 625
arrayiterator.uasort.atom                          16-Jul-2024 06:03                 699
arrayiterator.uksort.atom                          16-Jul-2024 06:03                 698
arrayiterator.unserialize.atom                     16-Jul-2024 06:03                 623
arrayiterator.valid.atom                           16-Jul-2024 06:03                 642
arrayobject.append.atom                            16-Jul-2024 06:03                 619
arrayobject.asort.atom                             16-Jul-2024 06:03                 612
arrayobject.construct.atom                         16-Jul-2024 06:03                 607
arrayobject.count.atom                             16-Jul-2024 06:03                 656
arrayobject.exchangearray.atom                     16-Jul-2024 06:03                 618
arrayobject.getarraycopy.atom                      16-Jul-2024 06:03                 636
arrayobject.getflags.atom                          16-Jul-2024 06:03                 602
arrayobject.getiterator.atom                       16-Jul-2024 06:03                 674
arrayobject.getiteratorclass.atom                  16-Jul-2024 06:03                 633
arrayobject.ksort.atom                             16-Jul-2024 06:03                 596
arrayobject.natcasesort.atom                       16-Jul-2024 06:03                 637
arrayobject.natsort.atom                           16-Jul-2024 06:03                 627
arrayobject.offsetexists.atom                      16-Jul-2024 06:03                 620
arrayobject.offsetget.atom                         16-Jul-2024 06:03                 639
arrayobject.offsetset.atom                         16-Jul-2024 06:03                 671
arrayobject.offsetunset.atom                       16-Jul-2024 06:03                 654
arrayobject.serialize.atom                         16-Jul-2024 06:03                 609
arrayobject.setflags.atom                          16-Jul-2024 06:03                 608
arrayobject.setiteratorclass.atom                  16-Jul-2024 06:03                 694
arrayobject.uasort.atom                            16-Jul-2024 06:03                 634
arrayobject.uksort.atom                            16-Jul-2024 06:03                 653
arrayobject.unserialize.atom                       16-Jul-2024 06:03                 639
attribute.construct.atom                           16-Jul-2024 06:03                 612
backedenum.from.atom                               16-Jul-2024 06:03                 605
backedenum.tryfrom.atom                            16-Jul-2024 06:03                 643
bc.configuration.atom                              16-Jul-2024 06:03                 613
bc.installation.atom                               16-Jul-2024 06:03                 568
bc.resources.atom                                  16-Jul-2024 06:03                 566
bc.setup.atom                                      16-Jul-2024 06:03                1253
book.apache.atom                                   16-Jul-2024 06:03                1206
book.apcu.atom                                     16-Jul-2024 06:03                1689
book.array.atom                                    16-Jul-2024 06:03                1678
book.bc.atom                                       16-Jul-2024 06:03                1181
book.bson.atom                                     16-Jul-2024 06:03                9580
book.bzip2.atom                                    16-Jul-2024 06:03                1409
book.calendar.atom                                 16-Jul-2024 06:03                1479
book.classobj.atom                                 16-Jul-2024 06:03                1464
book.cmark.atom                                    16-Jul-2024 06:03                9234
book.com.atom                                      16-Jul-2024 06:03                3387
book.componere.atom                                16-Jul-2024 06:03                2651
book.ctype.atom                                    16-Jul-2024 06:03                1248
book.cubrid.atom                                   16-Jul-2024 06:03                2171
book.curl.atom                                     16-Jul-2024 06:03                2944
book.datetime.atom                                 16-Jul-2024 06:03                6638
book.dba.atom                                      16-Jul-2024 06:03                1688
book.dbase.atom                                    16-Jul-2024 06:03                1440
book.dio.atom                                      16-Jul-2024 06:03                1426
book.dir.atom                                      16-Jul-2024 06:03                1468
book.dom.atom                                      16-Jul-2024 06:03                7275
book.ds.atom                                       16-Jul-2024 06:03                3816
book.eio.atom                                      16-Jul-2024 06:03                1624
book.enchant.atom                                  16-Jul-2024 06:03                2255
book.errorfunc.atom                                16-Jul-2024 06:03                1757
book.ev.atom                                       16-Jul-2024 06:03                5129
book.event.atom                                    16-Jul-2024 06:03                5857
book.exec.atom                                     16-Jul-2024 06:03                1280
book.exif.atom                                     16-Jul-2024 06:03                1440
book.expect.atom                                   16-Jul-2024 06:03                1669
book.fann.atom                                     16-Jul-2024 06:03                1932
book.fdf.atom                                      16-Jul-2024 06:03                1641
book.ffi.atom                                      16-Jul-2024 06:03                2534
book.fileinfo.atom                                 16-Jul-2024 06:03                1724
book.filesystem.atom                               16-Jul-2024 06:03                1550
book.filter.atom                                   16-Jul-2024 06:03                1916
book.fpm.atom                                      16-Jul-2024 06:03                1435
book.ftp.atom                                      16-Jul-2024 06:03                1884
book.funchand.atom                                 16-Jul-2024 06:03                1261
book.gearman.atom                                  16-Jul-2024 06:03                2739
book.gender.atom                                   16-Jul-2024 06:03                1500
book.geoip.atom                                    16-Jul-2024 06:03                1479
book.gettext.atom                                  16-Jul-2024 06:03                1217
book.gmagick.atom                                  16-Jul-2024 06:03                2199
book.gmp.atom                                      16-Jul-2024 06:03                1859
book.gnupg.atom                                    16-Jul-2024 06:03                1655
book.hash.atom                                     16-Jul-2024 06:03                1690
book.hrtime.atom                                   16-Jul-2024 06:03                2079
book.ibase.atom                                    16-Jul-2024 06:03                1466
book.ibm-db2.atom                                  16-Jul-2024 06:03                1504
book.iconv.atom                                    16-Jul-2024 06:03                1440
book.igbinary.atom                                 16-Jul-2024 06:03                1228
book.image.atom                                    16-Jul-2024 06:03                2143
book.imagick.atom                                  16-Jul-2024 06:03                2767
book.imap.atom                                     16-Jul-2024 06:03                1705
book.info.atom                                     16-Jul-2024 06:03                1492
book.inotify.atom                                  16-Jul-2024 06:03                1466
book.intl.atom                                     16-Jul-2024 06:03                7627
book.json.atom                                     16-Jul-2024 06:03                1974
book.ldap.atom                                     16-Jul-2024 06:03                2903
book.libxml.atom                                   16-Jul-2024 06:03                1701
book.lua.atom                                      16-Jul-2024 06:03                1428
book.luasandbox.atom                               16-Jul-2024 06:03                4031
book.lzf.atom                                      16-Jul-2024 06:03                1173
book.mail.atom                                     16-Jul-2024 06:03                1184
book.mailparse.atom                                16-Jul-2024 06:03                1492
book.math.atom                                     16-Jul-2024 06:03                1457
book.mbstring.atom                                 16-Jul-2024 06:03                3090
book.mcrypt.atom                                   16-Jul-2024 06:03                1686
book.memcache.atom                                 16-Jul-2024 06:03                1935
book.memcached.atom                                16-Jul-2024 06:03                2497
book.mhash.atom                                    16-Jul-2024 06:03                1654
book.misc.atom                                     16-Jul-2024 06:03                1679
book.mongodb.atom                                  16-Jul-2024 06:03                6416
book.mqseries.atom                                 16-Jul-2024 06:03                1479
book.mysql-xdevapi.atom                            16-Jul-2024 06:03               11365
book.mysql.atom                                    16-Jul-2024 06:03                1904
book.mysqli.atom                                   16-Jul-2024 06:03                4401
book.mysqlnd.atom                                  16-Jul-2024 06:03                2857
book.network.atom                                  16-Jul-2024 06:03                1483
book.oauth.atom                                    16-Jul-2024 06:03                2394
book.oci8.atom                                     16-Jul-2024 06:03                3667
book.opcache.atom                                  16-Jul-2024 06:03                1441
book.openal.atom                                   16-Jul-2024 06:03                1467
book.openssl.atom                                  16-Jul-2024 06:03                2875
book.outcontrol.atom                               16-Jul-2024 06:03                2550
book.parallel.atom                                 16-Jul-2024 06:03                3654
book.parle.atom                                    16-Jul-2024 06:03                4060
book.password.atom                                 16-Jul-2024 06:03                1521
book.pcntl.atom                                    16-Jul-2024 06:03                1680
book.pcre.atom                                     16-Jul-2024 06:03                1911
book.pdo.atom                                      16-Jul-2024 06:03                3644
book.pgsql.atom                                    16-Jul-2024 06:03                2424
book.phar.atom                                     16-Jul-2024 06:03                2911
book.phpdbg.atom                                   16-Jul-2024 06:03                1471
book.posix.atom                                    16-Jul-2024 06:03                1440
book.ps.atom                                       16-Jul-2024 06:03                1441
book.pspell.atom                                   16-Jul-2024 06:03                1981
book.pthreads.atom                                 16-Jul-2024 06:03                2657
book.quickhash.atom                                16-Jul-2024 06:03                2354
book.radius.atom                                   16-Jul-2024 06:03                1669
book.random.atom                                   16-Jul-2024 06:03                4758
book.rar.atom                                      16-Jul-2024 06:03                2365
book.readline.atom                                 16-Jul-2024 06:03                1483
book.recode.atom                                   16-Jul-2024 06:03                1210
book.reflection.atom                               16-Jul-2024 06:03                8417
book.rnp.atom                                      16-Jul-2024 06:03                1852
book.rpminfo.atom                                  16-Jul-2024 06:03                1466
book.rrd.atom                                      16-Jul-2024 06:03                2111
book.runkit7.atom                                  16-Jul-2024 06:03                1466
book.scoutapm.atom                                 16-Jul-2024 06:03                1228
book.seaslog.atom                                  16-Jul-2024 06:03                1916
book.sem.atom                                      16-Jul-2024 06:03                2236
book.session.atom                                  16-Jul-2024 06:03                3423
book.shmop.atom                                    16-Jul-2024 06:03                1698
book.simdjson.atom                                 16-Jul-2024 06:03                2027
book.simplexml.atom                                16-Jul-2024 06:03                2001
book.snmp.atom                                     16-Jul-2024 06:03                1903
book.soap.atom                                     16-Jul-2024 06:03                2871
book.sockets.atom                                  16-Jul-2024 06:03                2391
book.sodium.atom                                   16-Jul-2024 06:03                1717
book.solr.atom                                     16-Jul-2024 06:03                7642
book.spl.atom                                      16-Jul-2024 06:03                2789
book.sqlite3.atom                                  16-Jul-2024 06:03                2253
book.sqlsrv.atom                                   16-Jul-2024 06:03                1483
book.ssdeep.atom                                   16-Jul-2024 06:03                1221
book.ssh2.atom                                     16-Jul-2024 06:03                1472
book.stats.atom                                    16-Jul-2024 06:03                1204
book.stomp.atom                                    16-Jul-2024 06:03                2144
book.stream.atom                                   16-Jul-2024 06:03                2858
book.strings.atom                                  16-Jul-2024 06:03                1773
book.svm.atom                                      16-Jul-2024 06:03                1649
book.svn.atom                                      16-Jul-2024 06:03                1421
book.swoole.atom                                   16-Jul-2024 06:03                8153
book.sync.atom                                     16-Jul-2024 06:03                2248
book.taint.atom                                    16-Jul-2024 06:03                1409
book.tcpwrap.atom                                  16-Jul-2024 06:03                1218
book.tidy.atom                                     16-Jul-2024 06:03                2095
book.tokenizer.atom                                16-Jul-2024 06:03                1950
book.trader.atom                                   16-Jul-2024 06:03                1483
book.ui.atom                                       16-Jul-2024 06:03               13486
book.uodbc.atom                                    16-Jul-2024 06:03                1458
book.uopz.atom                                     16-Jul-2024 06:03                1467
book.url.atom                                      16-Jul-2024 06:03                1415
book.v8js.atom                                     16-Jul-2024 06:03                1706
book.var.atom                                      16-Jul-2024 06:03                1212
book.var_representation.atom                       16-Jul-2024 06:03                1609
book.varnish.atom                                  16-Jul-2024 06:03                2211
book.wddx.atom                                     16-Jul-2024 06:03                1396
book.win32service.atom                             16-Jul-2024 06:03                2046
book.wincache.atom                                 16-Jul-2024 06:03                1482
book.wkhtmltox.atom                                16-Jul-2024 06:03                1900
book.xattr.atom                                    16-Jul-2024 06:03                1440
book.xdiff.atom                                    16-Jul-2024 06:03                1440
book.xhprof.atom                                   16-Jul-2024 06:03                1696
book.xlswriter.atom                                16-Jul-2024 06:03                1580
book.xml.atom                                      16-Jul-2024 06:03                2846
book.xmldiff.atom                                  16-Jul-2024 06:03                2042
book.xmlreader.atom                                16-Jul-2024 06:03                1256
book.xmlrpc.atom                                   16-Jul-2024 06:03                1208
book.xmlwriter.atom                                16-Jul-2024 06:03                1478
book.xsl.atom                                      16-Jul-2024 06:03                1675
book.yac.atom                                      16-Jul-2024 06:03                1425
book.yaconf.atom                                   16-Jul-2024 06:03                1220
book.yaf.atom                                      16-Jul-2024 06:03               11795
book.yaml.atom                                     16-Jul-2024 06:03                1901
book.yar.atom                                      16-Jul-2024 06:03                2785
book.yaz.atom                                      16-Jul-2024 06:03                1383
book.zip.atom                                      16-Jul-2024 06:03                1868
book.zlib.atom                                     16-Jul-2024 06:03                2171
book.zmq.atom                                      16-Jul-2024 06:03                2140
book.zookeeper.atom                                16-Jul-2024 06:03                3931
bzip2.examples.atom                                16-Jul-2024 06:03                 561
bzip2.installation.atom                            16-Jul-2024 06:03                 577
bzip2.requirements.atom                            16-Jul-2024 06:03                 586
bzip2.resources.atom                               16-Jul-2024 06:03                 575
bzip2.setup.atom                                   16-Jul-2024 06:03                1254
cachingiterator.construct.atom                     16-Jul-2024 06:03                 660
cachingiterator.count.atom                         16-Jul-2024 06:03                 652
cachingiterator.current.atom                       16-Jul-2024 06:03                 633
cachingiterator.getcache.atom                      16-Jul-2024 06:03                 606
cachingiterator.getflags.atom                      16-Jul-2024 06:03                 619
cachingiterator.hasnext.atom                       16-Jul-2024 06:03                 687
cachingiterator.key.atom                           16-Jul-2024 06:03                 637
cachingiterator.next.atom                          16-Jul-2024 06:03                 651
cachingiterator.offsetexists.atom                  16-Jul-2024 06:03                 647
cachingiterator.offsetget.atom                     16-Jul-2024 06:03                 683
cachingiterator.offsetset.atom                     16-Jul-2024 06:03                 676
cachingiterator.offsetunset.atom                   16-Jul-2024 06:03                 689
cachingiterator.rewind.atom                        16-Jul-2024 06:03                 632
cachingiterator.setflags.atom                      16-Jul-2024 06:03                 621
cachingiterator.tostring.atom                      16-Jul-2024 06:03                 699
cachingiterator.valid.atom                         16-Jul-2024 06:03                 651
calendar.constants.atom                            16-Jul-2024 06:03                 610
calendar.installation.atom                         16-Jul-2024 06:03                 586
calendar.resources.atom                            16-Jul-2024 06:03                 584
calendar.setup.atom                                16-Jul-2024 06:03                1044
callbackfilteriterator.accept.atom                 16-Jul-2024 06:03                 736
callbackfilteriterator.construct.atom              16-Jul-2024 06:03                 701
cc.license.atom                                    16-Jul-2024 06:03                 573
changelog.misc.atom                                16-Jul-2024 06:03                 581
changelog.mysql.atom                               16-Jul-2024 06:03                 584
changelog.mysql_xdevapi.atom                       16-Jul-2024 06:03                 608
changelog.mysqli.atom                              16-Jul-2024 06:03                 587
changelog.strings.atom                             16-Jul-2024 06:03                 590
class.addressinfo.atom                             16-Jul-2024 06:03                 583
class.allowdynamicproperties.atom                  16-Jul-2024 06:03                 973
class.apcuiterator.atom                            16-Jul-2024 06:03                3238
class.appenditerator.atom                          16-Jul-2024 06:03                3214
class.argumentcounterror.atom                      16-Jul-2024 06:03                 601
class.arithmeticerror.atom                         16-Jul-2024 06:03                 589
class.arrayaccess.atom                             16-Jul-2024 06:03                1780
class.arrayiterator.atom                           16-Jul-2024 06:03                7638
class.arrayobject.atom                             16-Jul-2024 06:03                7129
class.assertionerror.atom                          16-Jul-2024 06:03                 585
class.attribute.atom                               16-Jul-2024 06:03                 861
class.backedenum.atom                              16-Jul-2024 06:03                1160
class.badfunctioncallexception.atom                16-Jul-2024 06:03                 635
class.badmethodcallexception.atom                  16-Jul-2024 06:03                 627
class.cachingiterator.atom                         16-Jul-2024 06:03                5563
class.callbackfilteriterator.atom                  16-Jul-2024 06:03                1381
class.closedgeneratorexception.atom                16-Jul-2024 06:03                 635
class.closure.atom                                 16-Jul-2024 06:03                1993
class.collator.atom                                16-Jul-2024 06:03                4503
class.collectable.atom                             16-Jul-2024 06:03                 920
class.com-exception.atom                           16-Jul-2024 06:03                 595
class.com-safearray-proxy.atom                     16-Jul-2024 06:03                 615
class.com.atom                                     16-Jul-2024 06:03                 804
class.commonmark-cql.atom                          16-Jul-2024 06:03                1129
class.commonmark-interfaces-ivisitable.atom        16-Jul-2024 06:03                 981
class.commonmark-interfaces-ivisitor.atom          16-Jul-2024 06:03                1265
class.commonmark-node-blockquote.atom              16-Jul-2024 06:03                 642
class.commonmark-node-bulletlist.atom              16-Jul-2024 06:03                 958
class.commonmark-node-code.atom                    16-Jul-2024 06:03                 618
class.commonmark-node-codeblock.atom               16-Jul-2024 06:03                 950
class.commonmark-node-customblock.atom             16-Jul-2024 06:03                 646
class.commonmark-node-custominline.atom            16-Jul-2024 06:03                 650
class.commonmark-node-document.atom                16-Jul-2024 06:03                 634
class.commonmark-node-heading.atom                 16-Jul-2024 06:03                 934
class.commonmark-node-htmlblock.atom               16-Jul-2024 06:03                 638
class.commonmark-node-htmlinline.atom              16-Jul-2024 06:03                 642
class.commonmark-node-image.atom                   16-Jul-2024 06:03                 918
class.commonmark-node-item.atom                    16-Jul-2024 06:03                 618
class.commonmark-node-linebreak.atom               16-Jul-2024 06:03                 638
class.commonmark-node-link.atom                    16-Jul-2024 06:03                 910
class.commonmark-node-orderedlist.atom             16-Jul-2024 06:03                 966
class.commonmark-node-paragraph.atom               16-Jul-2024 06:03                 638
class.commonmark-node-softbreak.atom               16-Jul-2024 06:03                 638
class.commonmark-node-text-emphasis.atom           16-Jul-2024 06:03                 649
class.commonmark-node-text-strong.atom             16-Jul-2024 06:03                 641
class.commonmark-node-text.atom                    16-Jul-2024 06:03                 910
class.commonmark-node-thematicbreak.atom           16-Jul-2024 06:03                 654
class.commonmark-node.atom                         16-Jul-2024 06:03                2516
class.commonmark-parser.atom                       16-Jul-2024 06:03                1401
class.compersisthelper.atom                        16-Jul-2024 06:03                2955
class.compileerror.atom                            16-Jul-2024 06:03                 577
class.componere-abstract-definition.atom           16-Jul-2024 06:03                1912
class.componere-definition.atom                    16-Jul-2024 06:03                2656
class.componere-method.atom                        16-Jul-2024 06:03                2038
class.componere-patch.atom                         16-Jul-2024 06:03                2477
class.componere-value.atom                         16-Jul-2024 06:03                2865
class.countable.atom                               16-Jul-2024 06:03                 862
class.curlfile.atom                                16-Jul-2024 06:03                2272
class.curlhandle.atom                              16-Jul-2024 06:03                 579
class.curlmultihandle.atom                         16-Jul-2024 06:03                 599
class.curlsharehandle.atom                         16-Jul-2024 06:03                 599
class.curlstringfile.atom                          16-Jul-2024 06:03                 887
class.dateerror.atom                               16-Jul-2024 06:03                 575
class.dateexception.atom                           16-Jul-2024 06:03                 591
class.dateinterval.atom                            16-Jul-2024 06:03                1498
class.dateinvalidoperationexception.atom           16-Jul-2024 06:03                 655
class.dateinvalidtimezoneexception.atom            16-Jul-2024 06:03                 651
class.datemalformedintervalstringexception.atom    16-Jul-2024 06:03                 683
class.datemalformedperiodstringexception.atom      16-Jul-2024 06:03                 675
class.datemalformedstringexception.atom            16-Jul-2024 06:03                 651
class.dateobjecterror.atom                         16-Jul-2024 06:03                 599
class.dateperiod.atom                              16-Jul-2024 06:03                2347
class.daterangeerror.atom                          16-Jul-2024 06:03                 595
class.datetime.atom                                16-Jul-2024 06:03                4649
class.datetimeimmutable.atom                       16-Jul-2024 06:03                5126
class.datetimeinterface.atom                       16-Jul-2024 06:03                2331
class.datetimezone.atom                            16-Jul-2024 06:03                2799
class.deflatecontext.atom                          16-Jul-2024 06:03                 595
class.directory.atom                               16-Jul-2024 06:03                1392
class.directoryiterator.atom                       16-Jul-2024 06:03                4358
class.divisionbyzeroerror.atom                     16-Jul-2024 06:03                 605
class.domainexception.atom                         16-Jul-2024 06:03                 599
class.domattr.atom                                 16-Jul-2024 06:03                1118
class.domcdatasection.atom                         16-Jul-2024 06:03                 900
class.domcharacterdata.atom                        16-Jul-2024 06:03                3427
class.domchildnode.atom                            16-Jul-2024 06:03                1729
class.domcomment.atom                              16-Jul-2024 06:03                 862
class.domdocument.atom                             16-Jul-2024 06:03               11572
class.domdocumentfragment.atom                     16-Jul-2024 06:03                2146
class.domdocumenttype.atom                         16-Jul-2024 06:03                 599
class.domelement.atom                              16-Jul-2024 06:03                9579
class.domentity.atom                               16-Jul-2024 06:03                 575
class.domentityreference.atom                      16-Jul-2024 06:03                 926
class.domexception.atom                            16-Jul-2024 06:03                 587
class.domimplementation.atom                       16-Jul-2024 06:03                1990
class.domnamednodemap.atom                         16-Jul-2024 06:03                2190
class.domnamespacenode.atom                        16-Jul-2024 06:03                 603
class.domnode.atom                                 16-Jul-2024 06:03                6332
class.domnodelist.atom                             16-Jul-2024 06:03                1474
class.domnotation.atom                             16-Jul-2024 06:03                 583
class.domparentnode.atom                           16-Jul-2024 06:03                1502
class.domprocessinginstruction.atom                16-Jul-2024 06:03                 974
class.domtext.atom                                 16-Jul-2024 06:03                1873
class.domxpath.atom                                16-Jul-2024 06:03                2082
class.dotnet.atom                                  16-Jul-2024 06:03                 828
class.ds-collection.atom                           16-Jul-2024 06:03                1708
class.ds-deque.atom                                16-Jul-2024 06:03                9599
class.ds-hashable.atom                             16-Jul-2024 06:03                1162
class.ds-map.atom                                  16-Jul-2024 06:03               10604
class.ds-pair.atom                                 16-Jul-2024 06:03                2135
class.ds-priorityqueue.atom                        16-Jul-2024 06:03                4078
class.ds-queue.atom                                16-Jul-2024 06:03                3758
class.ds-sequence.atom                             16-Jul-2024 06:03                8016
class.ds-set.atom                                  16-Jul-2024 06:03                8166
class.ds-stack.atom                                16-Jul-2024 06:03                3754
class.ds-vector.atom                               16-Jul-2024 06:03                9705
class.emptyiterator.atom                           16-Jul-2024 06:03                1982
class.enchantbroker.atom                           16-Jul-2024 06:03                 591
class.enchantdictionary.atom                       16-Jul-2024 06:03                 607
class.error.atom                                   16-Jul-2024 06:03                3351
class.errorexception.atom                          16-Jul-2024 06:03                1194
class.ev.atom                                      16-Jul-2024 06:03                5745
class.evcheck.atom                                 16-Jul-2024 06:03                1151
class.evchild.atom                                 16-Jul-2024 06:03                1390
class.evembed.atom                                 16-Jul-2024 06:03                1657
class.event.atom                                   16-Jul-2024 06:03                4730
class.eventbase.atom                               16-Jul-2024 06:03                4567
class.eventbuffer.atom                             16-Jul-2024 06:03                7402
class.eventbufferevent.atom                        16-Jul-2024 06:03               10375
class.eventconfig.atom                             16-Jul-2024 06:03                2233
class.eventdnsbase.atom                            16-Jul-2024 06:03                3392
class.eventexception.atom                          16-Jul-2024 06:03                 595
class.eventhttp.atom                               16-Jul-2024 06:03                4253
class.eventhttpconnection.atom                     16-Jul-2024 06:03                4418
class.eventhttprequest.atom                        16-Jul-2024 06:03                7967
class.eventlistener.atom                           16-Jul-2024 06:03                2928
class.eventsslcontext.atom                         16-Jul-2024 06:03                 929
class.eventutil.atom                               16-Jul-2024 06:03                2726
class.evfork.atom                                  16-Jul-2024 06:03                1155
class.evidle.atom                                  16-Jul-2024 06:03                1129
class.evio.atom                                    16-Jul-2024 06:03                1338
class.evloop.atom                                  16-Jul-2024 06:03                7831
class.evperiodic.atom                              16-Jul-2024 06:03                2002
class.evprepare.atom                               16-Jul-2024 06:03                1168
class.evsignal.atom                                16-Jul-2024 06:03                1384
class.evstat.atom                                  16-Jul-2024 06:03                2177
class.evtimer.atom                                 16-Jul-2024 06:03                1625
class.evwatcher.atom                               16-Jul-2024 06:03                3120
class.exception.atom                               16-Jul-2024 06:03                3506
class.fannconnection.atom                          16-Jul-2024 06:03                2075
class.ffi-cdata.atom                               16-Jul-2024 06:03                 592
class.ffi-ctype.atom                               16-Jul-2024 06:03                4849
class.ffi-exception.atom                           16-Jul-2024 06:03                 582
class.ffi-parserexception.atom                     16-Jul-2024 06:03                 631
class.ffi.atom                                     16-Jul-2024 06:03                5142
class.fiber.atom                                   16-Jul-2024 06:03                3598
class.fibererror.atom                              16-Jul-2024 06:03                 870
class.filesystemiterator.atom                      16-Jul-2024 06:03                2619
class.filteriterator.atom                          16-Jul-2024 06:03                2703
class.finfo.atom                                   16-Jul-2024 06:03                1538
class.ftp-connection.atom                          16-Jul-2024 06:03                 595
class.gdfont.atom                                  16-Jul-2024 06:03                 563
class.gdimage.atom                                 16-Jul-2024 06:03                 567
class.gearmanclient.atom                           16-Jul-2024 06:03               16179
class.gearmanexception.atom                        16-Jul-2024 06:03                 603
class.gearmanjob.atom                              16-Jul-2024 06:03                6395
class.gearmantask.atom                             16-Jul-2024 06:03                5823
class.gearmanworker.atom                           16-Jul-2024 06:03                6803
class.gender.atom                                  16-Jul-2024 06:03                2324
class.generator.atom                               16-Jul-2024 06:03                3106
class.globiterator.atom                            16-Jul-2024 06:03                1154
class.gmagick.atom                                 16-Jul-2024 06:03               42694
class.gmagickdraw.atom                             16-Jul-2024 06:03               10811
class.gmagickpixel.atom                            16-Jul-2024 06:03                2390
class.gmp.atom                                     16-Jul-2024 06:03                1348
class.hashcontext.atom                             16-Jul-2024 06:03                1507
class.hrtime-performancecounter.atom               16-Jul-2024 06:03                1658
class.hrtime-stopwatch.atom                        16-Jul-2024 06:03                2942
class.hrtime-unit.atom                             16-Jul-2024 06:03                 583
class.imagick.atom                                 16-Jul-2024 06:03              104115
class.imagickdraw.atom                             16-Jul-2024 06:03               39063
class.imagickkernel.atom                           16-Jul-2024 06:03                2681
class.imagickpixel.atom                            16-Jul-2024 06:03                6722
class.imagickpixeliterator.atom                    16-Jul-2024 06:03                5470
class.imap-connection.atom                         16-Jul-2024 06:03                 599
class.infiniteiterator.atom                        16-Jul-2024 06:03                1196
class.inflatecontext.atom                          16-Jul-2024 06:03                 595
class.internaliterator.atom                        16-Jul-2024 06:03                2435
class.intlbreakiterator.atom                       16-Jul-2024 06:03                7813
class.intlcalendar.atom                            16-Jul-2024 06:03               15683
class.intlchar.atom                                16-Jul-2024 06:03               17789
class.intlcodepointbreakiterator.atom              16-Jul-2024 06:03                1076
class.intldateformatter.atom                       16-Jul-2024 06:03                7001
class.intldatepatterngenerator.atom                16-Jul-2024 06:03                1303
class.intlexception.atom                           16-Jul-2024 06:03                 599
class.intlgregoriancalendar.atom                   16-Jul-2024 06:03                2652
class.intliterator.atom                            16-Jul-2024 06:03                2037
class.intlpartsiterator.atom                       16-Jul-2024 06:03                 987
class.intlrulebasedbreakiterator.atom              16-Jul-2024 06:03                2658
class.intltimezone.atom                            16-Jul-2024 06:03                9116
class.invalidargumentexception.atom                16-Jul-2024 06:03                 635
class.iterator.atom                                16-Jul-2024 06:03                1965
class.iteratoraggregate.atom                       16-Jul-2024 06:03                 920
class.iteratoriterator.atom                        16-Jul-2024 06:03                2712
class.jsonexception.atom                           16-Jul-2024 06:03                 591
class.jsonserializable.atom                        16-Jul-2024 06:03                 974
class.ldap-connection.atom                         16-Jul-2024 06:03                 599
class.ldap-result-entry.atom                       16-Jul-2024 06:03                 606
class.ldap-result.atom                             16-Jul-2024 06:03                 583
class.lengthexception.atom                         16-Jul-2024 06:03                 599
class.libxmlerror.atom                             16-Jul-2024 06:03                 583
class.limititerator.atom                           16-Jul-2024 06:03                2932
class.locale.atom                                  16-Jul-2024 06:03                5860
class.logicexception.atom                          16-Jul-2024 06:03                 595
class.lua.atom                                     16-Jul-2024 06:03                2298
class.luaclosure.atom                              16-Jul-2024 06:03                 833
class.luasandbox.atom                              16-Jul-2024 06:03                5378
class.luasandboxerror.atom                         16-Jul-2024 06:03                 599
class.luasandboxerrorerror.atom                    16-Jul-2024 06:03                 619
class.luasandboxfatalerror.atom                    16-Jul-2024 06:03                 619
class.luasandboxfunction.atom                      16-Jul-2024 06:03                1443
class.luasandboxmemoryerror.atom                   16-Jul-2024 06:03                 623
class.luasandboxruntimeerror.atom                  16-Jul-2024 06:03                 627
class.luasandboxsyntaxerror.atom                   16-Jul-2024 06:03                 623
class.luasandboxtimeouterror.atom                  16-Jul-2024 06:03                 627
class.memcache.atom                                16-Jul-2024 06:03                5797
class.memcached.atom                               16-Jul-2024 06:03               15776
class.memcachedexception.atom                      16-Jul-2024 06:03                 611
class.messageformatter.atom                        16-Jul-2024 06:03                3745
class.mongodb-bson-binary.atom                     16-Jul-2024 06:03                2773
class.mongodb-bson-binaryinterface.atom            16-Jul-2024 06:03                1660
class.mongodb-bson-dbpointer.atom                  16-Jul-2024 06:03                2279
class.mongodb-bson-decimal128.atom                 16-Jul-2024 06:03                2333
class.mongodb-bson-decimal128interface.atom        16-Jul-2024 06:03                1075
class.mongodb-bson-document.atom                   16-Jul-2024 06:03                6122
class.mongodb-bson-int64.atom                      16-Jul-2024 06:03                2218
class.mongodb-bson-iterator.atom                   16-Jul-2024 06:03                2437
class.mongodb-bson-javascript.atom                 16-Jul-2024 06:03                2904
class.mongodb-bson-javascriptinterface.atom        16-Jul-2024 06:03                1726
class.mongodb-bson-maxkey.atom                     16-Jul-2024 06:03                1882
class.mongodb-bson-maxkeyinterface.atom            16-Jul-2024 06:03                 655
class.mongodb-bson-minkey.atom                     16-Jul-2024 06:03                1882
class.mongodb-bson-minkeyinterface.atom            16-Jul-2024 06:03                 655
class.mongodb-bson-objectid.atom                   16-Jul-2024 06:03                2594
class.mongodb-bson-objectidinterface.atom          16-Jul-2024 06:03                1406
class.mongodb-bson-packedarray.atom                16-Jul-2024 06:03                4818
class.mongodb-bson-persistable.atom                16-Jul-2024 06:03                 982
class.mongodb-bson-regex.atom                      16-Jul-2024 06:03                2780
class.mongodb-bson-regexinterface.atom             16-Jul-2024 06:03                1711
class.mongodb-bson-serializable.atom               16-Jul-2024 06:03                1016
class.mongodb-bson-symbol.atom                     16-Jul-2024 06:03                2273
class.mongodb-bson-timestamp.atom                  16-Jul-2024 06:03                2978
class.mongodb-bson-timestampinterface.atom         16-Jul-2024 06:03                1830
class.mongodb-bson-type.atom                       16-Jul-2024 06:03                 614
class.mongodb-bson-undefined.atom                  16-Jul-2024 06:03                2279
class.mongodb-bson-unserializable.atom             16-Jul-2024 06:03                1034
class.mongodb-bson-utcdatetime.atom                16-Jul-2024 06:03                2687
class.mongodb-bson-utcdatetimeinterface.atom       16-Jul-2024 06:03                1471
class.mongodb-driver-bulkwrite.atom                16-Jul-2024 06:03                2193
class.mongodb-driver-clientencryption.atom         16-Jul-2024 06:03                4754
class.mongodb-driver-command.atom                  16-Jul-2024 06:03                 941
class.mongodb-driver-cursor.atom                   16-Jul-2024 06:03                4190
class.mongodb-driver-cursorid.atom                 16-Jul-2024 06:03                1928
class.mongodb-driver-cursorinterface.atom          16-Jul-2024 06:03                2380
class.mongodb-driver-exception-authenticationex..> 16-Jul-2024 06:03                 731
class.mongodb-driver-exception-bulkwriteexcepti..> 16-Jul-2024 06:03                 711
class.mongodb-driver-exception-commandexception..> 16-Jul-2024 06:03                1118
class.mongodb-driver-exception-connectionexcept..> 16-Jul-2024 06:03                 715
class.mongodb-driver-exception-connectiontimeou..> 16-Jul-2024 06:03                 743
class.mongodb-driver-exception-encryptionexcept..> 16-Jul-2024 06:03                 715
class.mongodb-driver-exception-exception.atom      16-Jul-2024 06:03                 675
class.mongodb-driver-exception-executiontimeout..> 16-Jul-2024 06:03                 739
class.mongodb-driver-exception-invalidargumente..> 16-Jul-2024 06:03                 735
class.mongodb-driver-exception-logicexception.atom 16-Jul-2024 06:03                 695
class.mongodb-driver-exception-runtimeexception..> 16-Jul-2024 06:03                1098
class.mongodb-driver-exception-serverexception...> 16-Jul-2024 06:03                 699
class.mongodb-driver-exception-sslconnectionexc..> 16-Jul-2024 06:03                 727
class.mongodb-driver-exception-unexpectedvaluee..> 16-Jul-2024 06:03                 735
class.mongodb-driver-exception-writeexception.atom 16-Jul-2024 06:03                1112
class.mongodb-driver-manager.atom                  16-Jul-2024 06:03                6435
class.mongodb-driver-monitoring-commandfailedev..> 16-Jul-2024 06:03                4717
class.mongodb-driver-monitoring-commandstartede..> 16-Jul-2024 06:03                3932
class.mongodb-driver-monitoring-commandsubscrib..> 16-Jul-2024 06:03                1914
class.mongodb-driver-monitoring-commandsucceede..> 16-Jul-2024 06:03                4412
class.mongodb-driver-monitoring-logsubscriber.atom 16-Jul-2024 06:03                1048
class.mongodb-driver-monitoring-sdamsubscriber...> 16-Jul-2024 06:03                4328
class.mongodb-driver-monitoring-serverchangedev..> 16-Jul-2024 06:03                2727
class.mongodb-driver-monitoring-serverclosedeve..> 16-Jul-2024 06:03                1872
class.mongodb-driver-monitoring-serverheartbeat..> 16-Jul-2024 06:03                2846
class.mongodb-driver-monitoring-serverheartbeat..> 16-Jul-2024 06:03                1994
class.mongodb-driver-monitoring-serverheartbeat..> 16-Jul-2024 06:03                2881
class.mongodb-driver-monitoring-serveropeningev..> 16-Jul-2024 06:03                1885
class.mongodb-driver-monitoring-subscriber.atom    16-Jul-2024 06:03                 687
class.mongodb-driver-monitoring-topologychanged..> 16-Jul-2024 06:03                1967
class.mongodb-driver-monitoring-topologyclosede..> 16-Jul-2024 06:03                1102
class.mongodb-driver-monitoring-topologyopening..> 16-Jul-2024 06:03                1109
class.mongodb-driver-query.atom                    16-Jul-2024 06:03                 912
class.mongodb-driver-readconcern.atom              16-Jul-2024 06:03                2610
class.mongodb-driver-readpreference.atom           16-Jul-2024 06:03                3843
class.mongodb-driver-server.atom                   16-Jul-2024 06:03                7144
class.mongodb-driver-serverapi.atom                16-Jul-2024 06:03                1910
class.mongodb-driver-serverdescription.atom        16-Jul-2024 06:03                2867
class.mongodb-driver-session.atom                  16-Jul-2024 06:03                5684
class.mongodb-driver-topologydescription.atom      16-Jul-2024 06:03                2166
class.mongodb-driver-writeconcern.atom             16-Jul-2024 06:03                3325
class.mongodb-driver-writeconcernerror.atom        16-Jul-2024 06:03                1751
class.mongodb-driver-writeerror.atom               16-Jul-2024 06:03                2017
class.mongodb-driver-writeresult.atom              16-Jul-2024 06:03                4397
class.multipleiterator.atom                        16-Jul-2024 06:03                4428
class.mysql-xdevapi-baseresult.atom                16-Jul-2024 06:03                1263
class.mysql-xdevapi-client.atom                    16-Jul-2024 06:03                1432
class.mysql-xdevapi-collection.atom                16-Jul-2024 06:03                5312
class.mysql-xdevapi-collectionadd.atom             16-Jul-2024 06:03                1232
class.mysql-xdevapi-collectionfind.atom            16-Jul-2024 06:03                4017
class.mysql-xdevapi-collectionmodify.atom          16-Jul-2024 06:03                4325
class.mysql-xdevapi-collectionremove.atom          16-Jul-2024 06:03                2177
class.mysql-xdevapi-columnresult.atom              16-Jul-2024 06:03                4610
class.mysql-xdevapi-crudoperationbindable.atom     16-Jul-2024 06:03                 979
class.mysql-xdevapi-crudoperationlimitable.atom    16-Jul-2024 06:03                 980
class.mysql-xdevapi-crudoperationskippable.atom    16-Jul-2024 06:03                 989
class.mysql-xdevapi-crudoperationsortable.atom     16-Jul-2024 06:03                 966
class.mysql-xdevapi-databaseobject.atom            16-Jul-2024 06:03                1569
class.mysql-xdevapi-docresult.atom                 16-Jul-2024 06:03                2090
class.mysql-xdevapi-exception.atom                 16-Jul-2024 06:03                 614
class.mysql-xdevapi-executable.atom                16-Jul-2024 06:03                 903
class.mysql-xdevapi-executionstatus.atom           16-Jul-2024 06:03                 953
class.mysql-xdevapi-expression.atom                16-Jul-2024 06:03                 913
class.mysql-xdevapi-result.atom                    16-Jul-2024 06:03                2426
class.mysql-xdevapi-rowresult.atom                 16-Jul-2024 06:03                3003
class.mysql-xdevapi-schema.atom                    16-Jul-2024 06:03                3810
class.mysql-xdevapi-schemaobject.atom              16-Jul-2024 06:03                 923
class.mysql-xdevapi-session.atom                   16-Jul-2024 06:03                5731
class.mysql-xdevapi-sqlstatement.atom              16-Jul-2024 06:03                2412
class.mysql-xdevapi-sqlstatementresult.atom        16-Jul-2024 06:03                4878
class.mysql-xdevapi-statement.atom                 16-Jul-2024 06:03                1784
class.mysql-xdevapi-table.atom                     16-Jul-2024 06:03                3590
class.mysql-xdevapi-tabledelete.atom               16-Jul-2024 06:03                2357
class.mysql-xdevapi-tableinsert.atom               16-Jul-2024 06:03                1495
class.mysql-xdevapi-tableselect.atom               16-Jul-2024 06:03                3835
class.mysql-xdevapi-tableupdate.atom               16-Jul-2024 06:03                2626
class.mysql-xdevapi-warning.atom                   16-Jul-2024 06:03                 889
class.mysqli-driver.atom                           16-Jul-2024 06:03                1563
class.mysqli-result.atom                           16-Jul-2024 06:03                6583
class.mysqli-sql-exception.atom                    16-Jul-2024 06:03                 929
class.mysqli-stmt.atom                             16-Jul-2024 06:03                9513
class.mysqli-warning.atom                          16-Jul-2024 06:03                1192
class.mysqli.atom                                  16-Jul-2024 06:03               17518
class.norewinditerator.atom                        16-Jul-2024 06:03                2367
class.normalizer.atom                              16-Jul-2024 06:03                1524
class.numberformatter.atom                         16-Jul-2024 06:03                5289
class.oauth.atom                                   16-Jul-2024 06:03                7845
class.oauthexception.atom                          16-Jul-2024 06:03                 595
class.oauthprovider.atom                           16-Jul-2024 06:03                5664
class.ocicollection.atom                           16-Jul-2024 06:03                3051
class.ocilob.atom                                  16-Jul-2024 06:03                6319
class.opensslasymmetrickey.atom                    16-Jul-2024 06:03                 619
class.opensslcertificate.atom                      16-Jul-2024 06:03                 611
class.opensslcertificatesigningrequest.atom        16-Jul-2024 06:03                 667
class.outeriterator.atom                           16-Jul-2024 06:03                 936
class.outofboundsexception.atom                    16-Jul-2024 06:03                 619
class.outofrangeexception.atom                     16-Jul-2024 06:03                 615
class.overflowexception.atom                       16-Jul-2024 06:03                 607
class.override.atom                                16-Jul-2024 06:03                 864
class.parallel-channel.atom                        16-Jul-2024 06:03                2152
class.parallel-events-event-type.atom              16-Jul-2024 06:03                 643
class.parallel-events-event.atom                   16-Jul-2024 06:03                 623
class.parallel-events-input.atom                   16-Jul-2024 06:03                1430
class.parallel-events.atom                         16-Jul-2024 06:03                2441
class.parallel-future.atom                         16-Jul-2024 06:03                1647
class.parallel-runtime.atom                        16-Jul-2024 06:03                1666
class.parallel-sync.atom                           16-Jul-2024 06:03                2107
class.parentiterator.atom                          16-Jul-2024 06:03                2476
class.parle-errorinfo.atom                         16-Jul-2024 06:03                 599
class.parle-lexer.atom                             16-Jul-2024 06:03                2920
class.parle-lexerexception.atom                    16-Jul-2024 06:03                 619
class.parle-parser.atom                            16-Jul-2024 06:03                5402
class.parle-parserexception.atom                   16-Jul-2024 06:03                 623
class.parle-rlexer.atom                            16-Jul-2024 06:03                3222
class.parle-rparser.atom                           16-Jul-2024 06:03                5460
class.parle-stack.atom                             16-Jul-2024 06:03                1095
class.parle-token.atom                             16-Jul-2024 06:03                 583
class.parseerror.atom                              16-Jul-2024 06:03                 569
class.pdo.atom                                     16-Jul-2024 06:03                4951
class.pdoexception.atom                            16-Jul-2024 06:03                 587
class.pdorow.atom                                  16-Jul-2024 06:03                 563
class.pdostatement.atom                            16-Jul-2024 06:03                7153
class.pgsql-connection.atom                        16-Jul-2024 06:03                 603
class.pgsql-lob.atom                               16-Jul-2024 06:03                 575
class.pgsql-result.atom                            16-Jul-2024 06:03                 587
class.phar.atom                                    16-Jul-2024 06:03               17585
class.phardata.atom                                16-Jul-2024 06:03                8398
class.pharexception.atom                           16-Jul-2024 06:03                 591
class.pharfileinfo.atom                            16-Jul-2024 06:03                5349
class.php-user-filter.atom                         16-Jul-2024 06:03                1496
class.phptoken.atom                                16-Jul-2024 06:03                2254
class.pool.atom                                    16-Jul-2024 06:03                2153
class.pspell-config.atom                           16-Jul-2024 06:03                 591
class.pspell-dictionary.atom                       16-Jul-2024 06:03                 607
class.quickhashinthash.atom                        16-Jul-2024 06:03                4305
class.quickhashintset.atom                         16-Jul-2024 06:03                3311
class.quickhashintstringhash.atom                  16-Jul-2024 06:03                4551
class.quickhashstringinthash.atom                  16-Jul-2024 06:03                4551
class.random-brokenrandomengineerror.atom          16-Jul-2024 06:03                 656
class.random-cryptosafeengine.atom                 16-Jul-2024 06:03                 638
class.random-engine-mt19937.atom                   16-Jul-2024 06:03                2197
class.random-engine-pcgoneseq128xslrr64.atom       16-Jul-2024 06:03                2811
class.random-engine-secure.atom                    16-Jul-2024 06:03                 933
class.random-engine-xoshiro256starstar.atom        16-Jul-2024 06:03                3129
class.random-engine.atom                           16-Jul-2024 06:03                 889
class.random-randomerror.atom                      16-Jul-2024 06:03                 611
class.random-randomexception.atom                  16-Jul-2024 06:03                 627
class.random-randomizer.atom                       16-Jul-2024 06:03                4218
class.rangeexception.atom                          16-Jul-2024 06:03                 595
class.rararchive.atom                              16-Jul-2024 06:03                3231
class.rarentry.atom                                16-Jul-2024 06:03                4888
class.rarexception.atom                            16-Jul-2024 06:03                1280
class.recursivearrayiterator.atom                  16-Jul-2024 06:03                1324
class.recursivecachingiterator.atom                16-Jul-2024 06:03                1685
class.recursivecallbackfilteriterator.atom         16-Jul-2024 06:03                1863
class.recursivedirectoryiterator.atom              16-Jul-2024 06:03                3430
class.recursivefilteriterator.atom                 16-Jul-2024 06:03                1749
class.recursiveiterator.atom                       16-Jul-2024 06:03                1327
class.recursiveiteratoriterator.atom               16-Jul-2024 06:03                6655
class.recursiveregexiterator.atom                  16-Jul-2024 06:03                1675
class.recursivetreeiterator.atom                   16-Jul-2024 06:03                6329
class.reflection.atom                              16-Jul-2024 06:03                1131
class.reflectionattribute.atom                     16-Jul-2024 06:03                2697
class.reflectionclass.atom                         16-Jul-2024 06:03               18862
class.reflectionclassconstant.atom                 16-Jul-2024 06:03                5292
class.reflectionenum.atom                          16-Jul-2024 06:03                2338
class.reflectionenumbackedcase.atom                16-Jul-2024 06:03                1315
class.reflectionenumunitcase.atom                  16-Jul-2024 06:03                1606
class.reflectionexception.atom                     16-Jul-2024 06:03                 615
class.reflectionextension.atom                     16-Jul-2024 06:03                5320
class.reflectionfiber.atom                         16-Jul-2024 06:03                2446
class.reflectionfunction.atom                      16-Jul-2024 06:03                3112
class.reflectionfunctionabstract.atom              16-Jul-2024 06:03               12116
class.reflectiongenerator.atom                     16-Jul-2024 06:03                3094
class.reflectionintersectiontype.atom              16-Jul-2024 06:03                 982
class.reflectionmethod.atom                        16-Jul-2024 06:03                6672
class.reflectionnamedtype.atom                     16-Jul-2024 06:03                1264
class.reflectionobject.atom                        16-Jul-2024 06:03                1171
class.reflectionparameter.atom                     16-Jul-2024 06:03                8406
class.reflectionproperty.atom                      16-Jul-2024 06:03                8454
class.reflectionreference.atom                     16-Jul-2024 06:03                1566
class.reflectiontype.atom                          16-Jul-2024 06:03                1149
class.reflectionuniontype.atom                     16-Jul-2024 06:03                 919
class.reflectionzendextension.atom                 16-Jul-2024 06:03                3438
class.reflector.atom                               16-Jul-2024 06:03                 820
class.regexiterator.atom                           16-Jul-2024 06:03                3226
class.resourcebundle.atom                          16-Jul-2024 06:03                2479
class.returntypewillchange.atom                    16-Jul-2024 06:03                 960
class.rnpffi.atom                                  16-Jul-2024 06:03                 563
class.rrdcreator.atom                              16-Jul-2024 06:03                1831
class.rrdgraph.atom                                16-Jul-2024 06:03                1839
class.rrdupdater.atom                              16-Jul-2024 06:03                1160
class.runtimeexception.atom                        16-Jul-2024 06:03                 603
class.seaslog.atom                                 16-Jul-2024 06:03                7912
class.seekableiterator.atom                        16-Jul-2024 06:03                 878
class.sensitiveparameter.atom                      16-Jul-2024 06:03                 941
class.sensitiveparametervalue.atom                 16-Jul-2024 06:03                1622
class.serializable.atom                            16-Jul-2024 06:03                1164
class.sessionhandler.atom                          16-Jul-2024 06:03                2501
class.sessionhandlerinterface.atom                 16-Jul-2024 06:03                2409
class.sessionidinterface.atom                      16-Jul-2024 06:03                 917
class.sessionupdatetimestamphandlerinterface.atom  16-Jul-2024 06:03                1418
class.shmop.atom                                   16-Jul-2024 06:03                 559
class.simdjsonexception.atom                       16-Jul-2024 06:03                 607
class.simdjsonvalueerror.atom                      16-Jul-2024 06:03                 611
class.simplexmlelement.atom                        16-Jul-2024 06:03                7230
class.simplexmliterator.atom                       16-Jul-2024 06:03                 607
class.snmp.atom                                    16-Jul-2024 06:03                2995
class.snmpexception.atom                           16-Jul-2024 06:03                 591
class.soapclient.atom                              16-Jul-2024 06:03                4754
class.soapfault.atom                               16-Jul-2024 06:03                1145
class.soapheader.atom                              16-Jul-2024 06:03                 847
class.soapparam.atom                               16-Jul-2024 06:03                 839
class.soapserver.atom                              16-Jul-2024 06:03                3254
class.soapvar.atom                                 16-Jul-2024 06:03                 823
class.socket.atom                                  16-Jul-2024 06:03                 563
class.sodiumexception.atom                         16-Jul-2024 06:03                 599
class.solrclient.atom                              16-Jul-2024 06:03                7079
class.solrclientexception.atom                     16-Jul-2024 06:03                 993
class.solrcollapsefunction.atom                    16-Jul-2024 06:03                4952
class.solrdismaxquery.atom                         16-Jul-2024 06:03                9765
class.solrdocument.atom                            16-Jul-2024 06:03               10192
class.solrdocumentfield.atom                       16-Jul-2024 06:03                1159
class.solrexception.atom                           16-Jul-2024 06:03                 964
class.solrgenericresponse.atom                     16-Jul-2024 06:03                1179
class.solrillegalargumentexception.atom            16-Jul-2024 06:03                1062
class.solrillegaloperationexception.atom           16-Jul-2024 06:03                1076
class.solrinputdocument.atom                       16-Jul-2024 06:03                7777
class.solrmissingmandatoryparameterexception.atom  16-Jul-2024 06:03                 691
class.solrmodifiableparams.atom                    16-Jul-2024 06:03                1189
class.solrobject.atom                              16-Jul-2024 06:03                2648
class.solrparams.atom                              16-Jul-2024 06:03                3755
class.solrpingresponse.atom                        16-Jul-2024 06:03                1467
class.solrquery.atom                               16-Jul-2024 06:03               63392
class.solrqueryresponse.atom                       16-Jul-2024 06:03                1159
class.solrresponse.atom                            16-Jul-2024 06:03                4333
class.solrserverexception.atom                     16-Jul-2024 06:03                1004
class.solrupdateresponse.atom                      16-Jul-2024 06:03                1169
class.solrutils.atom                               16-Jul-2024 06:03                1830
class.spldoublylinkedlist.atom                     16-Jul-2024 06:03                7733
class.splfileinfo.atom                             16-Jul-2024 06:03                8894
class.splfileobject.atom                           16-Jul-2024 06:03               10438
class.splfixedarray.atom                           16-Jul-2024 06:03                6696
class.splheap.atom                                 16-Jul-2024 06:03                4101
class.splmaxheap.atom                              16-Jul-2024 06:03                 851
class.splminheap.atom                              16-Jul-2024 06:03                 851
class.splobjectstorage.atom                        16-Jul-2024 06:03                7071
class.splobserver.atom                             16-Jul-2024 06:03                 884
class.splpriorityqueue.atom                        16-Jul-2024 06:03                5216
class.splqueue.atom                                16-Jul-2024 06:03                1134
class.splstack.atom                                16-Jul-2024 06:03                 571
class.splsubject.atom                              16-Jul-2024 06:03                1361
class.spltempfileobject.atom                       16-Jul-2024 06:03                 940
class.spoofchecker.atom                            16-Jul-2024 06:03                2456
class.sqlite3.atom                                 16-Jul-2024 06:03                7256
class.sqlite3exception.atom                        16-Jul-2024 06:03                 603
class.sqlite3result.atom                           16-Jul-2024 06:03                2696
class.sqlite3stmt.atom                             16-Jul-2024 06:03                3603
class.stdclass.atom                                16-Jul-2024 06:03                 571
class.stomp.atom                                   16-Jul-2024 06:03                4520
class.stompexception.atom                          16-Jul-2024 06:03                 891
class.stompframe.atom                              16-Jul-2024 06:03                 836
class.streamwrapper.atom                           16-Jul-2024 06:03                7777
class.stringable.atom                              16-Jul-2024 06:03                 899
class.svm.atom                                     16-Jul-2024 06:03                2016
class.svmmodel.atom                                16-Jul-2024 06:03                3716
class.swoole-async.atom                            16-Jul-2024 06:03                2220
class.swoole-atomic.atom                           16-Jul-2024 06:03                2283
class.swoole-buffer.atom                           16-Jul-2024 06:03                3629
class.swoole-channel.atom                          16-Jul-2024 06:03                1984
class.swoole-client.atom                           16-Jul-2024 06:03                5719
class.swoole-connection-iterator.atom              16-Jul-2024 06:03                3763
class.swoole-coroutine.atom                        16-Jul-2024 06:03               13150
class.swoole-event.atom                            16-Jul-2024 06:03                2509
class.swoole-exception.atom                        16-Jul-2024 06:03                 603
class.swoole-http-client.atom                      16-Jul-2024 06:03                5619
class.swoole-http-request.atom                     16-Jul-2024 06:03                1210
class.swoole-http-response.atom                    16-Jul-2024 06:03                3655
class.swoole-http-server.atom                      16-Jul-2024 06:03                1193
class.swoole-lock.atom                             16-Jul-2024 06:03                2636
class.swoole-mmap.atom                             16-Jul-2024 06:03                 911
class.swoole-mysql-exception.atom                  16-Jul-2024 06:03                 627
class.swoole-mysql.atom                            16-Jul-2024 06:03                2487
class.swoole-process.atom                          16-Jul-2024 06:03                6075
class.swoole-redis-server.atom                     16-Jul-2024 06:03                1440
class.swoole-serialize.atom                        16-Jul-2024 06:03                1141
class.swoole-server.atom                           16-Jul-2024 06:03               12442
class.swoole-table.atom                            16-Jul-2024 06:03                5030
class.swoole-timer.atom                            16-Jul-2024 06:03                1695
class.swoole-websocket-frame.atom                  16-Jul-2024 06:03                 627
class.swoole-websocket-server.atom                 16-Jul-2024 06:03                2168
class.syncevent.atom                               16-Jul-2024 06:03                1683
class.syncmutex.atom                               16-Jul-2024 06:03                1361
class.syncreaderwriter.atom                        16-Jul-2024 06:03                2105
class.syncsemaphore.atom                           16-Jul-2024 06:03                1489
class.syncsharedmemory.atom                        16-Jul-2024 06:03                2088
class.sysvmessagequeue.atom                        16-Jul-2024 06:03                 603
class.sysvsemaphore.atom                           16-Jul-2024 06:03                 591
class.sysvsharedmemory.atom                        16-Jul-2024 06:03                 603
class.thread.atom                                  16-Jul-2024 06:03                2583
class.threaded.atom                                16-Jul-2024 06:03                3776
class.throwable.atom                               16-Jul-2024 06:03                3064
class.tidy.atom                                    16-Jul-2024 06:03                6354
class.tidynode.atom                                16-Jul-2024 06:03                3416
class.transliterator.atom                          16-Jul-2024 06:03                3106
class.traversable.atom                             16-Jul-2024 06:03                 590
class.typeerror.atom                               16-Jul-2024 06:03                 565
class.uconverter.atom                              16-Jul-2024 06:03                6574
class.ui-area.atom                                 16-Jul-2024 06:03                1982
class.ui-control.atom                              16-Jul-2024 06:03                3130
class.ui-controls-box.atom                         16-Jul-2024 06:03                2233
class.ui-controls-button.atom                      16-Jul-2024 06:03                1700
class.ui-controls-check.atom                       16-Jul-2024 06:03                2247
class.ui-controls-colorbutton.atom                 16-Jul-2024 06:03                1486
class.ui-controls-combo.atom                       16-Jul-2024 06:03                1722
class.ui-controls-editablecombo.atom               16-Jul-2024 06:03                1795
class.ui-controls-entry.atom                       16-Jul-2024 06:03                2253
class.ui-controls-form.atom                        16-Jul-2024 06:03                1682
class.ui-controls-grid.atom                        16-Jul-2024 06:03                1416
class.ui-controls-group.atom                       16-Jul-2024 06:03                2257
class.ui-controls-label.atom                       16-Jul-2024 06:03                1412
class.ui-controls-multilineentry.atom              16-Jul-2024 06:03                2757
class.ui-controls-picker.atom                      16-Jul-2024 06:03                 888
class.ui-controls-progress.atom                    16-Jul-2024 06:03                1163
class.ui-controls-radio.atom                       16-Jul-2024 06:03                1722
class.ui-controls-separator.atom                   16-Jul-2024 06:03                 912
class.ui-controls-slider.atom                      16-Jul-2024 06:03                1712
class.ui-controls-spin.atom                        16-Jul-2024 06:03                1678
class.ui-controls-tab.atom                         16-Jul-2024 06:03                2169
class.ui-draw-brush-gradient.atom                  16-Jul-2024 06:03                1481
class.ui-draw-brush-lineargradient.atom            16-Jul-2024 06:03                 954
class.ui-draw-brush-radialgradient.atom            16-Jul-2024 06:03                 958
class.ui-draw-brush.atom                           16-Jul-2024 06:03                1366
class.ui-draw-color.atom                           16-Jul-2024 06:03                1407
class.ui-draw-line-cap.atom                        16-Jul-2024 06:03                 594
class.ui-draw-line-join.atom                       16-Jul-2024 06:03                 598
class.ui-draw-matrix.atom                          16-Jul-2024 06:03                2428
class.ui-draw-path.atom                            16-Jul-2024 06:03                2942
class.ui-draw-pen.atom                             16-Jul-2024 06:03                2300
class.ui-draw-stroke.atom                          16-Jul-2024 06:03                3019
class.ui-draw-text-font-descriptor.atom            16-Jul-2024 06:03                2515
class.ui-draw-text-font-italic.atom                16-Jul-2024 06:03                 621
class.ui-draw-text-font-stretch.atom               16-Jul-2024 06:03                 625
class.ui-draw-text-font-weight.atom                16-Jul-2024 06:03                 621
class.ui-draw-text-font.atom                       16-Jul-2024 06:03                2338
class.ui-draw-text-layout.atom                     16-Jul-2024 06:03                1459
class.ui-exception-invalidargumentexception.atom   16-Jul-2024 06:03                 664
class.ui-exception-runtimeexception.atom           16-Jul-2024 06:03                 632
class.ui-executor.atom                             16-Jul-2024 06:03                1634
class.ui-key.atom                                  16-Jul-2024 06:03                 562
class.ui-menu.atom                                 16-Jul-2024 06:03                2401
class.ui-menuitem.atom                             16-Jul-2024 06:03                1858
class.ui-point.atom                                16-Jul-2024 06:03                1989
class.ui-size.atom                                 16-Jul-2024 06:03                2049
class.ui-window.atom                               16-Jul-2024 06:03                4823
class.underflowexception.atom                      16-Jul-2024 06:03                 611
class.unexpectedvalueexception.atom                16-Jul-2024 06:03                 635
class.unhandledmatcherror.atom                     16-Jul-2024 06:03                 605
class.unitenum.atom                                16-Jul-2024 06:03                 874
class.v8js.atom                                    16-Jul-2024 06:03                2016
class.v8jsexception.atom                           16-Jul-2024 06:03                1743
class.valueerror.atom                              16-Jul-2024 06:03                 569
class.variant.atom                                 16-Jul-2024 06:03                 836
class.varnishadmin.atom                            16-Jul-2024 06:03                6329
class.varnishlog.atom                              16-Jul-2024 06:03                1459
class.varnishstat.atom                             16-Jul-2024 06:03                1177
class.volatile.atom                                16-Jul-2024 06:03                 571
class.vtiful-kernel-excel.atom                     16-Jul-2024 06:03                5238
class.vtiful-kernel-format.atom                    16-Jul-2024 06:03                1767
class.weakmap.atom                                 16-Jul-2024 06:03                2329
class.weakreference.atom                           16-Jul-2024 06:03                1493
class.win32serviceexception.atom                   16-Jul-2024 06:03                 622
class.wkhtmltox-image-converter.atom               16-Jul-2024 06:03                1626
class.wkhtmltox-pdf-converter.atom                 16-Jul-2024 06:03                1880
class.wkhtmltox-pdf-object.atom                    16-Jul-2024 06:03                 925
class.worker.atom                                  16-Jul-2024 06:03                2098
class.xmldiff-base.atom                            16-Jul-2024 06:03                1440
class.xmldiff-dom.atom                             16-Jul-2024 06:03                1140
class.xmldiff-file.atom                            16-Jul-2024 06:03                1136
class.xmldiff-memory.atom                          16-Jul-2024 06:03                1144
class.xmlparser.atom                               16-Jul-2024 06:03                 575
class.xmlreader.atom                               16-Jul-2024 06:03                8199
class.xmlwriter.atom                               16-Jul-2024 06:03               12428
class.xsltprocessor.atom                           16-Jul-2024 06:03                4603
class.yac.atom                                     16-Jul-2024 06:03                3031
class.yaconf.atom                                  16-Jul-2024 06:03                1073
class.yaf-action-abstract.atom                     16-Jul-2024 06:03                1592
class.yaf-application.atom                         16-Jul-2024 06:03                5201
class.yaf-bootstrap-abstract.atom                  16-Jul-2024 06:03                 627
class.yaf-config-abstract.atom                     16-Jul-2024 06:03                1806
class.yaf-config-ini.atom                          16-Jul-2024 06:03                5067
class.yaf-config-simple.atom                       16-Jul-2024 06:03                5005
class.yaf-controller-abstract.atom                 16-Jul-2024 06:03                5677
class.yaf-dispatcher.atom                          16-Jul-2024 06:03                8021
class.yaf-exception-dispatchfailed.atom            16-Jul-2024 06:03                 651
class.yaf-exception-loadfailed-action.atom         16-Jul-2024 06:03                 663
class.yaf-exception-loadfailed-controller.atom     16-Jul-2024 06:03                 679
class.yaf-exception-loadfailed-module.atom         16-Jul-2024 06:03                 663
class.yaf-exception-loadfailed-view.atom           16-Jul-2024 06:03                 655
class.yaf-exception-loadfailed.atom                16-Jul-2024 06:03                 635
class.yaf-exception-routerfailed.atom              16-Jul-2024 06:03                 643
class.yaf-exception-startuperror.atom              16-Jul-2024 06:03                 643
class.yaf-exception-typeerror.atom                 16-Jul-2024 06:03                 631
class.yaf-exception.atom                           16-Jul-2024 06:03                1145
class.yaf-loader.atom                              16-Jul-2024 06:03                4426
class.yaf-plugin-abstract.atom                     16-Jul-2024 06:03                2805
class.yaf-registry.atom                            16-Jul-2024 06:03                2003
class.yaf-request-abstract.atom                    16-Jul-2024 06:03               10236
class.yaf-request-http.atom                        16-Jul-2024 06:03                3306
class.yaf-request-simple.atom                      16-Jul-2024 06:03                2938
class.yaf-response-abstract.atom                   16-Jul-2024 06:03                5020
class.yaf-route-interface.atom                     16-Jul-2024 06:03                1189
class.yaf-route-map.atom                           16-Jul-2024 06:03                1383
class.yaf-route-regex.atom                         16-Jul-2024 06:03                1418
class.yaf-route-rewrite.atom                       16-Jul-2024 06:03                1447
class.yaf-route-simple.atom                        16-Jul-2024 06:03                1454
class.yaf-route-static.atom                        16-Jul-2024 06:03                1413
class.yaf-route-supervar.atom                      16-Jul-2024 06:03                1451
class.yaf-router.atom                              16-Jul-2024 06:03                2587
class.yaf-session.atom                             16-Jul-2024 06:03                5435
class.yaf-view-interface.atom                      16-Jul-2024 06:03                2082
class.yaf-view-simple.atom                         16-Jul-2024 06:03                4032
class.yar-client-exception.atom                    16-Jul-2024 06:03                 932
class.yar-client.atom                              16-Jul-2024 06:03                1357
class.yar-concurrent-client.atom                   16-Jul-2024 06:03                1501
class.yar-server-exception.atom                    16-Jul-2024 06:03                 932
class.yar-server.atom                              16-Jul-2024 06:03                1108
class.ziparchive.atom                              16-Jul-2024 06:03               17634
class.zmq.atom                                     16-Jul-2024 06:03                 790
class.zmqcontext.atom                              16-Jul-2024 06:03                1975
class.zmqdevice.atom                               16-Jul-2024 06:03                3046
class.zmqpoll.atom                                 16-Jul-2024 06:03                2165
class.zmqsocket.atom                               16-Jul-2024 06:03                4617
class.zookeeper.atom                               16-Jul-2024 06:03                6771
class.zookeeperauthenticationexception.atom        16-Jul-2024 06:03                 667
class.zookeeperconfig.atom                         16-Jul-2024 06:03                1831
class.zookeeperconnectionexception.atom            16-Jul-2024 06:03                 651
class.zookeeperexception.atom                      16-Jul-2024 06:03                 611
class.zookeepermarshallingexception.atom           16-Jul-2024 06:03                 655
class.zookeepernonodeexception.atom                16-Jul-2024 06:03                 635
class.zookeeperoperationtimeoutexception.atom      16-Jul-2024 06:03                 675
class.zookeepersessionexception.atom               16-Jul-2024 06:03                 639
classobj.examples.atom                             16-Jul-2024 06:03                 570
classobj.resources.atom                            16-Jul-2024 06:03                 584
classobj.setup.atom                                16-Jul-2024 06:03                 812
closure.bind.atom                                  16-Jul-2024 06:03                 639
closure.bindto.atom                                16-Jul-2024 06:03                 644
closure.call.atom                                  16-Jul-2024 06:03                 574
closure.construct.atom                             16-Jul-2024 06:03                 615
closure.fromcallable.atom                          16-Jul-2024 06:03                 609
cmark.constants.atom                               16-Jul-2024 06:03                 601
cmark.installation.atom                            16-Jul-2024 06:03                 577
cmark.requirements.atom                            16-Jul-2024 06:03                 586
cmark.setup.atom                                   16-Jul-2024 06:03                1027
collator.asort.atom                                16-Jul-2024 06:03                 621
collator.compare.atom                              16-Jul-2024 06:03                 597
collator.construct.atom                            16-Jul-2024 06:03                 603
collator.create.atom                               16-Jul-2024 06:03                 594
collator.getattribute.atom                         16-Jul-2024 06:03                 602
collator.geterrorcode.atom                         16-Jul-2024 06:03                 619
collator.geterrormessage.atom                      16-Jul-2024 06:03                 631
collator.getlocale.atom                            16-Jul-2024 06:03                 607
collator.getsortkey.atom                           16-Jul-2024 06:03                 639
collator.getstrength.atom                          16-Jul-2024 06:03                 655
collator.setattribute.atom                         16-Jul-2024 06:03                 612
collator.setstrength.atom                          16-Jul-2024 06:03                 593
collator.sort.atom                                 16-Jul-2024 06:03                 584
collator.sortwithsortkeys.atom                     16-Jul-2024 06:03                 642
collectable.isgarbage.atom                         16-Jul-2024 06:03                 678
com.configuration.atom                             16-Jul-2024 06:03                 616
com.constants.atom                                 16-Jul-2024 06:03                 595
com.construct.atom                                 16-Jul-2024 06:03                 579
com.error-handling.atom                            16-Jul-2024 06:03                 594
com.examples.arrays.atom                           16-Jul-2024 06:03                 665
com.examples.atom                                  16-Jul-2024 06:03                1078
com.examples.foreach.atom                          16-Jul-2024 06:03                 579
com.installation.atom                              16-Jul-2024 06:03                 571
com.requirements.atom                              16-Jul-2024 06:03                 580
com.resources.atom                                 16-Jul-2024 06:03                 569
com.setup.atom                                     16-Jul-2024 06:03                1489
commonmark-cql.construct.atom                      16-Jul-2024 06:03                 599
commonmark-cql.invoke.atom                         16-Jul-2024 06:03                 587
commonmark-interfaces-ivisitable.accept.atom       16-Jul-2024 06:03                 638
commonmark-interfaces-ivisitor.enter.atom          16-Jul-2024 06:03                 629
commonmark-interfaces-ivisitor.leave.atom          16-Jul-2024 06:03                 629
commonmark-node-bulletlist.construct.atom          16-Jul-2024 06:03                 642
commonmark-node-codeblock.construct.atom           16-Jul-2024 06:03                 638
commonmark-node-heading.construct.atom             16-Jul-2024 06:03                 630
commonmark-node-image.construct.atom               16-Jul-2024 06:03                 622
commonmark-node-link.construct.atom                16-Jul-2024 06:03                 618
commonmark-node-orderedlist.construct.atom         16-Jul-2024 06:03                 646
commonmark-node-text.construct.atom                16-Jul-2024 06:03                 618
commonmark-node.accept.atom                        16-Jul-2024 06:03                 587
commonmark-node.appendchild.atom                   16-Jul-2024 06:03                 608
commonmark-node.insertafter.atom                   16-Jul-2024 06:03                 608
commonmark-node.insertbefore.atom                  16-Jul-2024 06:03                 611
commonmark-node.prependchild.atom                  16-Jul-2024 06:03                 611
commonmark-node.replace.atom                       16-Jul-2024 06:03                 596
commonmark-node.unlink.atom                        16-Jul-2024 06:03                 593
commonmark-parser.construct.atom                   16-Jul-2024 06:03                 599
commonmark-parser.finish.atom                      16-Jul-2024 06:03                 590
commonmark-parser.parse.atom                       16-Jul-2024 06:03                 587
compersisthelper.construct.atom                    16-Jul-2024 06:03                 624
compersisthelper.getcurfilename.atom               16-Jul-2024 06:03                 624
compersisthelper.getmaxstreamsize.atom             16-Jul-2024 06:03                 633
compersisthelper.initnew.atom                      16-Jul-2024 06:03                 617
compersisthelper.loadfromfile.atom                 16-Jul-2024 06:03                 619
compersisthelper.loadfromstream.atom               16-Jul-2024 06:03                 627
compersisthelper.savetofile.atom                   16-Jul-2024 06:03                 611
compersisthelper.savetostream.atom                 16-Jul-2024 06:03                 619
componere-abstract-definition.addinterface.atom    16-Jul-2024 06:03                 650
componere-abstract-definition.addmethod.atom       16-Jul-2024 06:03                 638
componere-abstract-definition.addtrait.atom        16-Jul-2024 06:03                 634
componere-abstract-definition.getreflector.atom    16-Jul-2024 06:03                 647
componere-definition.addconstant.atom              16-Jul-2024 06:03                 619
componere-definition.addproperty.atom              16-Jul-2024 06:03                 619
componere-definition.construct.atom                16-Jul-2024 06:03                 624
componere-definition.getclosure.atom               16-Jul-2024 06:03                 615
componere-definition.getclosures.atom              16-Jul-2024 06:03                 619
componere-definition.isregistered.atom             16-Jul-2024 06:03                 625
componere-definition.register.atom                 16-Jul-2024 06:03                 610
componere-method.construct.atom                    16-Jul-2024 06:03                 608
componere-method.getreflector.atom                 16-Jul-2024 06:03                 608
componere-method.setprivate.atom                   16-Jul-2024 06:03                 618
componere-method.setprotected.atom                 16-Jul-2024 06:03                 624
componere-method.setstatic.atom                    16-Jul-2024 06:03                 615
componere-patch.apply.atom                         16-Jul-2024 06:03                 585
componere-patch.construct.atom                     16-Jul-2024 06:03                 604
componere-patch.derive.atom                        16-Jul-2024 06:03                 593
componere-patch.getclosure.atom                    16-Jul-2024 06:03                 600
componere-patch.getclosures.atom                   16-Jul-2024 06:03                 604
componere-patch.isapplied.atom                     16-Jul-2024 06:03                 601
componere-patch.revert.atom                        16-Jul-2024 06:03                 585
componere-value.construct.atom                     16-Jul-2024 06:03                 604
componere-value.hasdefault.atom                    16-Jul-2024 06:03                 606
componere-value.isprivate.atom                     16-Jul-2024 06:03                 609
componere-value.isprotected.atom                   16-Jul-2024 06:03                 615
componere-value.isstatic.atom                      16-Jul-2024 06:03                 606
componere-value.setprivate.atom                    16-Jul-2024 06:03                 615
componere-value.setprotected.atom                  16-Jul-2024 06:03                 621
componere-value.setstatic.atom                     16-Jul-2024 06:03                 612
componere.cast.atom                                16-Jul-2024 06:03                 560
componere.cast_by_ref.atom                         16-Jul-2024 06:03                 581
componere.installation.atom                        16-Jul-2024 06:03                 589
componere.requirements.atom                        16-Jul-2024 06:03                 598
componere.setup.atom                               16-Jul-2024 06:03                1055
configuration.atom                                 16-Jul-2024 06:03                1652
configuration.changes.atom                         16-Jul-2024 06:03                 607
configuration.changes.modes.atom                   16-Jul-2024 06:03                 676
configuration.file.atom                            16-Jul-2024 06:03                 592
configuration.file.per-user.atom                   16-Jul-2024 06:03                 610
configure.about.atom                               16-Jul-2024 06:03                 599
configure.atom                                     16-Jul-2024 06:03                 813
context.atom                                       16-Jul-2024 06:03                2705
context.ftp.atom                                   16-Jul-2024 06:03                 577
context.http.atom                                  16-Jul-2024 06:03                 581
context.params.atom                                16-Jul-2024 06:03                 596
context.phar.atom                                  16-Jul-2024 06:03                 581
context.socket.atom                                16-Jul-2024 06:03                 594
context.ssl.atom                                   16-Jul-2024 06:03                 577
context.zip.atom                                   16-Jul-2024 06:03                 570
context.zlib.atom                                  16-Jul-2024 06:03                 581
control-structures.alternative-syntax.atom         16-Jul-2024 06:03                 641
control-structures.break.atom                      16-Jul-2024 06:03                 588
control-structures.continue.atom                   16-Jul-2024 06:03                 600
control-structures.declare.atom                    16-Jul-2024 06:03                 596
control-structures.do.while.atom                   16-Jul-2024 06:03                 600
control-structures.else.atom                       16-Jul-2024 06:03                 584
control-structures.elseif.atom                     16-Jul-2024 06:03                 600
control-structures.for.atom                        16-Jul-2024 06:03                 580
control-structures.foreach.atom                    16-Jul-2024 06:03                 596
control-structures.goto.atom                       16-Jul-2024 06:03                 584
control-structures.if.atom                         16-Jul-2024 06:03                 576
control-structures.intro.atom                      16-Jul-2024 06:03                 595
control-structures.match.atom                      16-Jul-2024 06:03                 588
control-structures.switch.atom                     16-Jul-2024 06:03                 592
control-structures.while.atom                      16-Jul-2024 06:03                 588
copyright.atom                                     16-Jul-2024 06:03                 547
countable.count.atom                               16-Jul-2024 06:03                 626
ctype.installation.atom                            16-Jul-2024 06:03                 577
ctype.requirements.atom                            16-Jul-2024 06:03                 586
ctype.resources.atom                               16-Jul-2024 06:03                 575
ctype.setup.atom                                   16-Jul-2024 06:03                1254
cubrid.configuration.atom                          16-Jul-2024 06:03                 625
cubrid.constants.atom                              16-Jul-2024 06:03                 604
cubrid.examples.atom                               16-Jul-2024 06:03                 564
cubrid.installation.atom                           16-Jul-2024 06:03                 580
cubrid.requirements.atom                           16-Jul-2024 06:03                 589
cubrid.resources.atom                              16-Jul-2024 06:03                 578
cubrid.setup.atom                                  16-Jul-2024 06:03                1522
cubridmysql.cubrid.atom                            16-Jul-2024 06:03                9121
curl.configuration.atom                            16-Jul-2024 06:03                 619
curl.constants.atom                                16-Jul-2024 06:03                 598
curl.examples-basic.atom                           16-Jul-2024 06:03                 585
curl.examples.atom                                 16-Jul-2024 06:03                 791
curl.installation.atom                             16-Jul-2024 06:03                 574
curl.requirements.atom                             16-Jul-2024 06:03                 583
curl.resources.atom                                16-Jul-2024 06:03                 572
curl.setup.atom                                    16-Jul-2024 06:03                1500
curlfile.construct.atom                            16-Jul-2024 06:03                 598
curlfile.getfilename.atom                          16-Jul-2024 06:03                 619
curlfile.getmimetype.atom                          16-Jul-2024 06:03                 614
curlfile.getpostfilename.atom                      16-Jul-2024 06:03                 641
curlfile.setmimetype.atom                          16-Jul-2024 06:03                 602
curlfile.setpostfilename.atom                      16-Jul-2024 06:03                 629
curlstringfile.construct.atom                      16-Jul-2024 06:03                 622
dateinterval.construct.atom                        16-Jul-2024 06:03                 621
dateinterval.createfromdatestring.atom             16-Jul-2024 06:03                 701
dateinterval.format.atom                           16-Jul-2024 06:03                 593
dateperiod.construct.atom                          16-Jul-2024 06:03                 613
dateperiod.createfromiso8601string.atom            16-Jul-2024 06:03                 667
dateperiod.getdateinterval.atom                    16-Jul-2024 06:03                 615
dateperiod.getenddate.atom                         16-Jul-2024 06:03                 597
dateperiod.getrecurrences.atom                     16-Jul-2024 06:03                 652
dateperiod.getstartdate.atom                       16-Jul-2024 06:03                 615
datetime.add.atom                                  16-Jul-2024 06:03                 678
datetime.configuration.atom                        16-Jul-2024 06:03                 631
datetime.constants.atom                            16-Jul-2024 06:03                 610
datetime.construct.atom                            16-Jul-2024 06:03                 598
datetime.createfromformat.atom                     16-Jul-2024 06:03                 667
datetime.createfromimmutable.atom                  16-Jul-2024 06:03                 697
datetime.createfrominterface.atom                  16-Jul-2024 06:03                 678
datetime.diff.atom                                 16-Jul-2024 06:03                 610
datetime.error.tree.atom                           16-Jul-2024 06:03                 600
datetime.examples-arithmetic.atom                  16-Jul-2024 06:03                 632
datetime.examples.atom                             16-Jul-2024 06:03                 837
datetime.format.atom                               16-Jul-2024 06:03                 618
datetime.formats.atom                              16-Jul-2024 06:03                 608
datetime.getlasterrors.atom                        16-Jul-2024 06:03                 618
datetime.getoffset.atom                            16-Jul-2024 06:03                 604
datetime.gettimestamp.atom                         16-Jul-2024 06:03                 622
datetime.gettimezone.atom                          16-Jul-2024 06:03                 624
datetime.installation.atom                         16-Jul-2024 06:03                 586
datetime.modify.atom                               16-Jul-2024 06:03                 576
datetime.resources.atom                            16-Jul-2024 06:03                 584
datetime.set-state.atom                            16-Jul-2024 06:03                 592
datetime.setdate.atom                              16-Jul-2024 06:03                 574
datetime.setisodate.atom                           16-Jul-2024 06:03                 590
datetime.settime.atom                              16-Jul-2024 06:03                 579
datetime.settimestamp.atom                         16-Jul-2024 06:03                 656
datetime.settimezone.atom                          16-Jul-2024 06:03                 623
datetime.setup.atom                                16-Jul-2024 06:03                1307
datetime.sub.atom                                  16-Jul-2024 06:03                 608
datetime.wakeup.atom                               16-Jul-2024 06:03                 580
datetimeimmutable.add.atom                         16-Jul-2024 06:03                 696
datetimeimmutable.construct.atom                   16-Jul-2024 06:03                 634
datetimeimmutable.createfromformat.atom            16-Jul-2024 06:03                 694
datetimeimmutable.createfrominterface.atom         16-Jul-2024 06:03                 714
datetimeimmutable.createfrommutable.atom           16-Jul-2024 06:03                 709
datetimeimmutable.getlasterrors.atom               16-Jul-2024 06:03                 635
datetimeimmutable.modify.atom                      16-Jul-2024 06:03                 668
datetimeimmutable.set-state.atom                   16-Jul-2024 06:03                 619
datetimeimmutable.setdate.atom                     16-Jul-2024 06:03                 612
datetimeimmutable.setisodate.atom                  16-Jul-2024 06:03                 625
datetimeimmutable.settime.atom                     16-Jul-2024 06:03                 619
datetimeimmutable.settimestamp.atom                16-Jul-2024 06:03                 682
datetimeimmutable.settimezone.atom                 16-Jul-2024 06:03                 634
datetimeimmutable.sub.atom                         16-Jul-2024 06:03                 647
datetimezone.construct.atom                        16-Jul-2024 06:03                 621
datetimezone.getlocation.atom                      16-Jul-2024 06:03                 658
datetimezone.getname.atom                          16-Jul-2024 06:03                 604
datetimezone.getoffset.atom                        16-Jul-2024 06:03                 637
datetimezone.gettransitions.atom                   16-Jul-2024 06:03                 648
datetimezone.listabbreviations.atom                16-Jul-2024 06:03                 671
datetimezone.listidentifiers.atom                  16-Jul-2024 06:03                 706
dba.configuration.atom                             16-Jul-2024 06:03                 616
dba.constants.atom                                 16-Jul-2024 06:03                 595
dba.example.atom                                   16-Jul-2024 06:03                 555
dba.examples.atom                                  16-Jul-2024 06:03                 766
dba.installation.atom                              16-Jul-2024 06:03                 571
dba.requirements.atom                              16-Jul-2024 06:03                 580
dba.resources.atom                                 16-Jul-2024 06:03                 569
dba.setup.atom                                     16-Jul-2024 06:03                1489
dbase.constants.atom                               16-Jul-2024 06:03                 601
dbase.installation.atom                            16-Jul-2024 06:03                 577
dbase.resources.atom                               16-Jul-2024 06:03                 575
dbase.setup.atom                                   16-Jul-2024 06:03                1023
debugger-about.atom                                16-Jul-2024 06:03                 603
debugger.atom                                      16-Jul-2024 06:03                 807
dio.constants.atom                                 16-Jul-2024 06:03                 595
dio.installation.atom                              16-Jul-2024 06:03                 571
dio.resources.atom                                 16-Jul-2024 06:03                 569
dio.setup.atom                                     16-Jul-2024 06:03                1009
dir.constants.atom                                 16-Jul-2024 06:03                 595
dir.resources.atom                                 16-Jul-2024 06:03                 569
dir.setup.atom                                     16-Jul-2024 06:03                 787
directory.close.atom                               16-Jul-2024 06:03                 588
directory.read.atom                                16-Jul-2024 06:03                 612
directory.rewind.atom                              16-Jul-2024 06:03                 609
directoryiterator.construct.atom                   16-Jul-2024 06:03                 680
directoryiterator.current.atom                     16-Jul-2024 06:03                 660
directoryiterator.getbasename.atom                 16-Jul-2024 06:03                 677
directoryiterator.getextension.atom                16-Jul-2024 06:03                 659
directoryiterator.getfilename.atom                 16-Jul-2024 06:03                 661
directoryiterator.isdot.atom                       16-Jul-2024 06:03                 666
directoryiterator.key.atom                         16-Jul-2024 06:03                 627
directoryiterator.next.atom                        16-Jul-2024 06:03                 634
directoryiterator.rewind.atom                      16-Jul-2024 06:03                 621
directoryiterator.seek.atom                        16-Jul-2024 06:03                 654
directoryiterator.tostring.atom                    16-Jul-2024 06:03                 610
directoryiterator.valid.atom                       16-Jul-2024 06:03                 665
doc.changelog.atom                                 16-Jul-2024 06:03                 578
dom.constants.atom                                 16-Jul-2024 06:03                 595
dom.examples.atom                                  16-Jul-2024 06:03                 555
dom.installation.atom                              16-Jul-2024 06:03                 571
dom.requirements.atom                              16-Jul-2024 06:03                 580
dom.resources.atom                                 16-Jul-2024 06:03                 569
dom.setup.atom                                     16-Jul-2024 06:03                1236
domattr.construct.atom                             16-Jul-2024 06:03                 601
domattr.isid.atom                                  16-Jul-2024 06:03                 621
domcdatasection.construct.atom                     16-Jul-2024 06:03                 627
domcharacterdata.after.atom                        16-Jul-2024 06:03                 612
domcharacterdata.appenddata.atom                   16-Jul-2024 06:03                 684
domcharacterdata.before.atom                       16-Jul-2024 06:03                 606
domcharacterdata.deletedata.atom                   16-Jul-2024 06:03                 649
domcharacterdata.insertdata.atom                   16-Jul-2024 06:03                 718
domcharacterdata.remove.atom                       16-Jul-2024 06:03                 606
domcharacterdata.replacedata.atom                  16-Jul-2024 06:03                 669
domcharacterdata.replacewith.atom                  16-Jul-2024 06:03                 637
domcharacterdata.substringdata.atom                16-Jul-2024 06:03                 664
domchildnode.after.atom                            16-Jul-2024 06:03                 626
domchildnode.before.atom                           16-Jul-2024 06:03                 618
domchildnode.remove.atom                           16-Jul-2024 06:03                 594
domchildnode.replacewith.atom                      16-Jul-2024 06:03                 641
domcomment.construct.atom                          16-Jul-2024 06:03                 613
domdocument.adoptnode.atom                         16-Jul-2024 06:03                 611
domdocument.append.atom                            16-Jul-2024 06:03                 604
domdocument.construct.atom                         16-Jul-2024 06:03                 617
domdocument.createattribute.atom                   16-Jul-2024 06:03                 626
domdocument.createattributens.atom                 16-Jul-2024 06:03                 674
domdocument.createcdatasection.atom                16-Jul-2024 06:03                 648
domdocument.createcomment.atom                     16-Jul-2024 06:03                 642
domdocument.createdocumentfragment.atom            16-Jul-2024 06:03                 660
domdocument.createelement.atom                     16-Jul-2024 06:03                 627
domdocument.createelementns.atom                   16-Jul-2024 06:03                 675
domdocument.createentityreference.atom             16-Jul-2024 06:03                 711
domdocument.createprocessinginstruction.atom       16-Jul-2024 06:03                 672
domdocument.createtextnode.atom                    16-Jul-2024 06:03                 639
domdocument.getelementbyid.atom                    16-Jul-2024 06:03                 657
domdocument.getelementsbytagname.atom              16-Jul-2024 06:03                 706
domdocument.getelementsbytagnamens.atom            16-Jul-2024 06:03                 755
domdocument.importnode.atom                        16-Jul-2024 06:03                 627
domdocument.load.atom                              16-Jul-2024 06:03                 590
domdocument.loadhtml.atom                          16-Jul-2024 06:03                 663
domdocument.loadhtmlfile.atom                      16-Jul-2024 06:03                 635
domdocument.loadxml.atom                           16-Jul-2024 06:03                 634
domdocument.normalizedocument.atom                 16-Jul-2024 06:03                 619
domdocument.prepend.atom                           16-Jul-2024 06:03                 610
domdocument.registernodeclass.atom                 16-Jul-2024 06:03                 713
domdocument.relaxngvalidate.atom                   16-Jul-2024 06:03                 639
domdocument.relaxngvalidatesource.atom             16-Jul-2024 06:03                 657
domdocument.replacechildren.atom                   16-Jul-2024 06:03                 620
domdocument.save.atom                              16-Jul-2024 06:03                 610
domdocument.savehtml.atom                          16-Jul-2024 06:03                 658
domdocument.savehtmlfile.atom                      16-Jul-2024 06:03                 660
domdocument.savexml.atom                           16-Jul-2024 06:03                 654
domdocument.schemavalidate.atom                    16-Jul-2024 06:03                 699
domdocument.schemavalidatesource.atom              16-Jul-2024 06:03                 652
domdocument.validate.atom                          16-Jul-2024 06:03                 613
domdocument.xinclude.atom                          16-Jul-2024 06:03                 619
domdocumentfragment.append.atom                    16-Jul-2024 06:03                 628
domdocumentfragment.appendxml.atom                 16-Jul-2024 06:03                 631
domdocumentfragment.construct.atom                 16-Jul-2024 06:03                 636
domdocumentfragment.prepend.atom                   16-Jul-2024 06:03                 634
domdocumentfragment.replacechildren.atom           16-Jul-2024 06:03                 644
domelement.after.atom                              16-Jul-2024 06:03                 587
domelement.append.atom                             16-Jul-2024 06:03                 601
domelement.before.atom                             16-Jul-2024 06:03                 591
domelement.construct.atom                          16-Jul-2024 06:03                 613
domelement.getattribute.atom                       16-Jul-2024 06:03                 617
domelement.getattributenames.atom                  16-Jul-2024 06:03                 614
domelement.getattributenode.atom                   16-Jul-2024 06:03                 634
domelement.getattributenodens.atom                 16-Jul-2024 06:03                 640
domelement.getattributens.atom                     16-Jul-2024 06:03                 623
domelement.getelementsbytagname.atom               16-Jul-2024 06:03                 670
domelement.getelementsbytagnamens.atom             16-Jul-2024 06:03                 717
domelement.hasattribute.atom                       16-Jul-2024 06:03                 620
domelement.hasattributens.atom                     16-Jul-2024 06:03                 626
domelement.insertadjacentelement.atom              16-Jul-2024 06:03                 630
domelement.insertadjacenttext.atom                 16-Jul-2024 06:03                 618
domelement.prepend.atom                            16-Jul-2024 06:03                 607
domelement.remove.atom                             16-Jul-2024 06:03                 581
domelement.removeattribute.atom                    16-Jul-2024 06:03                 607
domelement.removeattributenode.atom                16-Jul-2024 06:03                 619
domelement.removeattributens.atom                  16-Jul-2024 06:03                 613
domelement.replacechildren.atom                    16-Jul-2024 06:03                 616
domelement.replacewith.atom                        16-Jul-2024 06:03                 612
domelement.setattribute.atom                       16-Jul-2024 06:03                 638
domelement.setattributenode.atom                   16-Jul-2024 06:03                 667
domelement.setattributenodens.atom                 16-Jul-2024 06:03                 673
domelement.setattributens.atom                     16-Jul-2024 06:03                 611
domelement.setidattribute.atom                     16-Jul-2024 06:03                 702
domelement.setidattributenode.atom                 16-Jul-2024 06:03                 724
domelement.setidattributens.atom                   16-Jul-2024 06:03                 739
domelement.toggleattribute.atom                    16-Jul-2024 06:03                 605
domentityreference.construct.atom                  16-Jul-2024 06:03                 645
domimplementation.construct.atom                   16-Jul-2024 06:03                 641
domimplementation.createdocument.atom              16-Jul-2024 06:03                 723
domimplementation.createdocumenttype.atom          16-Jul-2024 06:03                 664
domimplementation.hasfeature.atom                  16-Jul-2024 06:03                 714
domnamednodemap.count.atom                         16-Jul-2024 06:03                 679
domnamednodemap.getiterator.atom                   16-Jul-2024 06:03                 621
domnamednodemap.getnameditem.atom                  16-Jul-2024 06:03                 664
domnamednodemap.getnameditemns.atom                16-Jul-2024 06:03                 698
domnamednodemap.item.atom                          16-Jul-2024 06:03                 613
domnode.appendchild.atom                           16-Jul-2024 06:03                 619
domnode.c14n.atom                                  16-Jul-2024 06:03                 599
domnode.c14nfile.atom                              16-Jul-2024 06:03                 598
domnode.clonenode.atom                             16-Jul-2024 06:03                 585
domnode.contains.atom                              16-Jul-2024 06:03                 593
domnode.getlineno.atom                             16-Jul-2024 06:03                 620
domnode.getnodepath.atom                           16-Jul-2024 06:03                 630
domnode.getrootnode.atom                           16-Jul-2024 06:03                 581
domnode.hasattributes.atom                         16-Jul-2024 06:03                 644
domnode.haschildnodes.atom                         16-Jul-2024 06:03                 644
domnode.insertbefore.atom                          16-Jul-2024 06:03                 653
domnode.isdefaultnamespace.atom                    16-Jul-2024 06:03                 717
domnode.isequalnode.atom                           16-Jul-2024 06:03                 600
domnode.issamenode.atom                            16-Jul-2024 06:03                 612
domnode.issupported.atom                           16-Jul-2024 06:03                 681
domnode.lookupnamespaceuri.atom                    16-Jul-2024 06:03                 661
domnode.lookupprefix.atom                          16-Jul-2024 06:03                 668
domnode.normalize.atom                             16-Jul-2024 06:03                 589
domnode.removechild.atom                           16-Jul-2024 06:03                 608
domnode.replacechild.atom                          16-Jul-2024 06:03                 587
domnodelist.count.atom                             16-Jul-2024 06:03                 664
domnodelist.getiterator.atom                       16-Jul-2024 06:03                 609
domnodelist.item.atom                              16-Jul-2024 06:03                 630
domparentnode.append.atom                          16-Jul-2024 06:03                 647
domparentnode.prepend.atom                         16-Jul-2024 06:03                 639
domparentnode.replacechildren.atom                 16-Jul-2024 06:03                 622
domprocessinginstruction.construct.atom            16-Jul-2024 06:03                 669
domtext.construct.atom                             16-Jul-2024 06:03                 601
domtext.iselementcontentwhitespace.atom            16-Jul-2024 06:03                 709
domtext.iswhitespaceinelementcontent.atom          16-Jul-2024 06:03                 684
domtext.splittext.atom                             16-Jul-2024 06:03                 668
domxpath.construct.atom                            16-Jul-2024 06:03                 605
domxpath.evaluate.atom                             16-Jul-2024 06:03                 681
domxpath.query.atom                                16-Jul-2024 06:03                 612
domxpath.registernamespace.atom                    16-Jul-2024 06:03                 648
domxpath.registerphpfunctions.atom                 16-Jul-2024 06:03                 646
dotnet.construct.atom                              16-Jul-2024 06:03                 591
ds-collection.clear.atom                           16-Jul-2024 06:03                 596
ds-collection.copy.atom                            16-Jul-2024 06:03                 614
ds-collection.isempty.atom                         16-Jul-2024 06:03                 607
ds-collection.toarray.atom                         16-Jul-2024 06:03                 611
ds-deque.allocate.atom                             16-Jul-2024 06:03                 609
ds-deque.apply.atom                                16-Jul-2024 06:03                 617
ds-deque.capacity.atom                             16-Jul-2024 06:03                 590
ds-deque.clear.atom                                16-Jul-2024 06:03                 586
ds-deque.construct.atom                            16-Jul-2024 06:03                 587
ds-deque.contains.atom                             16-Jul-2024 06:03                 607
ds-deque.copy.atom                                 16-Jul-2024 06:03                 585
ds-deque.count.atom                                16-Jul-2024 06:03                 599
ds-deque.filter.atom                               16-Jul-2024 06:03                 633
ds-deque.find.atom                                 16-Jul-2024 06:03                 587
ds-deque.first.atom                                16-Jul-2024 06:03                 589
ds-deque.get.atom                                  16-Jul-2024 06:03                 581
ds-deque.insert.atom                               16-Jul-2024 06:03                 587
ds-deque.isempty.atom                              16-Jul-2024 06:03                 593
ds-deque.join.atom                                 16-Jul-2024 06:03                 587
ds-deque.jsonserialize.atom                        16-Jul-2024 06:03                 631
ds-deque.last.atom                                 16-Jul-2024 06:03                 572
ds-deque.map.atom                                  16-Jul-2024 06:03                 602
ds-deque.merge.atom                                16-Jul-2024 06:03                 611
ds-deque.pop.atom                                  16-Jul-2024 06:03                 581
ds-deque.push.atom                                 16-Jul-2024 06:03                 585
ds-deque.reduce.atom                               16-Jul-2024 06:03                 617
ds-deque.remove.atom                               16-Jul-2024 06:03                 592
ds-deque.reverse.atom                              16-Jul-2024 06:03                 586
ds-deque.reversed.atom                             16-Jul-2024 06:03                 585
ds-deque.rotate.atom                               16-Jul-2024 06:03                 604
ds-deque.set.atom                                  16-Jul-2024 06:03                 579
ds-deque.shift.atom                                16-Jul-2024 06:03                 588
ds-deque.slice.atom                                16-Jul-2024 06:03                 589
ds-deque.sort.atom                                 16-Jul-2024 06:03                 574
ds-deque.sorted.atom                               16-Jul-2024 06:03                 577
ds-deque.sum.atom                                  16-Jul-2024 06:03                 589
ds-deque.toarray.atom                              16-Jul-2024 06:03                 591
ds-deque.unshift.atom                              16-Jul-2024 06:03                 596
ds-hashable.equals.atom                            16-Jul-2024 06:03                 626
ds-hashable.hash.atom                              16-Jul-2024 06:03                 608
ds-map.allocate.atom                               16-Jul-2024 06:03                 603
ds-map.apply.atom                                  16-Jul-2024 06:03                 611
ds-map.capacity.atom                               16-Jul-2024 06:03                 584
ds-map.clear.atom                                  16-Jul-2024 06:03                 565
ds-map.construct.atom                              16-Jul-2024 06:03                 581
ds-map.copy.atom                                   16-Jul-2024 06:03                 577
ds-map.count.atom                                  16-Jul-2024 06:03                 586
ds-map.diff.atom                                   16-Jul-2024 06:03                 604
ds-map.filter.atom                                 16-Jul-2024 06:03                 620
ds-map.first.atom                                  16-Jul-2024 06:03                 580
ds-map.get.atom                                    16-Jul-2024 06:03                 574
ds-map.haskey.atom                                 16-Jul-2024 06:03                 597
ds-map.hasvalue.atom                               16-Jul-2024 06:03                 605
ds-map.intersect.atom                              16-Jul-2024 06:03                 614
ds-map.isempty.atom                                16-Jul-2024 06:03                 585
ds-map.jsonserialize.atom                          16-Jul-2024 06:03                 625
ds-map.keys.atom                                   16-Jul-2024 06:03                 580
ds-map.ksort.atom                                  16-Jul-2024 06:03                 576
ds-map.ksorted.atom                                16-Jul-2024 06:03                 582
ds-map.last.atom                                   16-Jul-2024 06:03                 576
ds-map.map.atom                                    16-Jul-2024 06:03                 596
ds-map.merge.atom                                  16-Jul-2024 06:03                 598
ds-map.pairs.atom                                  16-Jul-2024 06:03                 601
ds-map.put.atom                                    16-Jul-2024 06:03                 570
ds-map.putall.atom                                 16-Jul-2024 06:03                 613
ds-map.reduce.atom                                 16-Jul-2024 06:03                 609
ds-map.remove.atom                                 16-Jul-2024 06:03                 584
ds-map.reverse.atom                                16-Jul-2024 06:03                 578
ds-map.reversed.atom                               16-Jul-2024 06:03                 579
ds-map.skip.atom                                   16-Jul-2024 06:03                 588
ds-map.slice.atom                                  16-Jul-2024 06:03                 613
ds-map.sort.atom                                   16-Jul-2024 06:03                 575
ds-map.sorted.atom                                 16-Jul-2024 06:03                 581
ds-map.sum.atom                                    16-Jul-2024 06:03                 581
ds-map.toarray.atom                                16-Jul-2024 06:03                 583
ds-map.union.atom                                  16-Jul-2024 06:03                 619
ds-map.values.atom                                 16-Jul-2024 06:03                 593
ds-map.xor.atom                                    16-Jul-2024 06:03                 635
ds-pair.clear.atom                                 16-Jul-2024 06:03                 568
ds-pair.construct.atom                             16-Jul-2024 06:03                 584
ds-pair.copy.atom                                  16-Jul-2024 06:03                 581
ds-pair.isempty.atom                               16-Jul-2024 06:03                 589
ds-pair.jsonserialize.atom                         16-Jul-2024 06:03                 628
ds-pair.toarray.atom                               16-Jul-2024 06:03                 587
ds-priorityqueue.allocate.atom                     16-Jul-2024 06:03                 633
ds-priorityqueue.capacity.atom                     16-Jul-2024 06:03                 614
ds-priorityqueue.clear.atom                        16-Jul-2024 06:03                 595
ds-priorityqueue.construct.atom                    16-Jul-2024 06:03                 611
ds-priorityqueue.copy.atom                         16-Jul-2024 06:03                 609
ds-priorityqueue.count.atom                        16-Jul-2024 06:03                 618
ds-priorityqueue.isempty.atom                      16-Jul-2024 06:03                 617
ds-priorityqueue.jsonserialize.atom                16-Jul-2024 06:03                 655
ds-priorityqueue.peek.atom                         16-Jul-2024 06:03                 617
ds-priorityqueue.pop.atom                          16-Jul-2024 06:03                 626
ds-priorityqueue.push.atom                         16-Jul-2024 06:03                 602
ds-priorityqueue.toarray.atom                      16-Jul-2024 06:03                 615
ds-queue.allocate.atom                             16-Jul-2024 06:03                 609
ds-queue.capacity.atom                             16-Jul-2024 06:03                 590
ds-queue.clear.atom                                16-Jul-2024 06:03                 571
ds-queue.construct.atom                            16-Jul-2024 06:03                 587
ds-queue.copy.atom                                 16-Jul-2024 06:03                 585
ds-queue.count.atom                                16-Jul-2024 06:03                 594
ds-queue.isempty.atom                              16-Jul-2024 06:03                 593
ds-queue.jsonserialize.atom                        16-Jul-2024 06:03                 631
ds-queue.peek.atom                                 16-Jul-2024 06:03                 593
ds-queue.pop.atom                                  16-Jul-2024 06:03                 602
ds-queue.push.atom                                 16-Jul-2024 06:03                 578
ds-queue.toarray.atom                              16-Jul-2024 06:03                 591
ds-sequence.allocate.atom                          16-Jul-2024 06:03                 618
ds-sequence.apply.atom                             16-Jul-2024 06:03                 626
ds-sequence.capacity.atom                          16-Jul-2024 06:03                 599
ds-sequence.contains.atom                          16-Jul-2024 06:03                 619
ds-sequence.filter.atom                            16-Jul-2024 06:03                 645
ds-sequence.find.atom                              16-Jul-2024 06:03                 596
ds-sequence.first.atom                             16-Jul-2024 06:03                 601
ds-sequence.get.atom                               16-Jul-2024 06:03                 590
ds-sequence.insert.atom                            16-Jul-2024 06:03                 596
ds-sequence.join.atom                              16-Jul-2024 06:03                 596
ds-sequence.last.atom                              16-Jul-2024 06:03                 581
ds-sequence.map.atom                               16-Jul-2024 06:03                 611
ds-sequence.merge.atom                             16-Jul-2024 06:03                 623
ds-sequence.pop.atom                               16-Jul-2024 06:03                 590
ds-sequence.push.atom                              16-Jul-2024 06:03                 597
ds-sequence.reduce.atom                            16-Jul-2024 06:03                 629
ds-sequence.remove.atom                            16-Jul-2024 06:03                 601
ds-sequence.reverse.atom                           16-Jul-2024 06:03                 598
ds-sequence.reversed.atom                          16-Jul-2024 06:03                 594
ds-sequence.rotate.atom                            16-Jul-2024 06:03                 616
ds-sequence.set.atom                               16-Jul-2024 06:03                 588
ds-sequence.shift.atom                             16-Jul-2024 06:03                 597
ds-sequence.slice.atom                             16-Jul-2024 06:03                 601
ds-sequence.sort.atom                              16-Jul-2024 06:03                 586
ds-sequence.sorted.atom                            16-Jul-2024 06:03                 586
ds-sequence.sum.atom                               16-Jul-2024 06:03                 601
ds-sequence.unshift.atom                           16-Jul-2024 06:03                 608
ds-set.add.atom                                    16-Jul-2024 06:03                 563
ds-set.allocate.atom                               16-Jul-2024 06:03                 603
ds-set.capacity.atom                               16-Jul-2024 06:03                 584
ds-set.clear.atom                                  16-Jul-2024 06:03                 565
ds-set.construct.atom                              16-Jul-2024 06:03                 581
ds-set.contains.atom                               16-Jul-2024 06:03                 597
ds-set.copy.atom                                   16-Jul-2024 06:03                 577
ds-set.count.atom                                  16-Jul-2024 06:03                 586
ds-set.diff.atom                                   16-Jul-2024 06:03                 606
ds-set.filter.atom                                 16-Jul-2024 06:03                 625
ds-set.first.atom                                  16-Jul-2024 06:03                 581
ds-set.get.atom                                    16-Jul-2024 06:03                 575
ds-set.intersect.atom                              16-Jul-2024 06:03                 616
ds-set.isempty.atom                                16-Jul-2024 06:03                 585
ds-set.join.atom                                   16-Jul-2024 06:03                 581
ds-set.jsonserialize.atom                          16-Jul-2024 06:03                 625
ds-set.last.atom                                   16-Jul-2024 06:03                 577
ds-set.merge.atom                                  16-Jul-2024 06:03                 603
ds-set.reduce.atom                                 16-Jul-2024 06:03                 609
ds-set.remove.atom                                 16-Jul-2024 06:03                 587
ds-set.reverse.atom                                16-Jul-2024 06:03                 578
ds-set.reversed.atom                               16-Jul-2024 06:03                 579
ds-set.slice.atom                                  16-Jul-2024 06:03                 581
ds-set.sort.atom                                   16-Jul-2024 06:03                 566
ds-set.sorted.atom                                 16-Jul-2024 06:03                 571
ds-set.sum.atom                                    16-Jul-2024 06:03                 581
ds-set.toarray.atom                                16-Jul-2024 06:03                 583
ds-set.union.atom                                  16-Jul-2024 06:03                 619
ds-set.xor.atom                                    16-Jul-2024 06:03                 637
ds-stack.allocate.atom                             16-Jul-2024 06:03                 609
ds-stack.capacity.atom                             16-Jul-2024 06:03                 590
ds-stack.clear.atom                                16-Jul-2024 06:03                 571
ds-stack.construct.atom                            16-Jul-2024 06:03                 587
ds-stack.copy.atom                                 16-Jul-2024 06:03                 585
ds-stack.count.atom                                16-Jul-2024 06:03                 594
ds-stack.isempty.atom                              16-Jul-2024 06:03                 593
ds-stack.jsonserialize.atom                        16-Jul-2024 06:03                 631
ds-stack.peek.atom                                 16-Jul-2024 06:03                 591
ds-stack.pop.atom                                  16-Jul-2024 06:03                 600
ds-stack.push.atom                                 16-Jul-2024 06:03                 578
ds-stack.toarray.atom                              16-Jul-2024 06:03                 591
ds-vector.allocate.atom                            16-Jul-2024 06:03                 612
ds-vector.apply.atom                               16-Jul-2024 06:03                 620
ds-vector.capacity.atom                            16-Jul-2024 06:03                 593
ds-vector.clear.atom                               16-Jul-2024 06:03                 574
ds-vector.construct.atom                           16-Jul-2024 06:03                 590
ds-vector.contains.atom                            16-Jul-2024 06:03                 611
ds-vector.copy.atom                                16-Jul-2024 06:03                 589
ds-vector.count.atom                               16-Jul-2024 06:03                 602
ds-vector.filter.atom                              16-Jul-2024 06:03                 637
ds-vector.find.atom                                16-Jul-2024 06:03                 590
ds-vector.first.atom                               16-Jul-2024 06:03                 593
ds-vector.get.atom                                 16-Jul-2024 06:03                 584
ds-vector.insert.atom                              16-Jul-2024 06:03                 590
ds-vector.isempty.atom                             16-Jul-2024 06:03                 597
ds-vector.join.atom                                16-Jul-2024 06:03                 590
ds-vector.jsonserialize.atom                       16-Jul-2024 06:03                 634
ds-vector.last.atom                                16-Jul-2024 06:03                 575
ds-vector.map.atom                                 16-Jul-2024 06:03                 605
ds-vector.merge.atom                               16-Jul-2024 06:03                 615
ds-vector.pop.atom                                 16-Jul-2024 06:03                 584
ds-vector.push.atom                                16-Jul-2024 06:03                 589
ds-vector.reduce.atom                              16-Jul-2024 06:03                 621
ds-vector.remove.atom                              16-Jul-2024 06:03                 595
ds-vector.reverse.atom                             16-Jul-2024 06:03                 590
ds-vector.reversed.atom                            16-Jul-2024 06:03                 588
ds-vector.rotate.atom                              16-Jul-2024 06:03                 608
ds-vector.set.atom                                 16-Jul-2024 06:03                 582
ds-vector.shift.atom                               16-Jul-2024 06:03                 591
ds-vector.slice.atom                               16-Jul-2024 06:03                 593
ds-vector.sort.atom                                16-Jul-2024 06:03                 578
ds-vector.sorted.atom                              16-Jul-2024 06:03                 580
ds-vector.sum.atom                                 16-Jul-2024 06:03                 593
ds-vector.toarray.atom                             16-Jul-2024 06:03                 595
ds-vector.unshift.atom                             16-Jul-2024 06:03                 600
ds.examples.atom                                   16-Jul-2024 06:03                 552
ds.installation.atom                               16-Jul-2024 06:03                 568
ds.requirements.atom                               16-Jul-2024 06:03                 577
ds.setup.atom                                      16-Jul-2024 06:03                1006
eio.constants.atom                                 16-Jul-2024 06:03                 595
eio.examples.atom                                  16-Jul-2024 06:03                 555
eio.installation.atom                              16-Jul-2024 06:03                 571
eio.requirements.atom                              16-Jul-2024 06:03                 580
eio.resources.atom                                 16-Jul-2024 06:03                 569
eio.setup.atom                                     16-Jul-2024 06:03                1236
emptyiterator.current.atom                         16-Jul-2024 06:03                 618
emptyiterator.key.atom                             16-Jul-2024 06:03                 578
emptyiterator.next.atom                            16-Jul-2024 06:03                 606
emptyiterator.rewind.atom                          16-Jul-2024 06:03                 614
emptyiterator.valid.atom                           16-Jul-2024 06:03                 644
enchant.constants.atom                             16-Jul-2024 06:03                 607
enchant.examples.atom                              16-Jul-2024 06:03                 567
enchant.installation.atom                          16-Jul-2024 06:03                 583
enchant.requirements.atom                          16-Jul-2024 06:03                 592
enchant.resources.atom                             16-Jul-2024 06:03                 581
enchant.setup.atom                                 16-Jul-2024 06:03                1272
error.clone.atom                                   16-Jul-2024 06:03                 564
error.construct.atom                               16-Jul-2024 06:03                 590
error.getcode.atom                                 16-Jul-2024 06:03                 602
error.getfile.atom                                 16-Jul-2024 06:03                 639
error.getline.atom                                 16-Jul-2024 06:03                 658
error.getmessage.atom                              16-Jul-2024 06:03                 614
error.getprevious.atom                             16-Jul-2024 06:03                 612
error.gettrace.atom                                16-Jul-2024 06:03                 606
error.gettraceasstring.atom                        16-Jul-2024 06:03                 684
error.tostring.atom                                16-Jul-2024 06:03                 650
errorexception.construct.atom                      16-Jul-2024 06:03                 609
errorexception.getseverity.atom                    16-Jul-2024 06:03                 684
errorfunc.configuration.atom                       16-Jul-2024 06:03                 634
errorfunc.constants.atom                           16-Jul-2024 06:03                 613
errorfunc.examples.atom                            16-Jul-2024 06:03                 573
errorfunc.resources.atom                           16-Jul-2024 06:03                 587
errorfunc.setup.atom                               16-Jul-2024 06:03                1082
ev.backend.atom                                    16-Jul-2024 06:03                 620
ev.depth.atom                                      16-Jul-2024 06:03                 581
ev.embeddablebackends.atom                         16-Jul-2024 06:03                 696
ev.examples.atom                                   16-Jul-2024 06:03                 552
ev.feedsignal.atom                                 16-Jul-2024 06:03                 597
ev.feedsignalevent.atom                            16-Jul-2024 06:03                 653
ev.installation.atom                               16-Jul-2024 06:03                 568
ev.iteration.atom                                  16-Jul-2024 06:03                 748
ev.now.atom                                        16-Jul-2024 06:03                 694
ev.nowupdate.atom                                  16-Jul-2024 06:03                 698
ev.periodic-modes.atom                             16-Jul-2024 06:03                 635
ev.recommendedbackends.atom                        16-Jul-2024 06:03                 675
ev.requirements.atom                               16-Jul-2024 06:03                 577
ev.resources.atom                                  16-Jul-2024 06:03                 566
ev.resume.atom                                     16-Jul-2024 06:03                 670
ev.run.atom                                        16-Jul-2024 06:03                 677
ev.setup.atom                                      16-Jul-2024 06:03                1227
ev.sleep.atom                                      16-Jul-2024 06:03                 591
ev.stop.atom                                       16-Jul-2024 06:03                 620
ev.supportedbackends.atom                          16-Jul-2024 06:03                 657
ev.suspend.atom                                    16-Jul-2024 06:03                 620
ev.time.atom                                       16-Jul-2024 06:03                 594
ev.verify.atom                                     16-Jul-2024 06:03                 629
ev.watcher-callbacks.atom                          16-Jul-2024 06:03                 612
ev.watchers.atom                                   16-Jul-2024 06:03                 552
evcheck.construct.atom                             16-Jul-2024 06:03                 611
evcheck.createstopped.atom                         16-Jul-2024 06:03                 650
evchild.construct.atom                             16-Jul-2024 06:03                 611
evchild.createstopped.atom                         16-Jul-2024 06:03                 650
evchild.set.atom                                   16-Jul-2024 06:03                 572
evembed.construct.atom                             16-Jul-2024 06:03                 588
evembed.createstopped.atom                         16-Jul-2024 06:03                 632
evembed.set.atom                                   16-Jul-2024 06:03                 564
evembed.sweep.atom                                 16-Jul-2024 06:03                 628
event.add.atom                                     16-Jul-2024 06:03                 591
event.addsignal.atom                               16-Jul-2024 06:03                 575
event.addtimer.atom                                16-Jul-2024 06:03                 572
event.callbacks.atom                               16-Jul-2024 06:03                 612
event.construct.atom                               16-Jul-2024 06:03                 580
event.constructing.signal.events.atom              16-Jul-2024 06:03                 676
event.del.atom                                     16-Jul-2024 06:03                 652
event.delsignal.atom                               16-Jul-2024 06:03                 575
event.deltimer.atom                                16-Jul-2024 06:03                 572
event.examples.atom                                16-Jul-2024 06:03                 561
event.flags.atom                                   16-Jul-2024 06:03                 596
event.free.atom                                    16-Jul-2024 06:03                 716
event.getsupportedmethods.atom                     16-Jul-2024 06:03                 703
event.installation.atom                            16-Jul-2024 06:03                 577
event.pending.atom                                 16-Jul-2024 06:03                 649
event.persistence.atom                             16-Jul-2024 06:03                 625
event.requirements.atom                            16-Jul-2024 06:03                 586
event.resources.atom                               16-Jul-2024 06:03                 575
event.set.atom                                     16-Jul-2024 06:03                 589
event.setpriority.atom                             16-Jul-2024 06:03                 644
event.settimer.atom                                16-Jul-2024 06:03                 606
event.setup.atom                                   16-Jul-2024 06:03                1254
event.signal.atom                                  16-Jul-2024 06:03                 611
event.timer.atom                                   16-Jul-2024 06:03                 607
eventbase.construct.atom                           16-Jul-2024 06:03                 596
eventbase.dispatch.atom                            16-Jul-2024 06:03                 622
eventbase.exit.atom                                16-Jul-2024 06:03                 612
eventbase.free.atom                                16-Jul-2024 06:03                 657
eventbase.getfeatures.atom                         16-Jul-2024 06:03                 645
eventbase.getmethod.atom                           16-Jul-2024 06:03                 657
eventbase.gettimeofdaycached.atom                  16-Jul-2024 06:03                 662
eventbase.gotexit.atom                             16-Jul-2024 06:03                 710
eventbase.gotstop.atom                             16-Jul-2024 06:03                 728
eventbase.loop.atom                                16-Jul-2024 06:03                 610
eventbase.priorityinit.atom                        16-Jul-2024 06:03                 684
eventbase.reinit.atom                              16-Jul-2024 06:03                 646
eventbase.stop.atom                                16-Jul-2024 06:03                 651
eventbuffer.add.atom                               16-Jul-2024 06:03                 654
eventbuffer.addbuffer.atom                         16-Jul-2024 06:03                 681
eventbuffer.appendfrom.atom                        16-Jul-2024 06:03                 680
eventbuffer.construct.atom                         16-Jul-2024 06:03                 604
eventbuffer.copyout.atom                           16-Jul-2024 06:03                 665
eventbuffer.drain.atom                             16-Jul-2024 06:03                 700
eventbuffer.enablelocking.atom                     16-Jul-2024 06:03                 597
eventbuffer.expand.atom                            16-Jul-2024 06:03                 615
eventbuffer.freeze.atom                            16-Jul-2024 06:03                 708
eventbuffer.lock.atom                              16-Jul-2024 06:03                 602
eventbuffer.prepend.atom                           16-Jul-2024 06:03                 627
eventbuffer.prependbuffer.atom                     16-Jul-2024 06:03                 704
eventbuffer.pullup.atom                            16-Jul-2024 06:03                 696
eventbuffer.read.atom                              16-Jul-2024 06:03                 628
eventbuffer.readfrom.atom                          16-Jul-2024 06:03                 658
eventbuffer.readline.atom                          16-Jul-2024 06:03                 625
eventbuffer.search.atom                            16-Jul-2024 06:03                 632
eventbuffer.searcheol.atom                         16-Jul-2024 06:03                 627
eventbuffer.substr.atom                            16-Jul-2024 06:03                 619
eventbuffer.unfreeze.atom                          16-Jul-2024 06:03                 679
eventbuffer.unlock.atom                            16-Jul-2024 06:03                 622
eventbuffer.write.atom                             16-Jul-2024 06:03                 622
eventbufferevent.about.callbacks.atom              16-Jul-2024 06:03                 689
eventbufferevent.close.atom                        16-Jul-2024 06:03                 690
eventbufferevent.connect.atom                      16-Jul-2024 06:03                 724
eventbufferevent.connecthost.atom                  16-Jul-2024 06:03                 635
eventbufferevent.construct.atom                    16-Jul-2024 06:03                 624
eventbufferevent.createpair.atom                   16-Jul-2024 06:03                 712
eventbufferevent.disable.atom                      16-Jul-2024 06:03                 740
eventbufferevent.enable.atom                       16-Jul-2024 06:03                 725
eventbufferevent.free.atom                         16-Jul-2024 06:03                 636
eventbufferevent.getdnserrorstring.atom            16-Jul-2024 06:03                 697
eventbufferevent.getenabled.atom                   16-Jul-2024 06:03                 724
eventbufferevent.getinput.atom                     16-Jul-2024 06:03                 711
eventbufferevent.getoutput.atom                    16-Jul-2024 06:03                 701
eventbufferevent.read.atom                         16-Jul-2024 06:03                 610
eventbufferevent.readbuffer.atom                   16-Jul-2024 06:03                 676
eventbufferevent.setcallbacks.atom                 16-Jul-2024 06:03                 729
eventbufferevent.setpriority.atom                  16-Jul-2024 06:03                 681
eventbufferevent.settimeouts.atom                  16-Jul-2024 06:03                 755
eventbufferevent.setwatermark.atom                 16-Jul-2024 06:03                 664
eventbufferevent.sslerror.atom                     16-Jul-2024 06:03                 717
eventbufferevent.sslfilter.atom                    16-Jul-2024 06:03                 783
eventbufferevent.sslgetcipherinfo.atom             16-Jul-2024 06:03                 661
eventbufferevent.sslgetciphername.atom             16-Jul-2024 06:03                 665
eventbufferevent.sslgetcipherversion.atom          16-Jul-2024 06:03                 698
eventbufferevent.sslgetprotocol.atom               16-Jul-2024 06:03                 682
eventbufferevent.sslrenegotiate.atom               16-Jul-2024 06:03                 706
eventbufferevent.sslsocket.atom                    16-Jul-2024 06:03                 699
eventbufferevent.write.atom                        16-Jul-2024 06:03                 670
eventbufferevent.writebuffer.atom                  16-Jul-2024 06:03                 700
eventconfig.avoidmethod.atom                       16-Jul-2024 06:03                 708
eventconfig.construct.atom                         16-Jul-2024 06:03                 604
eventconfig.requirefeatures.atom                   16-Jul-2024 06:03                 736
eventconfig.setflags.atom                          16-Jul-2024 06:03                 649
eventconfig.setmaxdispatchinterval.atom            16-Jul-2024 06:03                 660
eventdnsbase.addnameserverip.atom                  16-Jul-2024 06:03                 645
eventdnsbase.addsearch.atom                        16-Jul-2024 06:03                 667
eventdnsbase.clearsearch.atom                      16-Jul-2024 06:03                 631
eventdnsbase.construct.atom                        16-Jul-2024 06:03                 608
eventdnsbase.countnameservers.atom                 16-Jul-2024 06:03                 680
eventdnsbase.loadhosts.atom                        16-Jul-2024 06:03                 642
eventdnsbase.parseresolvconf.atom                  16-Jul-2024 06:03                 625
eventdnsbase.setoption.atom                        16-Jul-2024 06:03                 640
eventdnsbase.setsearchndots.atom                   16-Jul-2024 06:03                 672
eventhttp.accept.atom                              16-Jul-2024 06:03                 685
eventhttp.addserveralias.atom                      16-Jul-2024 06:03                 640
eventhttp.bind.atom                                16-Jul-2024 06:03                 631
eventhttp.construct.atom                           16-Jul-2024 06:03                 614
eventhttp.removeserveralias.atom                   16-Jul-2024 06:03                 624
eventhttp.setallowedmethods.atom                   16-Jul-2024 06:03                 791
eventhttp.setcallback.atom                         16-Jul-2024 06:03                 651
eventhttp.setdefaultcallback.atom                  16-Jul-2024 06:03                 794
eventhttp.setmaxbodysize.atom                      16-Jul-2024 06:03                 643
eventhttp.setmaxheaderssize.atom                   16-Jul-2024 06:03                 657
eventhttp.settimeout.atom                          16-Jul-2024 06:03                 664
eventhttpconnection.construct.atom                 16-Jul-2024 06:03                 636
eventhttpconnection.getbase.atom                   16-Jul-2024 06:03                 685
eventhttpconnection.getpeer.atom                   16-Jul-2024 06:03                 694
eventhttpconnection.makerequest.atom               16-Jul-2024 06:03                 688
eventhttpconnection.setclosecallback.atom          16-Jul-2024 06:03                 696
eventhttpconnection.setlocaladdress.atom           16-Jul-2024 06:03                 715
eventhttpconnection.setlocalport.atom              16-Jul-2024 06:03                 695
eventhttpconnection.setmaxbodysize.atom            16-Jul-2024 06:03                 677
eventhttpconnection.setmaxheaderssize.atom         16-Jul-2024 06:03                 682
eventhttpconnection.setretries.atom                16-Jul-2024 06:03                 661
eventhttpconnection.settimeout.atom                16-Jul-2024 06:03                 680
eventhttprequest.addheader.atom                    16-Jul-2024 06:03                 668
eventhttprequest.cancel.atom                       16-Jul-2024 06:03                 624
eventhttprequest.clearheaders.atom                 16-Jul-2024 06:03                 697
eventhttprequest.closeconnection.atom              16-Jul-2024 06:03                 653
eventhttprequest.construct.atom                    16-Jul-2024 06:03                 624
eventhttprequest.findheader.atom                   16-Jul-2024 06:03                 637
eventhttprequest.free.atom                         16-Jul-2024 06:03                 673
eventhttprequest.getbufferevent.atom               16-Jul-2024 06:03                 642
eventhttprequest.getcommand.atom                   16-Jul-2024 06:03                 657
eventhttprequest.getconnection.atom                16-Jul-2024 06:03                 638
eventhttprequest.gethost.atom                      16-Jul-2024 06:03                 632
eventhttprequest.getinputbuffer.atom               16-Jul-2024 06:03                 647
eventhttprequest.getinputheaders.atom              16-Jul-2024 06:03                 695
eventhttprequest.getoutputbuffer.atom              16-Jul-2024 06:03                 659
eventhttprequest.getoutputheaders.atom             16-Jul-2024 06:03                 683
eventhttprequest.getresponsecode.atom              16-Jul-2024 06:03                 648
eventhttprequest.geturi.atom                       16-Jul-2024 06:03                 623
eventhttprequest.removeheader.atom                 16-Jul-2024 06:03                 686
eventhttprequest.senderror.atom                    16-Jul-2024 06:03                 634
eventhttprequest.sendreply.atom                    16-Jul-2024 06:03                 632
eventhttprequest.sendreplychunk.atom               16-Jul-2024 06:03                 703
eventhttprequest.sendreplyend.atom                 16-Jul-2024 06:03                 692
eventhttprequest.sendreplystart.atom               16-Jul-2024 06:03                 644
eventlistener.construct.atom                       16-Jul-2024 06:03                 709
eventlistener.disable.atom                         16-Jul-2024 06:03                 680
eventlistener.enable.atom                          16-Jul-2024 06:03                 663
eventlistener.getbase.atom                         16-Jul-2024 06:03                 721
eventlistener.getsocketname.atom                   16-Jul-2024 06:03                 713
eventlistener.setcallback.atom                     16-Jul-2024 06:03                 607
eventlistener.seterrorcallback.atom                16-Jul-2024 06:03                 698
eventsslcontext.construct.atom                     16-Jul-2024 06:03                 660
eventutil.construct.atom                           16-Jul-2024 06:03                 583
eventutil.getlastsocketerrno.atom                  16-Jul-2024 06:03                 689
eventutil.getlastsocketerror.atom                  16-Jul-2024 06:03                 669
eventutil.getsocketfd.atom                         16-Jul-2024 06:03                 643
eventutil.getsocketname.atom                       16-Jul-2024 06:03                 659
eventutil.setsocketoption.atom                     16-Jul-2024 06:03                 626
eventutil.sslrandpoll.atom                         16-Jul-2024 06:03                 642
evfork.construct.atom                              16-Jul-2024 06:03                 600
evfork.createstopped.atom                          16-Jul-2024 06:03                 668
evidle.construct.atom                              16-Jul-2024 06:03                 600
evidle.createstopped.atom                          16-Jul-2024 06:03                 634
evio.construct.atom                                16-Jul-2024 06:03                 583
evio.createstopped.atom                            16-Jul-2024 06:03                 641
evio.set.atom                                      16-Jul-2024 06:03                 563
evloop.backend.atom                                16-Jul-2024 06:03                 632
evloop.check.atom                                  16-Jul-2024 06:03                 681
evloop.child.atom                                  16-Jul-2024 06:03                 662
evloop.construct.atom                              16-Jul-2024 06:03                 627
evloop.defaultloop.atom                            16-Jul-2024 06:03                 664
evloop.embed.atom                                  16-Jul-2024 06:03                 667
evloop.fork.atom                                   16-Jul-2024 06:03                 689
evloop.idle.atom                                   16-Jul-2024 06:03                 689
evloop.invokepending.atom                          16-Jul-2024 06:03                 705
evloop.io.atom                                     16-Jul-2024 06:03                 681
evloop.loopfork.atom                               16-Jul-2024 06:03                 618
evloop.now.atom                                    16-Jul-2024 06:03                 596
evloop.nowupdate.atom                              16-Jul-2024 06:03                 717
evloop.periodic.atom                               16-Jul-2024 06:03                 702
evloop.prepare.atom                                16-Jul-2024 06:03                 698
evloop.resume.atom                                 16-Jul-2024 06:03                 659
evloop.run.atom                                    16-Jul-2024 06:03                 680
evloop.signal.atom                                 16-Jul-2024 06:03                 694
evloop.stat.atom                                   16-Jul-2024 06:03                 686
evloop.stop.atom                                   16-Jul-2024 06:03                 599
evloop.suspend.atom                                16-Jul-2024 06:03                 570
evloop.timer.atom                                  16-Jul-2024 06:03                 690
evloop.verify.atom                                 16-Jul-2024 06:03                 640
evperiodic.again.atom                              16-Jul-2024 06:03                 633
evperiodic.at.atom                                 16-Jul-2024 06:03                 633
evperiodic.construct.atom                          16-Jul-2024 06:03                 608
evperiodic.createstopped.atom                      16-Jul-2024 06:03                 638
evperiodic.set.atom                                16-Jul-2024 06:03                 573
evprepare.construct.atom                           16-Jul-2024 06:03                 607
evprepare.createstopped.atom                       16-Jul-2024 06:03                 648
evsignal.construct.atom                            16-Jul-2024 06:03                 600
evsignal.createstopped.atom                        16-Jul-2024 06:03                 636
evsignal.set.atom                                  16-Jul-2024 06:03                 567
evstat.attr.atom                                   16-Jul-2024 06:03                 627
evstat.construct.atom                              16-Jul-2024 06:03                 592
evstat.createstopped.atom                          16-Jul-2024 06:03                 628
evstat.prev.atom                                   16-Jul-2024 06:03                 628
evstat.set.atom                                    16-Jul-2024 06:03                 561
evstat.stat.atom                                   16-Jul-2024 06:03                 585
evtimer.again.atom                                 16-Jul-2024 06:03                 588
evtimer.construct.atom                             16-Jul-2024 06:03                 596
evtimer.createstopped.atom                         16-Jul-2024 06:03                 632
evtimer.set.atom                                   16-Jul-2024 06:03                 564
evwatcher.clear.atom                               16-Jul-2024 06:03                 609
evwatcher.construct.atom                           16-Jul-2024 06:03                 605
evwatcher.feed.atom                                16-Jul-2024 06:03                 636
evwatcher.getloop.atom                             16-Jul-2024 06:03                 614
evwatcher.invoke.atom                              16-Jul-2024 06:03                 698
evwatcher.keepalive.atom                           16-Jul-2024 06:03                 590
evwatcher.setcallback.atom                         16-Jul-2024 06:03                 640
evwatcher.start.atom                               16-Jul-2024 06:03                 585
evwatcher.stop.atom                                16-Jul-2024 06:03                 580
example.xml-external-entity.atom                   16-Jul-2024 06:03                 617
example.xml-map-tags.atom                          16-Jul-2024 06:03                 601
example.xml-structure.atom                         16-Jul-2024 06:03                 598
example.xmlwriter-namespace.atom                   16-Jul-2024 06:03                 631
example.xmlwriter-oop.atom                         16-Jul-2024 06:03                 603
example.xmlwriter-simple.atom                      16-Jul-2024 06:03                 623
exception.clone.atom                               16-Jul-2024 06:03                 578
exception.construct.atom                           16-Jul-2024 06:03                 594
exception.getcode.atom                             16-Jul-2024 06:03                 620
exception.getfile.atom                             16-Jul-2024 06:03                 688
exception.getline.atom                             16-Jul-2024 06:03                 688
exception.getmessage.atom                          16-Jul-2024 06:03                 632
exception.getprevious.atom                         16-Jul-2024 06:03                 627
exception.gettrace.atom                            16-Jul-2024 06:03                 615
exception.gettraceasstring.atom                    16-Jul-2024 06:03                 668
exception.tostring.atom                            16-Jul-2024 06:03                 645
exec.resources.atom                                16-Jul-2024 06:03                 572
exec.setup.atom                                    16-Jul-2024 06:03                 792
exif.configuration.atom                            16-Jul-2024 06:03                 619
exif.constants.atom                                16-Jul-2024 06:03                 598
exif.installation.atom                             16-Jul-2024 06:03                 574
exif.requirements.atom                             16-Jul-2024 06:03                 583
exif.resources.atom                                16-Jul-2024 06:03                 572
exif.setup.atom                                    16-Jul-2024 06:03                1500
expect.configuration.atom                          16-Jul-2024 06:03                 625
expect.constants.atom                              16-Jul-2024 06:03                 604
expect.examples-usage.atom                         16-Jul-2024 06:03                 613
expect.examples.atom                               16-Jul-2024 06:03                 818
expect.installation.atom                           16-Jul-2024 06:03                 580
expect.requirements.atom                           16-Jul-2024 06:03                 589
expect.resources.atom                              16-Jul-2024 06:03                 578
expect.setup.atom                                  16-Jul-2024 06:03                1522
extensions.alphabetical.atom                       16-Jul-2024 06:03                 613
extensions.atom                                    16-Jul-2024 06:03                1291
extensions.membership.atom                         16-Jul-2024 06:03                 593
extensions.state.atom                              16-Jul-2024 06:03                 574
fann.constants.atom                                16-Jul-2024 06:03                 598
fann.examples-1.atom                               16-Jul-2024 06:03                 568
fann.examples.atom                                 16-Jul-2024 06:03                 778
fann.installation.atom                             16-Jul-2024 06:03                 574
fann.requirements.atom                             16-Jul-2024 06:03                 583
fann.resources.atom                                16-Jul-2024 06:03                 572
fann.setup.atom                                    16-Jul-2024 06:03                1245
fannconnection.construct.atom                      16-Jul-2024 06:03                 611
fannconnection.getfromneuron.atom                  16-Jul-2024 06:03                 647
fannconnection.gettoneuron.atom                    16-Jul-2024 06:03                 627
fannconnection.getweight.atom                      16-Jul-2024 06:03                 616
fannconnection.setweight.atom                      16-Jul-2024 06:03                 625
faq.atom                                           16-Jul-2024 06:03                3046
faq.build.atom                                     16-Jul-2024 06:03                 573
faq.com.atom                                       16-Jul-2024 06:03                 542
faq.databases.atom                                 16-Jul-2024 06:03                 611
faq.general.atom                                   16-Jul-2024 06:03                 588
faq.html.atom                                      16-Jul-2024 06:03                 546
faq.installation.atom                              16-Jul-2024 06:03                 571
faq.mailinglist.atom                               16-Jul-2024 06:03                 576
faq.misc.atom                                      16-Jul-2024 06:03                 553
faq.obtaining.atom                                 16-Jul-2024 06:03                 561
faq.passwords.atom                                 16-Jul-2024 06:03                 588
faq.using.atom                                     16-Jul-2024 06:03                 550
fdf.constants.atom                                 16-Jul-2024 06:03                 595
fdf.examples.atom                                  16-Jul-2024 06:03                 555
fdf.installation.atom                              16-Jul-2024 06:03                 571
fdf.requirements.atom                              16-Jul-2024 06:03                 580
fdf.resources.atom                                 16-Jul-2024 06:03                 569
fdf.setup.atom                                     16-Jul-2024 06:03                1236
features.atom                                      16-Jul-2024 06:03                3294
features.commandline.atom                          16-Jul-2024 06:03                2473
features.commandline.differences.atom              16-Jul-2024 06:03                 650
features.commandline.ini.atom                      16-Jul-2024 06:03                 601
features.commandline.interactive.atom              16-Jul-2024 06:03                 623
features.commandline.io-streams.atom               16-Jul-2024 06:03                 640
features.commandline.options.atom                  16-Jul-2024 06:03                 623
features.commandline.usage.atom                    16-Jul-2024 06:03                 625
features.commandline.webserver.atom                16-Jul-2024 06:03                 620
features.connection-handling.atom                  16-Jul-2024 06:03                 617
features.cookies.atom                              16-Jul-2024 06:03                 566
features.dtrace.atom                               16-Jul-2024 06:03                1390
features.dtrace.dtrace.atom                        16-Jul-2024 06:03                 599
features.dtrace.introduction.atom                  16-Jul-2024 06:03                 634
features.dtrace.systemtap.atom                     16-Jul-2024 06:03                 644
features.file-upload.atom                          16-Jul-2024 06:03                2291
features.file-upload.common-pitfalls.atom          16-Jul-2024 06:03                 637
features.file-upload.errors.atom                   16-Jul-2024 06:03                 661
features.file-upload.errors.seealso.atom           16-Jul-2024 06:03                 626
features.file-upload.multiple.atom                 16-Jul-2024 06:03                 675
features.file-upload.post-method.atom              16-Jul-2024 06:03                 658
features.file-upload.put-method.atom               16-Jul-2024 06:03                 641
features.gc.atom                                   16-Jul-2024 06:03                1412
features.gc.collecting-cycles.atom                 16-Jul-2024 06:03                 617
features.gc.performance-considerations.atom        16-Jul-2024 06:03                 660
features.gc.refcounting-basics.atom                16-Jul-2024 06:03                 659
features.http-auth.atom                            16-Jul-2024 06:03                 593
features.persistent-connections.atom               16-Jul-2024 06:03                 659
features.remote-files.atom                         16-Jul-2024 06:03                 620
features.session.security.management.atom          16-Jul-2024 06:03                 647
features.sessions.atom                             16-Jul-2024 06:03                 570
features.xforms.atom                               16-Jul-2024 06:03                 575
ffi-ctype.getalignment.atom                        16-Jul-2024 06:03                 588
ffi-ctype.getarrayelementtype.atom                 16-Jul-2024 06:03                 609
ffi-ctype.getarraylength.atom                      16-Jul-2024 06:03                 594
ffi-ctype.getattributes.atom                       16-Jul-2024 06:03                 591
ffi-ctype.getenumkind.atom                         16-Jul-2024 06:03                 585
ffi-ctype.getfuncabi.atom                          16-Jul-2024 06:03                 582
ffi-ctype.getfuncparametercount.atom               16-Jul-2024 06:03                 615
ffi-ctype.getfuncparametertype.atom                16-Jul-2024 06:03                 612
ffi-ctype.getfuncreturntype.atom                   16-Jul-2024 06:03                 603
ffi-ctype.getkind.atom                             16-Jul-2024 06:03                 573
ffi-ctype.getname.atom                             16-Jul-2024 06:03                 573
ffi-ctype.getpointertype.atom                      16-Jul-2024 06:03                 594
ffi-ctype.getsize.atom                             16-Jul-2024 06:03                 573
ffi-ctype.getstructfieldnames.atom                 16-Jul-2024 06:03                 609
ffi-ctype.getstructfieldoffset.atom                16-Jul-2024 06:03                 612
ffi-ctype.getstructfieldtype.atom                  16-Jul-2024 06:03                 606
ffi.addr.atom                                      16-Jul-2024 06:03                 623
ffi.alignof.atom                                   16-Jul-2024 06:03                 592
ffi.arraytype.atom                                 16-Jul-2024 06:03                 602
ffi.cast.atom                                      16-Jul-2024 06:03                 568
ffi.cdef.atom                                      16-Jul-2024 06:03                 570
ffi.configuration.atom                             16-Jul-2024 06:03                 616
ffi.examples-basic.atom                            16-Jul-2024 06:03                 591
ffi.examples-callback.atom                         16-Jul-2024 06:03                 594
ffi.examples-complete.atom                         16-Jul-2024 06:03                 614
ffi.examples.atom                                  16-Jul-2024 06:03                1295
ffi.free.atom                                      16-Jul-2024 06:03                 620
ffi.installation.atom                              16-Jul-2024 06:03                 571
ffi.isnull.atom                                    16-Jul-2024 06:03                 602
ffi.load.atom                                      16-Jul-2024 06:03                 636
ffi.memcmp.atom                                    16-Jul-2024 06:03                 584
ffi.memcpy.atom                                    16-Jul-2024 06:03                 599
ffi.memset.atom                                    16-Jul-2024 06:03                 579
ffi.new.atom                                       16-Jul-2024 06:03                 585
ffi.requirements.atom                              16-Jul-2024 06:03                 580
ffi.resources.atom                                 16-Jul-2024 06:03                 569
ffi.scope.atom                                     16-Jul-2024 06:03                 649
ffi.setup.atom                                     16-Jul-2024 06:03                1489
ffi.sizeof.atom                                    16-Jul-2024 06:03                 619
ffi.string.atom                                    16-Jul-2024 06:03                 639
ffi.type.atom                                      16-Jul-2024 06:03                 625
ffi.typeof.atom                                    16-Jul-2024 06:03                 597
fiber.construct.atom                               16-Jul-2024 06:03                 602
fiber.getcurrent.atom                              16-Jul-2024 06:03                 628
fiber.getreturn.atom                               16-Jul-2024 06:03                 607
fiber.isrunning.atom                               16-Jul-2024 06:03                 629
fiber.isstarted.atom                               16-Jul-2024 06:03                 621
fiber.issuspended.atom                             16-Jul-2024 06:03                 608
fiber.isterminated.atom                            16-Jul-2024 06:03                 621
fiber.resume.atom                                  16-Jul-2024 06:03                 610
fiber.start.atom                                   16-Jul-2024 06:03                 602
fiber.suspend.atom                                 16-Jul-2024 06:03                 606
fiber.throw.atom                                   16-Jul-2024 06:03                 610
fibererror.construct.atom                          16-Jul-2024 06:03                 636
fileinfo.constants.atom                            16-Jul-2024 06:03                 610
fileinfo.installation.atom                         16-Jul-2024 06:03                 586
fileinfo.resources.atom                            16-Jul-2024 06:03                 584
fileinfo.setup.atom                                16-Jul-2024 06:03                1044
filesystem.configuration.atom                      16-Jul-2024 06:03                 637
filesystem.constants.atom                          16-Jul-2024 06:03                 616
filesystem.resources.atom                          16-Jul-2024 06:03                 590
filesystem.setup.atom                              16-Jul-2024 06:03                1089
filesystemiterator.construct.atom                  16-Jul-2024 06:03                 632
filesystemiterator.current.atom                    16-Jul-2024 06:03                 611
filesystemiterator.getflags.atom                   16-Jul-2024 06:03                 627
filesystemiterator.key.atom                        16-Jul-2024 06:03                 598
filesystemiterator.next.atom                       16-Jul-2024 06:03                 604
filesystemiterator.rewind.atom                     16-Jul-2024 06:03                 625
filesystemiterator.setflags.atom                   16-Jul-2024 06:03                 613
filter.configuration.atom                          16-Jul-2024 06:03                 625
filter.constants.atom                              16-Jul-2024 06:03                 604
filter.examples.atom                               16-Jul-2024 06:03                1047
filter.examples.sanitization.atom                  16-Jul-2024 06:03                 604
filter.examples.validation.atom                    16-Jul-2024 06:03                 599
filter.filters.atom                                16-Jul-2024 06:03                1526
filter.filters.flags.atom                          16-Jul-2024 06:03                 591
filter.filters.misc.atom                           16-Jul-2024 06:03                 582
filter.filters.sanitize.atom                       16-Jul-2024 06:03                 600
filter.filters.validate.atom                       16-Jul-2024 06:03                 601
filter.installation.atom                           16-Jul-2024 06:03                 580
filter.resources.atom                              16-Jul-2024 06:03                 578
filter.setup.atom                                  16-Jul-2024 06:03                1289
filteriterator.accept.atom                         16-Jul-2024 06:03                 686
filteriterator.construct.atom                      16-Jul-2024 06:03                 610
filteriterator.current.atom                        16-Jul-2024 06:03                 665
filteriterator.key.atom                            16-Jul-2024 06:03                 622
filteriterator.next.atom                           16-Jul-2024 06:03                 648
filteriterator.rewind.atom                         16-Jul-2024 06:03                 629
filteriterator.valid.atom                          16-Jul-2024 06:03                 648
filters.atom                                       16-Jul-2024 06:03                1513
filters.compression.atom                           16-Jul-2024 06:03                 590
filters.convert.atom                               16-Jul-2024 06:03                 577
filters.encryption.atom                            16-Jul-2024 06:03                 587
filters.string.atom                                16-Jul-2024 06:03                 606
finfo.buffer.atom                                  16-Jul-2024 06:03                 570
finfo.construct.atom                               16-Jul-2024 06:03                 575
finfo.file.atom                                    16-Jul-2024 06:03                 562
finfo.set-flags.atom                               16-Jul-2024 06:03                 582
fpm.observability.atom                             16-Jul-2024 06:03                 802
fpm.setup.atom                                     16-Jul-2024 06:03                 564
fpm.status.atom                                    16-Jul-2024 06:03                 568
ftp.constants.atom                                 16-Jul-2024 06:03                 595
ftp.examples-basic.atom                            16-Jul-2024 06:03                 583
ftp.examples.atom                                  16-Jul-2024 06:03                 787
ftp.installation.atom                              16-Jul-2024 06:03                 571
ftp.resources.atom                                 16-Jul-2024 06:03                 569
ftp.setup.atom                                     16-Jul-2024 06:03                1009
funchand.resources.atom                            16-Jul-2024 06:03                 584
funchand.setup.atom                                16-Jul-2024 06:03                 812
funcref.atom                                       16-Jul-2024 06:03                6961
function.abs.atom                                  16-Jul-2024 06:03                 561
function.acos.atom                                 16-Jul-2024 06:03                 561
function.acosh.atom                                16-Jul-2024 06:03                 577
function.addcslashes.atom                          16-Jul-2024 06:03                 648
function.addslashes.atom                           16-Jul-2024 06:03                 615
function.apache-child-terminate.atom               16-Jul-2024 06:03                 672
function.apache-get-modules.atom                   16-Jul-2024 06:03                 647
function.apache-get-version.atom                   16-Jul-2024 06:03                 647
function.apache-getenv.atom                        16-Jul-2024 06:03                 613
function.apache-lookup-uri.atom                    16-Jul-2024 06:03                 729
function.apache-note.atom                          16-Jul-2024 06:03                 622
function.apache-request-headers.atom               16-Jul-2024 06:03                 691
function.apache-response-headers.atom              16-Jul-2024 06:03                 692
function.apache-setenv.atom                        16-Jul-2024 06:03                 617
function.apcu-add.atom                             16-Jul-2024 06:03                 653
function.apcu-cache-info.atom                      16-Jul-2024 06:03                 714
function.apcu-cas.atom                             16-Jul-2024 06:03                 607
function.apcu-clear-cache.atom                     16-Jul-2024 06:03                 606
function.apcu-dec.atom                             16-Jul-2024 06:03                 622
function.apcu-delete.atom                          16-Jul-2024 06:03                 618
function.apcu-enabled.atom                         16-Jul-2024 06:03                 649
function.apcu-entry.atom                           16-Jul-2024 06:03                 674
function.apcu-exists.atom                          16-Jul-2024 06:03                 621
function.apcu-fetch.atom                           16-Jul-2024 06:03                 644
function.apcu-inc.atom                             16-Jul-2024 06:03                 611
function.apcu-key-info.atom                        16-Jul-2024 06:03                 666
function.apcu-sma-info.atom                        16-Jul-2024 06:03                 678
function.apcu-store.atom                           16-Jul-2024 06:03                 650
function.array-change-key-case.atom                16-Jul-2024 06:03                 664
function.array-chunk.atom                          16-Jul-2024 06:03                 643
function.array-column.atom                         16-Jul-2024 06:03                 656
function.array-combine.atom                        16-Jul-2024 06:03                 647
function.array-count-values.atom                   16-Jul-2024 06:03                 657
function.array-diff-assoc.atom                     16-Jul-2024 06:03                 683
function.array-diff-key.atom                       16-Jul-2024 06:03                 679
function.array-diff-uassoc.atom                    16-Jul-2024 06:03                 724
function.array-diff-ukey.atom                      16-Jul-2024 06:03                 712
function.array-diff.atom                           16-Jul-2024 06:03                 619
function.array-fill-keys.atom                      16-Jul-2024 06:03                 664
function.array-fill.atom                           16-Jul-2024 06:03                 617
function.array-filter.atom                         16-Jul-2024 06:03                 685
function.array-flip.atom                           16-Jul-2024 06:03                 652
function.array-intersect-assoc.atom                16-Jul-2024 06:03                 674
function.array-intersect-key.atom                  16-Jul-2024 06:03                 689
function.array-intersect-uassoc.atom               16-Jul-2024 06:03                 734
function.array-intersect-ukey.atom                 16-Jul-2024 06:03                 719
function.array-intersect.atom                      16-Jul-2024 06:03                 622
function.array-is-list.atom                        16-Jul-2024 06:03                 638
function.array-key-exists.atom                     16-Jul-2024 06:03                 649
function.array-key-first.atom                      16-Jul-2024 06:03                 669
function.array-key-last.atom                       16-Jul-2024 06:03                 666
function.array-keys.atom                           16-Jul-2024 06:03                 656
function.array-map.atom                            16-Jul-2024 06:03                 643
function.array-merge-recursive.atom                16-Jul-2024 06:03                 668
function.array-merge.atom                          16-Jul-2024 06:03                 609
function.array-multisort.atom                      16-Jul-2024 06:03                 619
function.array-pad.atom                            16-Jul-2024 06:03                 679
function.array-pop.atom                            16-Jul-2024 06:03                 643
function.array-product.atom                        16-Jul-2024 06:03                 618
function.array-push.atom                           16-Jul-2024 06:03                 659
function.array-rand.atom                           16-Jul-2024 06:03                 633
function.array-reduce.atom                         16-Jul-2024 06:03                 627
function.array-replace-recursive.atom              16-Jul-2024 06:03                 727
function.array-replace.atom                        16-Jul-2024 06:03                 670
function.array-reverse.atom                        16-Jul-2024 06:03                 650
function.array-search.atom                         16-Jul-2024 06:03                 680
function.array-shift.atom                          16-Jul-2024 06:03                 659
function.array-slice.atom                          16-Jul-2024 06:03                 601
function.array-splice.atom                         16-Jul-2024 06:03                 615
function.array-sum.atom                            16-Jul-2024 06:03                 604
function.array-udiff-assoc.atom                    16-Jul-2024 06:03                 742
function.array-udiff-uassoc.atom                   16-Jul-2024 06:03                 729
function.array-udiff.atom                          16-Jul-2024 06:03                 656
function.array-uintersect-assoc.atom               16-Jul-2024 06:03                 751
function.array-uintersect-uassoc.atom              16-Jul-2024 06:03                 818
function.array-uintersect.atom                     16-Jul-2024 06:03                 701
function.array-unique.atom                         16-Jul-2024 06:03                 607
function.array-unshift.atom                        16-Jul-2024 06:03                 668
function.array-values.atom                         16-Jul-2024 06:03                 619
function.array-walk-recursive.atom                 16-Jul-2024 06:03                 699
function.array-walk.atom                           16-Jul-2024 06:03                 694
function.array.atom                                16-Jul-2024 06:03                 579
function.arsort.atom                               16-Jul-2024 06:03                 644
function.asin.atom                                 16-Jul-2024 06:03                 559
function.asinh.atom                                16-Jul-2024 06:03                 575
function.asort.atom                                16-Jul-2024 06:03                 628
function.assert-options.atom                       16-Jul-2024 06:03                 678
function.assert.atom                               16-Jul-2024 06:03                 588
function.atan.atom                                 16-Jul-2024 06:03                 562
function.atan2.atom                                16-Jul-2024 06:03                 582
function.atanh.atom                                16-Jul-2024 06:03                 578
function.autoload.atom                             16-Jul-2024 06:03                 610
function.base-convert.atom                         16-Jul-2024 06:03                 621
function.base64-decode.atom                        16-Jul-2024 06:03                 630
function.base64-encode.atom                        16-Jul-2024 06:03                 619
function.basename.atom                             16-Jul-2024 06:03                 618
function.bcadd.atom                                16-Jul-2024 06:03                 593
function.bccomp.atom                               16-Jul-2024 06:03                 593
function.bcdiv.atom                                16-Jul-2024 06:03                 589
function.bcmod.atom                                16-Jul-2024 06:03                 621
function.bcmul.atom                                16-Jul-2024 06:03                 592
function.bcpow.atom                                16-Jul-2024 06:03                 635
function.bcpowmod.atom                             16-Jul-2024 06:03                 657
function.bcscale.atom                              16-Jul-2024 06:03                 691
function.bcsqrt.atom                               16-Jul-2024 06:03                 648
function.bcsub.atom                                16-Jul-2024 06:03                 605
function.bin2hex.atom                              16-Jul-2024 06:03                 653
function.bind-textdomain-codeset.atom              16-Jul-2024 06:03                 747
function.bindec.atom                               16-Jul-2024 06:03                 598
function.bindtextdomain.atom                       16-Jul-2024 06:03                 661
function.boolval.atom                              16-Jul-2024 06:03                 640
function.bzclose.atom                              16-Jul-2024 06:03                 581
function.bzcompress.atom                           16-Jul-2024 06:03                 609
function.bzdecompress.atom                         16-Jul-2024 06:03                 623
function.bzerrno.atom                              16-Jul-2024 06:03                 595
function.bzerror.atom                              16-Jul-2024 06:03                 638
function.bzerrstr.atom                             16-Jul-2024 06:03                 601
function.bzflush.atom                              16-Jul-2024 06:03                 571
function.bzopen.atom                               16-Jul-2024 06:03                 604
function.bzread.atom                               16-Jul-2024 06:03                 595
function.bzwrite.atom                              16-Jul-2024 06:03                 608
function.cal-days-in-month.atom                    16-Jul-2024 06:03                 690
function.cal-from-jd.atom                          16-Jul-2024 06:03                 645
function.cal-info.atom                             16-Jul-2024 06:03                 611
function.cal-to-jd.atom                            16-Jul-2024 06:03                 614
function.call-user-func-array.atom                 16-Jul-2024 06:03                 692
function.call-user-func.atom                       16-Jul-2024 06:03                 642
function.ceil.atom                                 16-Jul-2024 06:03                 589
function.chdir.atom                                16-Jul-2024 06:03                 570
function.checkdate.atom                            16-Jul-2024 06:03                 603
function.checkdnsrr.atom                           16-Jul-2024 06:03                 615
function.chgrp.atom                                16-Jul-2024 06:03                 587
function.chmod.atom                                16-Jul-2024 06:03                 578
function.chop.atom                                 16-Jul-2024 06:03                 564
function.chown.atom                                16-Jul-2024 06:03                 597
function.chr.atom                                  16-Jul-2024 06:03                 650
function.chroot.atom                               16-Jul-2024 06:03                 580
function.chunk-split.atom                          16-Jul-2024 06:03                 598
function.class-alias.atom                          16-Jul-2024 06:03                 605
function.class-exists.atom                         16-Jul-2024 06:03                 653
function.class-implements.atom                     16-Jul-2024 06:03                 694
function.class-parents.atom                        16-Jul-2024 06:03                 624
function.class-uses.atom                           16-Jul-2024 06:03                 641
function.clearstatcache.atom                       16-Jul-2024 06:03                 603
function.cli-get-process-title.atom                16-Jul-2024 06:03                 639
function.cli-set-process-title.atom                16-Jul-2024 06:03                 641
function.closedir.atom                             16-Jul-2024 06:03                 594
function.closelog.atom                             16-Jul-2024 06:03                 630
function.com-create-guid.atom                      16-Jul-2024 06:03                 647
function.com-event-sink.atom                       16-Jul-2024 06:03                 662
function.com-get-active-object.atom                16-Jul-2024 06:03                 687
function.com-load-typelib.atom                     16-Jul-2024 06:03                 603
function.com-message-pump.atom                     16-Jul-2024 06:03                 649
function.com-print-typeinfo.atom                   16-Jul-2024 06:03                 683
function.commonmark-parse.atom                     16-Jul-2024 06:03                 593
function.commonmark-render-html.atom               16-Jul-2024 06:03                 613
function.commonmark-render-latex.atom              16-Jul-2024 06:03                 616
function.commonmark-render-man.atom                16-Jul-2024 06:03                 610
function.commonmark-render-xml.atom                16-Jul-2024 06:03                 610
function.commonmark-render.atom                    16-Jul-2024 06:03                 598
function.compact.atom                              16-Jul-2024 06:03                 636
function.connection-aborted.atom                   16-Jul-2024 06:03                 661
function.connection-status.atom                    16-Jul-2024 06:03                 637
function.constant.atom                             16-Jul-2024 06:03                 601
function.convert-cyr-string.atom                   16-Jul-2024 06:03                 698
function.convert-uudecode.atom                     16-Jul-2024 06:03                 643
function.convert-uuencode.atom                     16-Jul-2024 06:03                 678
function.copy.atom                                 16-Jul-2024 06:03                 566
function.cos.atom                                  16-Jul-2024 06:03                 554
function.cosh.atom                                 16-Jul-2024 06:03                 570
function.count-chars.atom                          16-Jul-2024 06:03                 672
function.count.atom                                16-Jul-2024 06:03                 644
function.crc32.atom                                16-Jul-2024 06:03                 597
function.create-function.atom                      16-Jul-2024 06:03                 619
function.crypt.atom                                16-Jul-2024 06:03                 613
function.ctype-alnum.atom                          16-Jul-2024 06:03                 648
function.ctype-alpha.atom                          16-Jul-2024 06:03                 646
function.ctype-cntrl.atom                          16-Jul-2024 06:03                 671
function.ctype-digit.atom                          16-Jul-2024 06:03                 632
function.ctype-graph.atom                          16-Jul-2024 06:03                 633
function.ctype-lower.atom                          16-Jul-2024 06:03                 636
function.ctype-print.atom                          16-Jul-2024 06:03                 633
function.ctype-punct.atom                          16-Jul-2024 06:03                 645
function.ctype-space.atom                          16-Jul-2024 06:03                 671
function.ctype-upper.atom                          16-Jul-2024 06:03                 636
function.ctype-xdigit.atom                         16-Jul-2024 06:03                 679
function.cubrid-affected-rows.atom                 16-Jul-2024 06:03                 718
function.cubrid-bind.atom                          16-Jul-2024 06:03                 652
function.cubrid-client-encoding.atom               16-Jul-2024 06:03                 696
function.cubrid-close-prepare.atom                 16-Jul-2024 06:03                 640
function.cubrid-close-request.atom                 16-Jul-2024 06:03                 640
function.cubrid-close.atom                         16-Jul-2024 06:03                 600
function.cubrid-col-get.atom                       16-Jul-2024 06:03                 709
function.cubrid-col-size.atom                      16-Jul-2024 06:03                 731
function.cubrid-column-names.atom                  16-Jul-2024 06:03                 669
function.cubrid-column-types.atom                  16-Jul-2024 06:03                 670
function.cubrid-commit.atom                        16-Jul-2024 06:03                 599
function.cubrid-connect-with-url.atom              16-Jul-2024 06:03                 683
function.cubrid-connect.atom                       16-Jul-2024 06:03                 617
function.cubrid-current-oid.atom                   16-Jul-2024 06:03                 671
function.cubrid-data-seek.atom                     16-Jul-2024 06:03                 664
function.cubrid-db-name.atom                       16-Jul-2024 06:03                 701
function.cubrid-disconnect.atom                    16-Jul-2024 06:03                 650
function.cubrid-drop.atom                          16-Jul-2024 06:03                 613
function.cubrid-errno.atom                         16-Jul-2024 06:03                 645
function.cubrid-error-code-facility.atom           16-Jul-2024 06:03                 671
function.cubrid-error-code.atom                    16-Jul-2024 06:03                 676
function.cubrid-error-msg.atom                     16-Jul-2024 06:03                 683
function.cubrid-error.atom                         16-Jul-2024 06:03                 632
function.cubrid-execute.atom                       16-Jul-2024 06:03                 655
function.cubrid-fetch-array.atom                   16-Jul-2024 06:03                 734
function.cubrid-fetch-assoc.atom                   16-Jul-2024 06:03                 701
function.cubrid-fetch-field.atom                   16-Jul-2024 06:03                 701
function.cubrid-fetch-lengths.atom                 16-Jul-2024 06:03                 690
function.cubrid-fetch-object.atom                  16-Jul-2024 06:03                 689
function.cubrid-fetch-row.atom                     16-Jul-2024 06:03                 664
function.cubrid-fetch.atom                         16-Jul-2024 06:03                 654
function.cubrid-field-flags.atom                   16-Jul-2024 06:03                 670
function.cubrid-field-len.atom                     16-Jul-2024 06:03                 677
function.cubrid-field-name.atom                    16-Jul-2024 06:03                 644
function.cubrid-field-seek.atom                    16-Jul-2024 06:03                 707
function.cubrid-field-table.atom                   16-Jul-2024 06:03                 666
function.cubrid-field-type.atom                    16-Jul-2024 06:03                 674
function.cubrid-free-result.atom                   16-Jul-2024 06:03                 700
function.cubrid-get-autocommit.atom                16-Jul-2024 06:03                 667
function.cubrid-get-charset.atom                   16-Jul-2024 06:03                 684
function.cubrid-get-class-name.atom                16-Jul-2024 06:03                 672
function.cubrid-get-client-info.atom               16-Jul-2024 06:03                 661
function.cubrid-get-db-parameter.atom              16-Jul-2024 06:03                 681
function.cubrid-get-query-timeout.atom             16-Jul-2024 06:03                 722
function.cubrid-get-server-info.atom               16-Jul-2024 06:03                 641
function.cubrid-get.atom                           16-Jul-2024 06:03                 631
function.cubrid-insert-id.atom                     16-Jul-2024 06:03                 733
function.cubrid-is-instance.atom                   16-Jul-2024 06:03                 633
function.cubrid-list-dbs.atom                      16-Jul-2024 06:03                 681
function.cubrid-load-from-glo.atom                 16-Jul-2024 06:03                 623
function.cubrid-lob-close.atom                     16-Jul-2024 06:03                 604
function.cubrid-lob-export.atom                    16-Jul-2024 06:03                 645
function.cubrid-lob-get.atom                       16-Jul-2024 06:03                 643
function.cubrid-lob-send.atom                      16-Jul-2024 06:03                 647
function.cubrid-lob-size.atom                      16-Jul-2024 06:03                 656
function.cubrid-lob2-bind.atom                     16-Jul-2024 06:03                 767
function.cubrid-lob2-close.atom                    16-Jul-2024 06:03                 607
function.cubrid-lob2-export.atom                   16-Jul-2024 06:03                 628
function.cubrid-lob2-import.atom                   16-Jul-2024 06:03                 650
function.cubrid-lob2-new.atom                      16-Jul-2024 06:03                 618
function.cubrid-lob2-read.atom                     16-Jul-2024 06:03                 622
function.cubrid-lob2-seek.atom                     16-Jul-2024 06:03                 635
function.cubrid-lob2-seek64.atom                   16-Jul-2024 06:03                 641
function.cubrid-lob2-size.atom                     16-Jul-2024 06:03                 646
function.cubrid-lob2-size64.atom                   16-Jul-2024 06:03                 652
function.cubrid-lob2-tell.atom                     16-Jul-2024 06:03                 657
function.cubrid-lob2-tell64.atom                   16-Jul-2024 06:03                 667
function.cubrid-lob2-write.atom                    16-Jul-2024 06:03                 612
function.cubrid-lock-read.atom                     16-Jul-2024 06:03                 634
function.cubrid-lock-write.atom                    16-Jul-2024 06:03                 653
function.cubrid-move-cursor.atom                   16-Jul-2024 06:03                 649
function.cubrid-new-glo.atom                       16-Jul-2024 06:03                 612
function.cubrid-next-result.atom                   16-Jul-2024 06:03                 754
function.cubrid-num-cols.atom                      16-Jul-2024 06:03                 666
function.cubrid-num-fields.atom                    16-Jul-2024 06:03                 655
function.cubrid-num-rows.atom                      16-Jul-2024 06:03                 671
function.cubrid-pconnect-with-url.atom             16-Jul-2024 06:03                 664
function.cubrid-pconnect.atom                      16-Jul-2024 06:03                 637
function.cubrid-ping.atom                          16-Jul-2024 06:03                 663
function.cubrid-prepare.atom                       16-Jul-2024 06:03                 654
function.cubrid-put.atom                           16-Jul-2024 06:03                 617
function.cubrid-query.atom                         16-Jul-2024 06:03                 608
function.cubrid-real-escape-string.atom            16-Jul-2024 06:03                 757
function.cubrid-result.atom                        16-Jul-2024 06:03                 650
function.cubrid-rollback.atom                      16-Jul-2024 06:03                 605
function.cubrid-save-to-glo.atom                   16-Jul-2024 06:03                 635
function.cubrid-schema.atom                        16-Jul-2024 06:03                 649
function.cubrid-send-glo.atom                      16-Jul-2024 06:03                 633
function.cubrid-seq-drop.atom                      16-Jul-2024 06:03                 655
function.cubrid-seq-insert.atom                    16-Jul-2024 06:03                 668
function.cubrid-seq-put.atom                       16-Jul-2024 06:03                 682
function.cubrid-set-add.atom                       16-Jul-2024 06:03                 686
function.cubrid-set-autocommit.atom                16-Jul-2024 06:03                 657
function.cubrid-set-db-parameter.atom              16-Jul-2024 06:03                 688
function.cubrid-set-drop.atom                      16-Jul-2024 06:03                 624
function.cubrid-set-query-timeout.atom             16-Jul-2024 06:03                 713
function.cubrid-unbuffered-query.atom              16-Jul-2024 06:03                 711
function.cubrid-version.atom                       16-Jul-2024 06:03                 642
function.curl-close.atom                           16-Jul-2024 06:03                 590
function.curl-copy-handle.atom                     16-Jul-2024 06:03                 660
function.curl-errno.atom                           16-Jul-2024 06:03                 614
function.curl-error.atom                           16-Jul-2024 06:03                 645
function.curl-escape.atom                          16-Jul-2024 06:03                 609
function.curl-exec.atom                            16-Jul-2024 06:03                 600
function.curl-getinfo.atom                         16-Jul-2024 06:03                 634
function.curl-init.atom                            16-Jul-2024 06:03                 592
function.curl-multi-add-handle.atom                16-Jul-2024 06:03                 656
function.curl-multi-close.atom                     16-Jul-2024 06:03                 617
function.curl-multi-errno.atom                     16-Jul-2024 06:03                 651
function.curl-multi-exec.atom                      16-Jul-2024 06:03                 648
function.curl-multi-getcontent.atom                16-Jul-2024 06:03                 669
function.curl-multi-info-read.atom                 16-Jul-2024 06:03                 645
function.curl-multi-init.atom                      16-Jul-2024 06:03                 616
function.curl-multi-remove-handle.atom             16-Jul-2024 06:03                 659
function.curl-multi-select.atom                    16-Jul-2024 06:03                 666
function.curl-multi-setopt.atom                    16-Jul-2024 06:03                 632
function.curl-multi-strerror.atom                  16-Jul-2024 06:03                 640
function.curl-pause.atom                           16-Jul-2024 06:03                 615
function.curl-reset.atom                           16-Jul-2024 06:03                 653
function.curl-setopt-array.atom                    16-Jul-2024 06:03                 634
function.curl-setopt.atom                          16-Jul-2024 06:03                 621
function.curl-share-close.atom                     16-Jul-2024 06:03                 631
function.curl-share-errno.atom                     16-Jul-2024 06:03                 677
function.curl-share-init.atom                      16-Jul-2024 06:03                 633
function.curl-share-setopt.atom                    16-Jul-2024 06:03                 658
function.curl-share-strerror.atom                  16-Jul-2024 06:03                 676
function.curl-strerror.atom                        16-Jul-2024 06:03                 639
function.curl-unescape.atom                        16-Jul-2024 06:03                 612
function.curl-version.atom                         16-Jul-2024 06:03                 610
function.curl_upkeep.atom                          16-Jul-2024 06:03                 634
function.current.atom                              16-Jul-2024 06:03                 623
function.date-add.atom                             16-Jul-2024 06:03                 584
function.date-create-from-format.atom              16-Jul-2024 06:03                 642
function.date-create-immutable-from-format.atom    16-Jul-2024 06:03                 681
function.date-create-immutable.atom                16-Jul-2024 06:03                 650
function.date-create.atom                          16-Jul-2024 06:03                 615
function.date-date-set.atom                        16-Jul-2024 06:03                 603
function.date-default-timezone-get.atom            16-Jul-2024 06:03                 768
function.date-default-timezone-set.atom            16-Jul-2024 06:03                 719
function.date-diff.atom                            16-Jul-2024 06:03                 588
function.date-format.atom                          16-Jul-2024 06:03                 596
function.date-get-last-errors.atom                 16-Jul-2024 06:03                 639
function.date-interval-create-from-date-string...> 16-Jul-2024 06:03                 692
function.date-interval-format.atom                 16-Jul-2024 06:03                 627
function.date-isodate-set.atom                     16-Jul-2024 06:03                 615
function.date-modify.atom                          16-Jul-2024 06:03                 596
function.date-offset-get.atom                      16-Jul-2024 06:03                 611
function.date-parse-from-format.atom               16-Jul-2024 06:03                 725
function.date-parse.atom                           16-Jul-2024 06:03                 691
function.date-sub.atom                             16-Jul-2024 06:03                 584
function.date-sun-info.atom                        16-Jul-2024 06:03                 708
function.date-sunrise.atom                         16-Jul-2024 06:03                 659
function.date-sunset.atom                          16-Jul-2024 06:03                 658
function.date-time-set.atom                        16-Jul-2024 06:03                 603
function.date-timestamp-get.atom                   16-Jul-2024 06:03                 623
function.date-timestamp-set.atom                   16-Jul-2024 06:03                 623
function.date-timezone-get.atom                    16-Jul-2024 06:03                 619
function.date-timezone-set.atom                    16-Jul-2024 06:03                 619
function.date.atom                                 16-Jul-2024 06:03                 576
function.db2-autocommit.atom                       16-Jul-2024 06:03                 695
function.db2-bind-param.atom                       16-Jul-2024 06:03                 674
function.db2-client-info.atom                      16-Jul-2024 06:03                 711
function.db2-close.atom                            16-Jul-2024 06:03                 614
function.db2-column-privileges.atom                16-Jul-2024 06:03                 707
function.db2-columns.atom                          16-Jul-2024 06:03                 689
function.db2-commit.atom                           16-Jul-2024 06:03                 589
function.db2-conn-error.atom                       16-Jul-2024 06:03                 715
function.db2-conn-errormsg.atom                    16-Jul-2024 06:03                 677
function.db2-connect.atom                          16-Jul-2024 06:03                 637
function.db2-cursor-type.atom                      16-Jul-2024 06:03                 647
function.db2-escape-string.atom                    16-Jul-2024 06:03                 663
function.db2-exec.atom                             16-Jul-2024 06:03                 618
function.db2-execute.atom                          16-Jul-2024 06:03                 646
function.db2-fetch-array.atom                      16-Jul-2024 06:03                 719
function.db2-fetch-assoc.atom                      16-Jul-2024 06:03                 709
function.db2-fetch-both.atom                       16-Jul-2024 06:03                 718
function.db2-fetch-object.atom                     16-Jul-2024 06:03                 708
function.db2-fetch-row.atom                        16-Jul-2024 06:03                 706
function.db2-field-display-size.atom               16-Jul-2024 06:03                 670
function.db2-field-name.atom                       16-Jul-2024 06:03                 640
function.db2-field-num.atom                        16-Jul-2024 06:03                 649
function.db2-field-precision.atom                  16-Jul-2024 06:03                 692
function.db2-field-scale.atom                      16-Jul-2024 06:03                 682
function.db2-field-type.atom                       16-Jul-2024 06:03                 682
function.db2-field-width.atom                      16-Jul-2024 06:03                 692
function.db2-foreign-keys.atom                     16-Jul-2024 06:03                 703
function.db2-free-result.atom                      16-Jul-2024 06:03                 686
function.db2-free-stmt.atom                        16-Jul-2024 06:03                 682
function.db2-get-option.atom                       16-Jul-2024 06:03                 682
function.db2-last-insert-id.atom                   16-Jul-2024 06:03                 716
function.db2-lob-read.atom                         16-Jul-2024 06:03                 706
function.db2-next-result.atom                      16-Jul-2024 06:03                 666
function.db2-num-fields.atom                       16-Jul-2024 06:03                 647
function.db2-num-rows.atom                         16-Jul-2024 06:03                 653
function.db2-pclose.atom                           16-Jul-2024 06:03                 642
function.db2-pconnect.atom                         16-Jul-2024 06:03                 652
function.db2-prepare.atom                          16-Jul-2024 06:03                 674
function.db2-primary-keys.atom                     16-Jul-2024 06:03                 670
function.db2-procedure-columns.atom                16-Jul-2024 06:03                 720
function.db2-procedures.atom                       16-Jul-2024 06:03                 737
function.db2-result.atom                           16-Jul-2024 06:03                 643
function.db2-rollback.atom                         16-Jul-2024 06:03                 596
function.db2-server-info.atom                      16-Jul-2024 06:03                 712
function.db2-set-option.atom                       16-Jul-2024 06:03                 633
function.db2-special-columns.atom                  16-Jul-2024 06:03                 695
function.db2-statistics.atom                       16-Jul-2024 06:03                 670
function.db2-stmt-error.atom                       16-Jul-2024 06:03                 692
function.db2-stmt-errormsg.atom                    16-Jul-2024 06:03                 663
function.db2-table-privileges.atom                 16-Jul-2024 06:03                 763
function.db2-tables.atom                           16-Jul-2024 06:03                 639
function.dba-close.atom                            16-Jul-2024 06:03                 583
function.dba-delete.atom                           16-Jul-2024 06:03                 602
function.dba-exists.atom                           16-Jul-2024 06:03                 624
function.dba-fetch.atom                            16-Jul-2024 06:03                 644
function.dba-firstkey.atom                         16-Jul-2024 06:03                 619
function.dba-handlers.atom                         16-Jul-2024 06:03                 613
function.dba-insert.atom                           16-Jul-2024 06:03                 611
function.dba-key-split.atom                        16-Jul-2024 06:03                 708
function.dba-list.atom                             16-Jul-2024 06:03                 628
function.dba-nextkey.atom                          16-Jul-2024 06:03                 605
function.dba-open.atom                             16-Jul-2024 06:03                 602
function.dba-optimize.atom                         16-Jul-2024 06:03                 595
function.dba-popen.atom                            16-Jul-2024 06:03                 644
function.dba-replace.atom                          16-Jul-2024 06:03                 614
function.dba-sync.atom                             16-Jul-2024 06:03                 608
function.dbase-add-record.atom                     16-Jul-2024 06:03                 652
function.dbase-close.atom                          16-Jul-2024 06:03                 591
function.dbase-create.atom                         16-Jul-2024 06:03                 626
function.dbase-delete-record.atom                  16-Jul-2024 06:03                 639
function.dbase-get-header-info.atom                16-Jul-2024 06:03                 717
function.dbase-get-record-with-names.atom          16-Jul-2024 06:03                 704
function.dbase-get-record.atom                     16-Jul-2024 06:03                 627
function.dbase-numfields.atom                      16-Jul-2024 06:03                 631
function.dbase-numrecords.atom                     16-Jul-2024 06:03                 645
function.dbase-open.atom                           16-Jul-2024 06:03                 588
function.dbase-pack.atom                           16-Jul-2024 06:03                 591
function.dbase-replace-record.atom                 16-Jul-2024 06:03                 644
function.dcgettext.atom                            16-Jul-2024 06:03                 610
function.dcngettext.atom                           16-Jul-2024 06:03                 598
function.debug-backtrace.atom                      16-Jul-2024 06:03                 646
function.debug-print-backtrace.atom                16-Jul-2024 06:03                 648
function.debug-zval-dump.atom                      16-Jul-2024 06:03                 708
function.decbin.atom                               16-Jul-2024 06:03                 598
function.dechex.atom                               16-Jul-2024 06:03                 613
function.decoct.atom                               16-Jul-2024 06:03                 596
function.define.atom                               16-Jul-2024 06:03                 588
function.defined.atom                              16-Jul-2024 06:03                 630
function.deflate-add.atom                          16-Jul-2024 06:03                 597
function.deflate-init.atom                         16-Jul-2024 06:03                 615
function.deg2rad.atom                              16-Jul-2024 06:03                 610
function.delete.atom                               16-Jul-2024 06:03                 576
function.dgettext.atom                             16-Jul-2024 06:03                 589
function.die.atom                                  16-Jul-2024 06:03                 572
function.dio-close.atom                            16-Jul-2024 06:03                 605
function.dio-fcntl.atom                            16-Jul-2024 06:03                 617
function.dio-open.atom                             16-Jul-2024 06:03                 640
function.dio-read.atom                             16-Jul-2024 06:03                 592
function.dio-seek.atom                             16-Jul-2024 06:03                 611
function.dio-stat.atom                             16-Jul-2024 06:03                 597
function.dio-tcsetattr.atom                        16-Jul-2024 06:03                 654
function.dio-truncate.atom                         16-Jul-2024 06:03                 592
function.dio-write.atom                            16-Jul-2024 06:03                 678
function.dir.atom                                  16-Jul-2024 06:03                 591
function.dirname.atom                              16-Jul-2024 06:03                 594
function.disk-free-space.atom                      16-Jul-2024 06:03                 676
function.disk-total-space.atom                     16-Jul-2024 06:03                 646
function.diskfreespace.atom                        16-Jul-2024 06:03                 601
function.dl.atom                                   16-Jul-2024 06:03                 601
function.dngettext.atom                            16-Jul-2024 06:03                 594
function.dns-check-record.atom                     16-Jul-2024 06:03                 605
function.dns-get-mx.atom                           16-Jul-2024 06:03                 584
function.dns-get-record.atom                       16-Jul-2024 06:03                 662
function.dom-import-simplexml.atom                 16-Jul-2024 06:03                 657
function.doubleval.atom                            16-Jul-2024 06:03                 582
function.each.atom                                 16-Jul-2024 06:03                 611
function.easter-date.atom                          16-Jul-2024 06:03                 684
function.easter-days.atom                          16-Jul-2024 06:03                 680
function.echo.atom                                 16-Jul-2024 06:03                 603
function.eio-busy.atom                             16-Jul-2024 06:03                 627
function.eio-cancel.atom                           16-Jul-2024 06:03                 596
function.eio-chmod.atom                            16-Jul-2024 06:03                 614
function.eio-chown.atom                            16-Jul-2024 06:03                 614
function.eio-close.atom                            16-Jul-2024 06:03                 581
function.eio-custom.atom                           16-Jul-2024 06:03                 679
function.eio-dup2.atom                             16-Jul-2024 06:03                 596
function.eio-event-loop.atom                       16-Jul-2024 06:03                 653
function.eio-fallocate.atom                        16-Jul-2024 06:03                 691
function.eio-fchmod.atom                           16-Jul-2024 06:03                 606
function.eio-fchown.atom                           16-Jul-2024 06:03                 613
function.eio-fdatasync.atom                        16-Jul-2024 06:03                 679
function.eio-fstat.atom                            16-Jul-2024 06:03                 623
function.eio-fstatvfs.atom                         16-Jul-2024 06:03                 659
function.eio-fsync.atom                            16-Jul-2024 06:03                 667
function.eio-ftruncate.atom                        16-Jul-2024 06:03                 595
function.eio-futime.atom                           16-Jul-2024 06:03                 676
function.eio-get-event-stream.atom                 16-Jul-2024 06:03                 738
function.eio-get-last-error.atom                   16-Jul-2024 06:03                 730
function.eio-grp-add.atom                          16-Jul-2024 06:03                 631
function.eio-grp-cancel.atom                       16-Jul-2024 06:03                 618
function.eio-grp-limit.atom                        16-Jul-2024 06:03                 622
function.eio-grp.atom                              16-Jul-2024 06:03                 606
function.eio-init.atom                             16-Jul-2024 06:03                 581
function.eio-link.atom                             16-Jul-2024 06:03                 605
function.eio-lstat.atom                            16-Jul-2024 06:03                 623
function.eio-mkdir.atom                            16-Jul-2024 06:03                 591
function.eio-mknod.atom                            16-Jul-2024 06:03                 623
function.eio-nop.atom                              16-Jul-2024 06:03                 663
function.eio-npending.atom                         16-Jul-2024 06:03                 635
function.eio-nready.atom                           16-Jul-2024 06:03                 648
function.eio-nreqs.atom                            16-Jul-2024 06:03                 646
function.eio-nthreads.atom                         16-Jul-2024 06:03                 636
function.eio-open.atom                             16-Jul-2024 06:03                 578
function.eio-poll.atom                             16-Jul-2024 06:03                 656
function.eio-read.atom                             16-Jul-2024 06:03                 635
function.eio-readahead.atom                        16-Jul-2024 06:03                 643
function.eio-readdir.atom                          16-Jul-2024 06:03                 603
function.eio-readlink.atom                         16-Jul-2024 06:03                 613
function.eio-realpath.atom                         16-Jul-2024 06:03                 648
function.eio-rename.atom                           16-Jul-2024 06:03                 613
function.eio-rmdir.atom                            16-Jul-2024 06:03                 584
function.eio-seek.atom                             16-Jul-2024 06:03                 610
function.eio-sendfile.atom                         16-Jul-2024 06:03                 652
function.eio-set-max-idle.atom                     16-Jul-2024 06:03                 642
function.eio-set-max-parallel.atom                 16-Jul-2024 06:03                 669
function.eio-set-max-poll-reqs.atom                16-Jul-2024 06:03                 721
function.eio-set-max-poll-time.atom                16-Jul-2024 06:03                 674
function.eio-set-min-parallel.atom                 16-Jul-2024 06:03                 667
function.eio-stat.atom                             16-Jul-2024 06:03                 620
function.eio-statvfs.atom                          16-Jul-2024 06:03                 652
function.eio-symlink.atom                          16-Jul-2024 06:03                 605
function.eio-sync-file-range.atom                  16-Jul-2024 06:03                 643
function.eio-sync.atom                             16-Jul-2024 06:03                 601
function.eio-syncfs.atom                           16-Jul-2024 06:03                 632
function.eio-truncate.atom                         16-Jul-2024 06:03                 592
function.eio-unlink.atom                           16-Jul-2024 06:03                 666
function.eio-utime.atom                            16-Jul-2024 06:03                 673
function.eio-write.atom                            16-Jul-2024 06:03                 586
function.empty.atom                                16-Jul-2024 06:03                 598
function.enchant-broker-describe.atom              16-Jul-2024 06:03                 661
function.enchant-broker-dict-exists.atom           16-Jul-2024 06:03                 660
function.enchant-broker-free-dict.atom             16-Jul-2024 06:03                 657
function.enchant-broker-free.atom                  16-Jul-2024 06:03                 664
function.enchant-broker-get-dict-path.atom         16-Jul-2024 06:03                 697
function.enchant-broker-get-error.atom             16-Jul-2024 06:03                 666
function.enchant-broker-init.atom                  16-Jul-2024 06:03                 634
function.enchant-broker-list-dicts.atom            16-Jul-2024 06:03                 669
function.enchant-broker-request-dict.atom          16-Jul-2024 06:03                 658
function.enchant-broker-request-pwl-dict.atom      16-Jul-2024 06:03                 690
function.enchant-broker-set-dict-path.atom         16-Jul-2024 06:03                 685
function.enchant-broker-set-ordering.atom          16-Jul-2024 06:03                 713
function.enchant-dict-add-to-personal.atom         16-Jul-2024 06:03                 647
function.enchant-dict-add-to-session.atom          16-Jul-2024 06:03                 665
function.enchant-dict-add.atom                     16-Jul-2024 06:03                 641
function.enchant-dict-check.atom                   16-Jul-2024 06:03                 661
function.enchant-dict-describe.atom                16-Jul-2024 06:03                 634
function.enchant-dict-get-error.atom               16-Jul-2024 06:03                 665
function.enchant-dict-is-added.atom                16-Jul-2024 06:03                 675
function.enchant-dict-is-in-session.atom           16-Jul-2024 06:03                 646
function.enchant-dict-quick-check.atom             16-Jul-2024 06:03                 706
function.enchant-dict-store-replacement.atom       16-Jul-2024 06:03                 662
function.enchant-dict-suggest.atom                 16-Jul-2024 06:03                 680
function.end.atom                                  16-Jul-2024 06:03                 598
function.enum-exists.atom                          16-Jul-2024 06:03                 656
function.error-clear-last.atom                     16-Jul-2024 06:03                 644
function.error-get-last.atom                       16-Jul-2024 06:03                 649
function.error-log.atom                            16-Jul-2024 06:03                 649
function.error-reporting.atom                      16-Jul-2024 06:03                 627
function.escapeshellarg.atom                       16-Jul-2024 06:03                 682
function.escapeshellcmd.atom                       16-Jul-2024 06:03                 653
function.eval.atom                                 16-Jul-2024 06:03                 609
function.exec.atom                                 16-Jul-2024 06:03                 589
function.exif-imagetype.atom                       16-Jul-2024 06:03                 625
function.exif-read-data.atom                       16-Jul-2024 06:03                 627
function.exif-tagname.atom                         16-Jul-2024 06:03                 630
function.exif-thumbnail.atom                       16-Jul-2024 06:03                 640
function.exit.atom                                 16-Jul-2024 06:03                 597
function.exp.atom                                  16-Jul-2024 06:03                 579
function.expect-expectl.atom                       16-Jul-2024 06:03                 781
function.expect-popen.atom                         16-Jul-2024 06:03                 662
function.explode.atom                              16-Jul-2024 06:03                 623
function.expm1.atom                                16-Jul-2024 06:03                 712
function.extension-loaded.atom                     16-Jul-2024 06:03                 653
function.extract.atom                              16-Jul-2024 06:03                 607
function.ezmlm-hash.atom                           16-Jul-2024 06:03                 615
function.fann-cascadetrain-on-data.atom            16-Jul-2024 06:03                 700
function.fann-cascadetrain-on-file.atom            16-Jul-2024 06:03                 715
function.fann-clear-scaling-params.atom            16-Jul-2024 06:03                 638
function.fann-copy.atom                            16-Jul-2024 06:03                 616
function.fann-create-from-file.atom                16-Jul-2024 06:03                 703
function.fann-create-shortcut-array.atom           16-Jul-2024 06:03                 782
function.fann-create-shortcut.atom                 16-Jul-2024 06:03                 708
function.fann-create-sparse-array.atom             16-Jul-2024 06:03                 719
function.fann-create-sparse.atom                   16-Jul-2024 06:03                 671
function.fann-create-standard-array.atom           16-Jul-2024 06:03                 711
function.fann-create-standard.atom                 16-Jul-2024 06:03                 663
function.fann-create-train-from-callback.atom      16-Jul-2024 06:03                 755
function.fann-create-train.atom                    16-Jul-2024 06:03                 665
function.fann-descale-input.atom                   16-Jul-2024 06:03                 682
function.fann-descale-output.atom                  16-Jul-2024 06:03                 686
function.fann-descale-train.atom                   16-Jul-2024 06:03                 663
function.fann-destroy-train.atom                   16-Jul-2024 06:03                 653
function.fann-destroy.atom                         16-Jul-2024 06:03                 704
function.fann-duplicate-train-data.atom            16-Jul-2024 06:03                 685
function.fann-get-activation-function.atom         16-Jul-2024 06:03                 653
function.fann-get-activation-steepness.atom        16-Jul-2024 06:03                 694
function.fann-get-bias-array.atom                  16-Jul-2024 06:03                 646
function.fann-get-bit-fail-limit.atom              16-Jul-2024 06:03                 654
function.fann-get-bit-fail.atom                    16-Jul-2024 06:03                 612
function.fann-get-cascade-activation-functions-..> 16-Jul-2024 06:03                 717
function.fann-get-cascade-activation-functions...> 16-Jul-2024 06:03                 689
function.fann-get-cascade-activation-steepnesse..> 16-Jul-2024 06:03                 709
function.fann-get-cascade-activation-steepnesse..> 16-Jul-2024 06:03                 697
function.fann-get-cascade-candidate-change-frac..> 16-Jul-2024 06:03                 709
function.fann-get-cascade-candidate-limit.atom     16-Jul-2024 06:03                 660
function.fann-get-cascade-candidate-stagnation-..> 16-Jul-2024 06:03                 727
function.fann-get-cascade-max-cand-epochs.atom     16-Jul-2024 06:03                 670
function.fann-get-cascade-max-out-epochs.atom      16-Jul-2024 06:03                 661
function.fann-get-cascade-min-cand-epochs.atom     16-Jul-2024 06:03                 670
function.fann-get-cascade-min-out-epochs.atom      16-Jul-2024 06:03                 661
function.fann-get-cascade-num-candidate-groups...> 16-Jul-2024 06:03                 687
function.fann-get-cascade-num-candidates.atom      16-Jul-2024 06:03                 684
function.fann-get-cascade-output-change-fractio..> 16-Jul-2024 06:03                 697
function.fann-get-cascade-output-stagnation-epo..> 16-Jul-2024 06:03                 715
function.fann-get-cascade-weight-multiplier.atom   16-Jul-2024 06:03                 669
function.fann-get-connection-array.atom            16-Jul-2024 06:03                 684
function.fann-get-connection-rate.atom             16-Jul-2024 06:03                 745
function.fann-get-errno.atom                       16-Jul-2024 06:03                 642
function.fann-get-errstr.atom                      16-Jul-2024 06:03                 624
function.fann-get-layer-array.atom                 16-Jul-2024 06:03                 652
function.fann-get-learning-momentum.atom           16-Jul-2024 06:03                 645
function.fann-get-learning-rate.atom               16-Jul-2024 06:03                 629
function.fann-get-mse.atom                         16-Jul-2024 06:03                 618
function.fann-get-network-type.atom                16-Jul-2024 06:03                 649
function.fann-get-num-input.atom                   16-Jul-2024 06:03                 653
function.fann-get-num-layers.atom                  16-Jul-2024 06:03                 676
function.fann-get-num-output.atom                  16-Jul-2024 06:03                 656
function.fann-get-quickprop-decay.atom             16-Jul-2024 06:03                 718
function.fann-get-quickprop-mu.atom                16-Jul-2024 06:03                 623
function.fann-get-rprop-decrease-factor.atom       16-Jul-2024 06:03                 721
function.fann-get-rprop-delta-max.atom             16-Jul-2024 06:03                 664
function.fann-get-rprop-delta-min.atom             16-Jul-2024 06:03                 664
function.fann-get-rprop-delta-zero.atom            16-Jul-2024 06:03                 667
function.fann-get-rprop-increase-factor.atom       16-Jul-2024 06:03                 710
function.fann-get-sarprop-step-error-shift.atom    16-Jul-2024 06:03                 725
function.fann-get-sarprop-step-error-threshold-..> 16-Jul-2024 06:03                 752
function.fann-get-sarprop-temperature.atom         16-Jul-2024 06:03                 664
function.fann-get-sarprop-weight-decay-shift.atom  16-Jul-2024 06:03                 705
function.fann-get-total-connections.atom           16-Jul-2024 06:03                 725
function.fann-get-total-neurons.atom               16-Jul-2024 06:03                 711
function.fann-get-train-error-function.atom        16-Jul-2024 06:03                 707
function.fann-get-train-stop-function.atom         16-Jul-2024 06:03                 713
function.fann-get-training-algorithm.atom          16-Jul-2024 06:03                 665
function.fann-init-weights.atom                    16-Jul-2024 06:03                 654
function.fann-length-train-data.atom               16-Jul-2024 06:03                 701
function.fann-merge-train-data.atom                16-Jul-2024 06:03                 652
function.fann-num-input-train-data.atom            16-Jul-2024 06:03                 744
function.fann-num-output-train-data.atom           16-Jul-2024 06:03                 731
function.fann-print-error.atom                     16-Jul-2024 06:03                 618
function.fann-randomize-weights.atom               16-Jul-2024 06:03                 711
function.fann-read-train-from-file.atom            16-Jul-2024 06:03                 680
function.fann-reset-errno.atom                     16-Jul-2024 06:03                 663
function.fann-reset-errstr.atom                    16-Jul-2024 06:03                 656
function.fann-reset-mse.atom                       16-Jul-2024 06:03                 658
function.fann-run.atom                             16-Jul-2024 06:03                 637
function.fann-save-train.atom                      16-Jul-2024 06:03                 642
function.fann-save.atom                            16-Jul-2024 06:03                 637
function.fann-scale-input-train-data.atom          16-Jul-2024 06:03                 797
function.fann-scale-input.atom                     16-Jul-2024 06:03                 831
function.fann-scale-output-train-data.atom         16-Jul-2024 06:03                 789
function.fann-scale-output.atom                    16-Jul-2024 06:03                 819
function.fann-scale-train-data.atom                16-Jul-2024 06:03                 794
function.fann-scale-train.atom                     16-Jul-2024 06:03                 790
function.fann-set-activation-function-hidden.atom  16-Jul-2024 06:03                 733
function.fann-set-activation-function-layer.atom   16-Jul-2024 06:03                 755
function.fann-set-activation-function-output.atom  16-Jul-2024 06:03                 730
function.fann-set-activation-function.atom         16-Jul-2024 06:03                 730
function.fann-set-activation-steepness-hidden.atom 16-Jul-2024 06:03                 761
function.fann-set-activation-steepness-layer.atom  16-Jul-2024 06:03                 762
function.fann-set-activation-steepness-output.atom 16-Jul-2024 06:03                 729
function.fann-set-activation-steepness.atom        16-Jul-2024 06:03                 737
function.fann-set-bit-fail-limit.atom              16-Jul-2024 06:03                 700
function.fann-set-callback.atom                    16-Jul-2024 06:03                 678
function.fann-set-cascade-activation-functions...> 16-Jul-2024 06:03                 730
function.fann-set-cascade-activation-steepnesse..> 16-Jul-2024 06:03                 736
function.fann-set-cascade-candidate-change-frac..> 16-Jul-2024 06:03                 730
function.fann-set-cascade-candidate-limit.atom     16-Jul-2024 06:03                 671
function.fann-set-cascade-candidate-stagnation-..> 16-Jul-2024 06:03                 759
function.fann-set-cascade-max-cand-epochs.atom     16-Jul-2024 06:03                 695
function.fann-set-cascade-max-out-epochs.atom      16-Jul-2024 06:03                 692
function.fann-set-cascade-min-cand-epochs.atom     16-Jul-2024 06:03                 695
function.fann-set-cascade-min-out-epochs.atom      16-Jul-2024 06:03                 692
function.fann-set-cascade-num-candidate-groups...> 16-Jul-2024 06:03                 697
function.fann-set-cascade-output-change-fractio..> 16-Jul-2024 06:03                 721
function.fann-set-cascade-output-stagnation-epo..> 16-Jul-2024 06:03                 749
function.fann-set-cascade-weight-multiplier.atom   16-Jul-2024 06:03                 684
function.fann-set-error-log.atom                   16-Jul-2024 06:03                 680
function.fann-set-input-scaling-params.atom        16-Jul-2024 06:03                 801
function.fann-set-learning-momentum.atom           16-Jul-2024 06:03                 667
function.fann-set-learning-rate.atom               16-Jul-2024 06:03                 650
function.fann-set-output-scaling-params.atom       16-Jul-2024 06:03                 789
function.fann-set-quickprop-decay.atom             16-Jul-2024 06:03                 671
function.fann-set-quickprop-mu.atom                16-Jul-2024 06:03                 642
function.fann-set-rprop-decrease-factor.atom       16-Jul-2024 06:03                 723
function.fann-set-rprop-delta-max.atom             16-Jul-2024 06:03                 673
function.fann-set-rprop-delta-min.atom             16-Jul-2024 06:03                 673
function.fann-set-rprop-delta-zero.atom            16-Jul-2024 06:03                 676
function.fann-set-rprop-increase-factor.atom       16-Jul-2024 06:03                 729
function.fann-set-sarprop-step-error-shift.atom    16-Jul-2024 06:03                 717
function.fann-set-sarprop-step-error-threshold-..> 16-Jul-2024 06:03                 756
function.fann-set-sarprop-temperature.atom         16-Jul-2024 06:03                 673
function.fann-set-sarprop-weight-decay-shift.atom  16-Jul-2024 06:03                 717
function.fann-set-scaling-params.atom              16-Jul-2024 06:03                 788
function.fann-set-train-error-function.atom        16-Jul-2024 06:03                 716
function.fann-set-train-stop-function.atom         16-Jul-2024 06:03                 723
function.fann-set-training-algorithm.atom          16-Jul-2024 06:03                 674
function.fann-set-weight-array.atom                16-Jul-2024 06:03                 659
function.fann-set-weight.atom                      16-Jul-2024 06:03                 640
function.fann-shuffle-train-data.atom              16-Jul-2024 06:03                 711
function.fann-subset-train-data.atom               16-Jul-2024 06:03                 683
function.fann-test-data.atom                       16-Jul-2024 06:03                 698
function.fann-test.atom                            16-Jul-2024 06:03                 671
function.fann-train-epoch.atom                     16-Jul-2024 06:03                 664
function.fann-train-on-data.atom                   16-Jul-2024 06:03                 694
function.fann-train-on-file.atom                   16-Jul-2024 06:03                 744
function.fann-train.atom                           16-Jul-2024 06:03                 715
function.fastcgi-finish-request.atom               16-Jul-2024 06:03                 676
function.fbird-add-user.atom                       16-Jul-2024 06:03                 603
function.fbird-affected-rows.atom                  16-Jul-2024 06:03                 623
function.fbird-backup.atom                         16-Jul-2024 06:03                 595
function.fbird-blob-add.atom                       16-Jul-2024 06:03                 603
function.fbird-blob-cancel.atom                    16-Jul-2024 06:03                 633
function.fbird-blob-close.atom                     16-Jul-2024 06:03                 611
function.fbird-blob-create.atom                    16-Jul-2024 06:03                 615
function.fbird-blob-echo.atom                      16-Jul-2024 06:03                 607
function.fbird-blob-get.atom                       16-Jul-2024 06:03                 603
function.fbird-blob-import.atom                    16-Jul-2024 06:03                 615
function.fbird-blob-info.atom                      16-Jul-2024 06:03                 607
function.fbird-blob-open.atom                      16-Jul-2024 06:03                 607
function.fbird-close.atom                          16-Jul-2024 06:03                 591
function.fbird-commit-ret.atom                     16-Jul-2024 06:03                 611
function.fbird-commit.atom                         16-Jul-2024 06:03                 595
function.fbird-connect.atom                        16-Jul-2024 06:03                 599
function.fbird-db-info.atom                        16-Jul-2024 06:03                 599
function.fbird-delete-user.atom                    16-Jul-2024 06:03                 615
function.fbird-drop-db.atom                        16-Jul-2024 06:03                 599
function.fbird-errcode.atom                        16-Jul-2024 06:03                 599
function.fbird-errmsg.atom                         16-Jul-2024 06:03                 595
function.fbird-execute.atom                        16-Jul-2024 06:03                 599
function.fbird-fetch-assoc.atom                    16-Jul-2024 06:03                 615
function.fbird-fetch-object.atom                   16-Jul-2024 06:03                 619
function.fbird-fetch-row.atom                      16-Jul-2024 06:03                 607
function.fbird-field-info.atom                     16-Jul-2024 06:03                 611
function.fbird-free-event-handler.atom             16-Jul-2024 06:03                 643
function.fbird-free-query.atom                     16-Jul-2024 06:03                 611
function.fbird-free-result.atom                    16-Jul-2024 06:03                 615
function.fbird-gen-id.atom                         16-Jul-2024 06:03                 595
function.fbird-maintain-db.atom                    16-Jul-2024 06:03                 615
function.fbird-modify-user.atom                    16-Jul-2024 06:03                 615
function.fbird-name-result.atom                    16-Jul-2024 06:03                 615
function.fbird-num-fields.atom                     16-Jul-2024 06:03                 611
function.fbird-num-params.atom                     16-Jul-2024 06:03                 611
function.fbird-param-info.atom                     16-Jul-2024 06:03                 611
function.fbird-pconnect.atom                       16-Jul-2024 06:03                 603
function.fbird-prepare.atom                        16-Jul-2024 06:03                 599
function.fbird-query.atom                          16-Jul-2024 06:03                 591
function.fbird-restore.atom                        16-Jul-2024 06:03                 599
function.fbird-rollback-ret.atom                   16-Jul-2024 06:03                 619
function.fbird-rollback.atom                       16-Jul-2024 06:03                 603
function.fbird-server-info.atom                    16-Jul-2024 06:03                 615
function.fbird-service-attach.atom                 16-Jul-2024 06:03                 627
function.fbird-service-detach.atom                 16-Jul-2024 06:03                 627
function.fbird-set-event-handler.atom              16-Jul-2024 06:03                 639
function.fbird-trans.atom                          16-Jul-2024 06:03                 591
function.fbird-wait-event.atom                     16-Jul-2024 06:03                 611
function.fclose.atom                               16-Jul-2024 06:03                 572
function.fdatasync.atom                            16-Jul-2024 06:03                 664
function.fdf-add-doc-javascript.atom               16-Jul-2024 06:03                 650
function.fdf-add-template.atom                     16-Jul-2024 06:03                 625
function.fdf-close.atom                            16-Jul-2024 06:03                 586
function.fdf-create.atom                           16-Jul-2024 06:03                 607
function.fdf-enum-values.atom                      16-Jul-2024 06:03                 646
function.fdf-errno.atom                            16-Jul-2024 06:03                 646
function.fdf-error.atom                            16-Jul-2024 06:03                 602
function.fdf-get-ap.atom                           16-Jul-2024 06:03                 604
function.fdf-get-attachment.atom                   16-Jul-2024 06:03                 661
function.fdf-get-encoding.atom                     16-Jul-2024 06:03                 630
function.fdf-get-file.atom                         16-Jul-2024 06:03                 611
function.fdf-get-flags.atom                        16-Jul-2024 06:03                 614
function.fdf-get-opt.atom                          16-Jul-2024 06:03                 631
function.fdf-get-status.atom                       16-Jul-2024 06:03                 622
function.fdf-get-value.atom                        16-Jul-2024 06:03                 615
function.fdf-get-version.atom                      16-Jul-2024 06:03                 636
function.fdf-header.atom                           16-Jul-2024 06:03                 651
function.fdf-next-field-name.atom                  16-Jul-2024 06:03                 626
function.fdf-open-string.atom                      16-Jul-2024 06:03                 675
function.fdf-open.atom                             16-Jul-2024 06:03                 583
function.fdf-remove-item.atom                      16-Jul-2024 06:03                 639
function.fdf-save-string.atom                      16-Jul-2024 06:03                 671
function.fdf-save.atom                             16-Jul-2024 06:03                 588
function.fdf-set-ap.atom                           16-Jul-2024 06:03                 609
function.fdf-set-encoding.atom                     16-Jul-2024 06:03                 635
function.fdf-set-file.atom                         16-Jul-2024 06:03                 648
function.fdf-set-flags.atom                        16-Jul-2024 06:03                 611
function.fdf-set-javascript-action.atom            16-Jul-2024 06:03                 661
function.fdf-set-on-import-javascript.atom         16-Jul-2024 06:03                 734
function.fdf-set-opt.atom                          16-Jul-2024 06:03                 605
function.fdf-set-status.atom                       16-Jul-2024 06:03                 623
function.fdf-set-submit-form-action.atom           16-Jul-2024 06:03                 658
function.fdf-set-target-frame.atom                 16-Jul-2024 06:03                 667
function.fdf-set-value.atom                        16-Jul-2024 06:03                 614
function.fdf-set-version.atom                      16-Jul-2024 06:03                 637
function.fdiv.atom                                 16-Jul-2024 06:03                 592
function.feof.atom                                 16-Jul-2024 06:03                 573
function.fflush.atom                               16-Jul-2024 06:03                 634
function.fgetc.atom                                16-Jul-2024 06:03                 596
function.fgetcsv.atom                              16-Jul-2024 06:03                 644
function.fgets.atom                                16-Jul-2024 06:03                 667
function.fgetss.atom                               16-Jul-2024 06:03                 631
function.file-exists.atom                          16-Jul-2024 06:03                 624
function.file-get-contents.atom                    16-Jul-2024 06:03                 634
function.file-put-contents.atom                    16-Jul-2024 06:03                 644
function.file.atom                                 16-Jul-2024 06:03                 614
function.fileatime.atom                            16-Jul-2024 06:03                 703
function.filectime.atom                            16-Jul-2024 06:03                 650
function.filegroup.atom                            16-Jul-2024 06:03                 586
function.fileinode.atom                            16-Jul-2024 06:03                 613
function.filemtime.atom                            16-Jul-2024 06:03                 623
function.fileowner.atom                            16-Jul-2024 06:03                 632
function.fileperms.atom                            16-Jul-2024 06:03                 597
function.filesize.atom                             16-Jul-2024 06:03                 593
function.filetype.atom                             16-Jul-2024 06:03                 589
function.filter-has-var.atom                       16-Jul-2024 06:03                 658
function.filter-id.atom                            16-Jul-2024 06:03                 626
function.filter-input-array.atom                   16-Jul-2024 06:03                 663
function.filter-input.atom                         16-Jul-2024 06:03                 638
function.filter-list.atom                          16-Jul-2024 06:03                 630
function.filter-var-array.atom                     16-Jul-2024 06:03                 650
function.filter-var.atom                           16-Jul-2024 06:03                 624
function.finfo-buffer.atom                         16-Jul-2024 06:03                 679
function.finfo-close.atom                          16-Jul-2024 06:03                 595
function.finfo-file.atom                           16-Jul-2024 06:03                 631
function.finfo-open.atom                           16-Jul-2024 06:03                 611
function.finfo-set-flags.atom                      16-Jul-2024 06:03                 625
function.floatval.atom                             16-Jul-2024 06:03                 633
function.flock.atom                                16-Jul-2024 06:03                 574
function.floor.atom                                16-Jul-2024 06:03                 609
function.flush.atom                                16-Jul-2024 06:03                 601
function.fmod.atom                                 16-Jul-2024 06:03                 582
function.fnmatch.atom                              16-Jul-2024 06:03                 621
function.fopen.atom                                16-Jul-2024 06:03                 580
function.forward-static-call-array.atom            16-Jul-2024 06:03                 686
function.forward-static-call.atom                  16-Jul-2024 06:03                 634
function.fpassthru.atom                            16-Jul-2024 06:03                 592
function.fpm-get-status.atom                       16-Jul-2024 06:03                 630
function.fprintf.atom                              16-Jul-2024 06:03                 629
function.fputcsv.atom                              16-Jul-2024 06:03                 626
function.fputs.atom                                16-Jul-2024 06:03                 568
function.fread.atom                                16-Jul-2024 06:03                 587
function.frenchtojd.atom                           16-Jul-2024 06:03                 686
function.fscanf.atom                               16-Jul-2024 06:03                 603
function.fseek.atom                                16-Jul-2024 06:03                 595
function.fsockopen.atom                            16-Jul-2024 06:03                 610
function.fstat.atom                                16-Jul-2024 06:03                 638
function.fsync.atom                                16-Jul-2024 06:03                 664
function.ftell.atom                                16-Jul-2024 06:03                 604
function.ftok.atom                                 16-Jul-2024 06:03                 632
function.ftp-alloc.atom                            16-Jul-2024 06:03                 644
function.ftp-append.atom                           16-Jul-2024 06:03                 652
function.ftp-cdup.atom                             16-Jul-2024 06:03                 606
function.ftp-chdir.atom                            16-Jul-2024 06:03                 595
function.ftp-chmod.atom                            16-Jul-2024 06:03                 609
function.ftp-close.atom                            16-Jul-2024 06:03                 588
function.ftp-connect.atom                          16-Jul-2024 06:03                 594
function.ftp-delete.atom                           16-Jul-2024 06:03                 604
function.ftp-exec.atom                             16-Jul-2024 06:03                 612
function.ftp-fget.atom                             16-Jul-2024 06:03                 635
function.ftp-fput.atom                             16-Jul-2024 06:03                 623
function.ftp-get-option.atom                       16-Jul-2024 06:03                 645
function.ftp-get.atom                              16-Jul-2024 06:03                 624
function.ftp-login.atom                            16-Jul-2024 06:03                 598
function.ftp-mdtm.atom                             16-Jul-2024 06:03                 654
function.ftp-mkdir.atom                            16-Jul-2024 06:03                 610
function.ftp-mlsd.atom                             16-Jul-2024 06:03                 627
function.ftp-nb-continue.atom                      16-Jul-2024 06:03                 663
function.ftp-nb-fget.atom                          16-Jul-2024 06:03                 663
function.ftp-nb-fput.atom                          16-Jul-2024 06:03                 661
function.ftp-nb-get.atom                           16-Jul-2024 06:03                 660
function.ftp-nb-put.atom                           16-Jul-2024 06:03                 619
function.ftp-nlist.atom                            16-Jul-2024 06:03                 613
function.ftp-pasv.atom                             16-Jul-2024 06:03                 607
function.ftp-put.atom                              16-Jul-2024 06:03                 595
function.ftp-pwd.atom                              16-Jul-2024 06:03                 593
function.ftp-quit.atom                             16-Jul-2024 06:03                 580
function.ftp-raw.atom                              16-Jul-2024 06:03                 588
function.ftp-rawlist.atom                          16-Jul-2024 06:03                 648
function.ftp-rename.atom                           16-Jul-2024 06:03                 605
function.ftp-rmdir.atom                            16-Jul-2024 06:03                 586
function.ftp-set-option.atom                       16-Jul-2024 06:03                 619
function.ftp-site.atom                             16-Jul-2024 06:03                 616
function.ftp-size.atom                             16-Jul-2024 06:03                 598
function.ftp-ssl-connect.atom                      16-Jul-2024 06:03                 647
function.ftp-systype.atom                          16-Jul-2024 06:03                 617
function.ftruncate.atom                            16-Jul-2024 06:03                 583
function.func-get-arg.atom                         16-Jul-2024 06:03                 641
function.func-get-args.atom                        16-Jul-2024 06:03                 651
function.func-num-args.atom                        16-Jul-2024 06:03                 655
function.function-exists.atom                      16-Jul-2024 06:03                 629
function.fwrite.atom                               16-Jul-2024 06:03                 599
function.gc-collect-cycles.atom                    16-Jul-2024 06:03                 641
function.gc-disable.atom                           16-Jul-2024 06:03                 650
function.gc-enable.atom                            16-Jul-2024 06:03                 633
function.gc-enabled.atom                           16-Jul-2024 06:03                 648
function.gc-mem-caches.atom                        16-Jul-2024 06:03                 707
function.gc-status.atom                            16-Jul-2024 06:03                 651
function.gd-info.atom                              16-Jul-2024 06:03                 658
function.geoip-asnum-by-name.atom                  16-Jul-2024 06:03                 664
function.geoip-continent-code-by-name.atom         16-Jul-2024 06:03                 660
function.geoip-country-code-by-name.atom           16-Jul-2024 06:03                 676
function.geoip-country-code3-by-name.atom          16-Jul-2024 06:03                 680
function.geoip-country-name-by-name.atom           16-Jul-2024 06:03                 669
function.geoip-database-info.atom                  16-Jul-2024 06:03                 681
function.geoip-db-avail.atom                       16-Jul-2024 06:03                 652
function.geoip-db-filename.atom                    16-Jul-2024 06:03                 693
function.geoip-db-get-all-info.atom                16-Jul-2024 06:03                 715
function.geoip-domain-by-name.atom                 16-Jul-2024 06:03                 663
function.geoip-id-by-name.atom                     16-Jul-2024 06:03                 649
function.geoip-isp-by-name.atom                    16-Jul-2024 06:03                 665
function.geoip-netspeedcell-by-name.atom           16-Jul-2024 06:03                 682
function.geoip-org-by-name.atom                    16-Jul-2024 06:03                 649
function.geoip-record-by-name.atom                 16-Jul-2024 06:03                 811
function.geoip-region-by-name.atom                 16-Jul-2024 06:03                 665
function.geoip-region-name-by-code.atom            16-Jul-2024 06:03                 697
function.geoip-setup-custom-directory.atom         16-Jul-2024 06:03                 715
function.geoip-time-zone-by-country-and-region...> 16-Jul-2024 06:03                 722
function.get-browser.atom                          16-Jul-2024 06:03                 624
function.get-called-class.atom                     16-Jul-2024 06:03                 648
function.get-cfg-var.atom                          16-Jul-2024 06:03                 614
function.get-class-methods.atom                    16-Jul-2024 06:03                 648
function.get-class-vars.atom                       16-Jul-2024 06:03                 677
function.get-class.atom                            16-Jul-2024 06:03                 609
function.get-current-user.atom                     16-Jul-2024 06:03                 633
function.get-debug-type.atom                       16-Jul-2024 06:03                 652
function.get-declared-classes.atom                 16-Jul-2024 06:03                 651
function.get-declared-interfaces.atom              16-Jul-2024 06:03                 685
function.get-declared-traits.atom                  16-Jul-2024 06:03                 671
function.get-defined-constants.atom                16-Jul-2024 06:03                 650
function.get-defined-functions.atom                16-Jul-2024 06:03                 647
function.get-defined-vars.atom                     16-Jul-2024 06:03                 632
function.get-extension-funcs.atom                  16-Jul-2024 06:03                 635
function.get-headers.atom                          16-Jul-2024 06:03                 703
function.get-html-translation-table.atom           16-Jul-2024 06:03                 727
function.get-include-path.atom                     16-Jul-2024 06:03                 645
function.get-included-files.atom                   16-Jul-2024 06:03                 669
function.get-loaded-extensions.atom                16-Jul-2024 06:03                 680
function.get-magic-quotes-gpc.atom                 16-Jul-2024 06:03                 666
function.get-magic-quotes-runtime.atom             16-Jul-2024 06:03                 682
function.get-mangled-object-vars.atom              16-Jul-2024 06:03                 698
function.get-meta-tags.atom                        16-Jul-2024 06:03                 642
function.get-object-vars.atom                      16-Jul-2024 06:03                 644
function.get-parent-class.atom                     16-Jul-2024 06:03                 638
function.get-required-files.atom                   16-Jul-2024 06:03                 619
function.get-resource-id.atom                      16-Jul-2024 06:03                 627
function.get-resource-type.atom                    16-Jul-2024 06:03                 618
function.get-resources.atom                        16-Jul-2024 06:03                 607
function.getallheaders.atom                        16-Jul-2024 06:03                 664
function.getcwd.atom                               16-Jul-2024 06:03                 594
function.getdate.atom                              16-Jul-2024 06:03                 581
function.getenv.atom                               16-Jul-2024 06:03                 636
function.gethostbyaddr.atom                        16-Jul-2024 06:03                 648
function.gethostbyname.atom                        16-Jul-2024 06:03                 650
function.gethostbynamel.atom                       16-Jul-2024 06:03                 655
function.gethostname.atom                          16-Jul-2024 06:03                 606
function.getimagesize.atom                         16-Jul-2024 06:03                 609
function.getimagesizefromstring.atom               16-Jul-2024 06:03                 689
function.getlastmod.atom                           16-Jul-2024 06:03                 631
function.getmxrr.atom                              16-Jul-2024 06:03                 615
function.getmygid.atom                             16-Jul-2024 06:03                 614
function.getmyinode.atom                           16-Jul-2024 06:03                 599
function.getmypid.atom                             16-Jul-2024 06:03                 619
function.getmyuid.atom                             16-Jul-2024 06:03                 625
function.getopt.atom                               16-Jul-2024 06:03                 616
function.getprotobyname.atom                       16-Jul-2024 06:03                 674
function.getprotobynumber.atom                     16-Jul-2024 06:03                 680
function.getrandmax.atom                           16-Jul-2024 06:03                 616
function.getrusage.atom                            16-Jul-2024 06:03                 617
function.getservbyname.atom                        16-Jul-2024 06:03                 682
function.getservbyport.atom                        16-Jul-2024 06:03                 641
function.gettext.atom                              16-Jul-2024 06:03                 603
function.gettimeofday.atom                         16-Jul-2024 06:03                 604
function.gettype.atom                              16-Jul-2024 06:03                 590
function.glob.atom                                 16-Jul-2024 06:03                 606
function.gmdate.atom                               16-Jul-2024 06:03                 586
function.gmmktime.atom                             16-Jul-2024 06:03                 608
function.gmp-abs.atom                              16-Jul-2024 06:03                 577
function.gmp-add.atom                              16-Jul-2024 06:03                 584
function.gmp-and.atom                              16-Jul-2024 06:03                 569
function.gmp-binomial.atom                         16-Jul-2024 06:03                 604
function.gmp-clrbit.atom                           16-Jul-2024 06:03                 583
function.gmp-cmp.atom                              16-Jul-2024 06:03                 582
function.gmp-com.atom                              16-Jul-2024 06:03                 612
function.gmp-div-q.atom                            16-Jul-2024 06:03                 591
function.gmp-div-qr.atom                           16-Jul-2024 06:03                 591
function.gmp-div-r.atom                            16-Jul-2024 06:03                 605
function.gmp-div.atom                              16-Jul-2024 06:03                 577
function.gmp-divexact.atom                         16-Jul-2024 06:03                 604
function.gmp-export.atom                           16-Jul-2024 06:03                 613
function.gmp-fact.atom                             16-Jul-2024 06:03                 577
function.gmp-gcd.atom                              16-Jul-2024 06:03                 574
function.gmp-gcdext.atom                           16-Jul-2024 06:03                 590
function.gmp-hamdist.atom                          16-Jul-2024 06:03                 590
function.gmp-import.atom                           16-Jul-2024 06:03                 615
function.gmp-init.atom                             16-Jul-2024 06:03                 591
function.gmp-intval.atom                           16-Jul-2024 06:03                 601
function.gmp-invert.atom                           16-Jul-2024 06:03                 593
function.gmp-jacobi.atom                           16-Jul-2024 06:03                 585
function.gmp-kronecker.atom                        16-Jul-2024 06:03                 594
function.gmp-lcm.atom                              16-Jul-2024 06:03                 573
function.gmp-legendre.atom                         16-Jul-2024 06:03                 593
function.gmp-mod.atom                              16-Jul-2024 06:03                 569
function.gmp-mul.atom                              16-Jul-2024 06:03                 590
function.gmp-neg.atom                              16-Jul-2024 06:03                 590
function.gmp-nextprime.atom                        16-Jul-2024 06:03                 610
function.gmp-or.atom                               16-Jul-2024 06:03                 566
function.gmp-perfect-power.atom                    16-Jul-2024 06:03                 647
function.gmp-perfect-square.atom                   16-Jul-2024 06:03                 620
function.gmp-popcount.atom                         16-Jul-2024 06:03                 596
function.gmp-pow.atom                              16-Jul-2024 06:03                 568
function.gmp-powm.atom                             16-Jul-2024 06:03                 581
function.gmp-prob-prime.atom                       16-Jul-2024 06:03                 611
function.gmp-random-bits.atom                      16-Jul-2024 06:03                 642
function.gmp-random-range.atom                     16-Jul-2024 06:03                 685
function.gmp-random-seed.atom                      16-Jul-2024 06:03                 682
function.gmp-random.atom                           16-Jul-2024 06:03                 599
function.gmp-root.atom                             16-Jul-2024 06:03                 651
function.gmp-rootrem.atom                          16-Jul-2024 06:03                 672
function.gmp-scan0.atom                            16-Jul-2024 06:03                 576
function.gmp-scan1.atom                            16-Jul-2024 06:03                 576
function.gmp-setbit.atom                           16-Jul-2024 06:03                 582
function.gmp-sign.atom                             16-Jul-2024 06:03                 581
function.gmp-sqrt.atom                             16-Jul-2024 06:03                 590
function.gmp-sqrtrem.atom                          16-Jul-2024 06:03                 610
function.gmp-strval.atom                           16-Jul-2024 06:03                 611
function.gmp-sub.atom                              16-Jul-2024 06:03                 588
function.gmp-testbit.atom                          16-Jul-2024 06:03                 610
function.gmp-xor.atom                              16-Jul-2024 06:03                 578
function.gmstrftime.atom                           16-Jul-2024 06:03                 637
function.gnupg-adddecryptkey.atom                  16-Jul-2024 06:03                 650
function.gnupg-addencryptkey.atom                  16-Jul-2024 06:03                 637
function.gnupg-addsignkey.atom                     16-Jul-2024 06:03                 623
function.gnupg-cleardecryptkeys.atom               16-Jul-2024 06:03                 721
function.gnupg-clearencryptkeys.atom               16-Jul-2024 06:03                 708
function.gnupg-clearsignkeys.atom                  16-Jul-2024 06:03                 697
function.gnupg-decrypt.atom                        16-Jul-2024 06:03                 623
function.gnupg-decryptverify.atom                  16-Jul-2024 06:03                 663
function.gnupg-deletekey.atom                      16-Jul-2024 06:03                 612
function.gnupg-encrypt.atom                        16-Jul-2024 06:03                 610
function.gnupg-encryptsign.atom                    16-Jul-2024 06:03                 631
function.gnupg-export.atom                         16-Jul-2024 06:03                 600
function.gnupg-getengineinfo.atom                  16-Jul-2024 06:03                 618
function.gnupg-geterror.atom                       16-Jul-2024 06:03                 646
function.gnupg-geterrorinfo.atom                   16-Jul-2024 06:03                 614
function.gnupg-getprotocol.atom                    16-Jul-2024 06:03                 662
function.gnupg-gettrustlist.atom                   16-Jul-2024 06:03                 614
function.gnupg-import.atom                         16-Jul-2024 06:03                 600
function.gnupg-init.atom                           16-Jul-2024 06:03                 592
function.gnupg-keyinfo.atom                        16-Jul-2024 06:03                 714
function.gnupg-listsignatures.atom                 16-Jul-2024 06:03                 617
function.gnupg-setarmor.atom                       16-Jul-2024 06:03                 615
function.gnupg-seterrormode.atom                   16-Jul-2024 06:03                 625
function.gnupg-setsignmode.atom                    16-Jul-2024 06:03                 613
function.gnupg-sign.atom                           16-Jul-2024 06:03                 599
function.gnupg-verify.atom                         16-Jul-2024 06:03                 618
function.grapheme-extract.atom                     16-Jul-2024 06:03                 660
function.grapheme-stripos.atom                     16-Jul-2024 06:03                 724
function.grapheme-stristr.atom                     16-Jul-2024 06:03                 674
function.grapheme-strlen.atom                      16-Jul-2024 06:03                 657
function.grapheme-strpos.atom                      16-Jul-2024 06:03                 632
function.grapheme-strripos.atom                    16-Jul-2024 06:03                 672
function.grapheme-strrpos.atom                     16-Jul-2024 06:03                 635
function.grapheme-strstr.atom                      16-Jul-2024 06:03                 705
function.grapheme-substr.atom                      16-Jul-2024 06:03                 630
function.gregoriantojd.atom                        16-Jul-2024 06:03                 658
function.gzclose.atom                              16-Jul-2024 06:03                 601
function.gzcompress.atom                           16-Jul-2024 06:03                 598
function.gzdecode.atom                             16-Jul-2024 06:03                 652
function.gzdeflate.atom                            16-Jul-2024 06:03                 595
function.gzencode.atom                             16-Jul-2024 06:03                 625
function.gzeof.atom                                16-Jul-2024 06:03                 628
function.gzfile.atom                               16-Jul-2024 06:03                 621
function.gzgetc.atom                               16-Jul-2024 06:03                 620
function.gzgets.atom                               16-Jul-2024 06:03                 606
function.gzgetss.atom                              16-Jul-2024 06:03                 639
function.gzinflate.atom                            16-Jul-2024 06:03                 608
function.gzopen.atom                               16-Jul-2024 06:03                 603
function.gzpassthru.atom                           16-Jul-2024 06:03                 637
function.gzputs.atom                               16-Jul-2024 06:03                 572
function.gzread.atom                               16-Jul-2024 06:03                 603
function.gzrewind.atom                             16-Jul-2024 06:03                 612
function.gzseek.atom                               16-Jul-2024 06:03                 597
function.gztell.atom                               16-Jul-2024 06:03                 603
function.gzuncompress.atom                         16-Jul-2024 06:03                 639
function.gzwrite.atom                              16-Jul-2024 06:03                 617
function.halt-compiler.atom                        16-Jul-2024 06:03                 626
function.hash-algos.atom                           16-Jul-2024 06:03                 636
function.hash-copy.atom                            16-Jul-2024 06:03                 593
function.hash-equals.atom                          16-Jul-2024 06:03                 650
function.hash-file.atom                            16-Jul-2024 06:03                 674
function.hash-final.atom                           16-Jul-2024 06:03                 686
function.hash-hkdf.atom                            16-Jul-2024 06:03                 676
function.hash-hmac-algos.atom                      16-Jul-2024 06:03                 652
function.hash-hmac-file.atom                       16-Jul-2024 06:03                 737
function.hash-hmac.atom                            16-Jul-2024 06:03                 673
function.hash-init.atom                            16-Jul-2024 06:03                 621
function.hash-update-file.atom                     16-Jul-2024 06:03                 677
function.hash-update-stream.atom                   16-Jul-2024 06:03                 677
function.hash-update.atom                          16-Jul-2024 06:03                 634
function.hash.atom                                 16-Jul-2024 06:03                 633
function.header-register-callback.atom             16-Jul-2024 06:03                 684
function.header-remove.atom                        16-Jul-2024 06:03                 611
function.header.atom                               16-Jul-2024 06:03                 593
function.headers-list.atom                         16-Jul-2024 06:03                 654
function.headers-sent.atom                         16-Jul-2024 06:03                 688
function.hebrev.atom                               16-Jul-2024 06:03                 617
function.hebrevc.atom                              16-Jul-2024 06:03                 656
function.hex2bin.atom                              16-Jul-2024 06:03                 650
function.hexdec.atom                               16-Jul-2024 06:03                 613
function.highlight-file.atom                       16-Jul-2024 06:03                 621
function.highlight-string.atom                     16-Jul-2024 06:03                 651
function.hrtime.atom                               16-Jul-2024 06:03                 598
function.html-entity-decode.atom                   16-Jul-2024 06:03                 684
function.htmlentities.atom                         16-Jul-2024 06:03                 662
function.htmlspecialchars-decode.atom              16-Jul-2024 06:03                 690
function.htmlspecialchars.atom                     16-Jul-2024 06:03                 668
function.http-build-query.atom                     16-Jul-2024 06:03                 672
function.http-response-code.atom                   16-Jul-2024 06:03                 679
function.hypot.atom                                16-Jul-2024 06:03                 647
function.ibase-add-user.atom                       16-Jul-2024 06:03                 679
function.ibase-affected-rows.atom                  16-Jul-2024 06:03                 695
function.ibase-backup.atom                         16-Jul-2024 06:03                 683
function.ibase-blob-add.atom                       16-Jul-2024 06:03                 677
function.ibase-blob-cancel.atom                    16-Jul-2024 06:03                 639
function.ibase-blob-close.atom                     16-Jul-2024 06:03                 605
function.ibase-blob-create.atom                    16-Jul-2024 06:03                 654
function.ibase-blob-echo.atom                      16-Jul-2024 06:03                 636
function.ibase-blob-get.atom                       16-Jul-2024 06:03                 642
function.ibase-blob-import.atom                    16-Jul-2024 06:03                 652
function.ibase-blob-info.atom                      16-Jul-2024 06:03                 659
function.ibase-blob-open.atom                      16-Jul-2024 06:03                 673
function.ibase-close.atom                          16-Jul-2024 06:03                 644
function.ibase-commit-ret.atom                     16-Jul-2024 06:03                 631
function.ibase-commit.atom                         16-Jul-2024 06:03                 602
function.ibase-connect.atom                        16-Jul-2024 06:03                 640
function.ibase-db-info.atom                        16-Jul-2024 06:03                 646
function.ibase-delete-user.atom                    16-Jul-2024 06:03                 682
function.ibase-drop-db.atom                        16-Jul-2024 06:03                 622
function.ibase-errcode.atom                        16-Jul-2024 06:03                 613
function.ibase-errmsg.atom                         16-Jul-2024 06:03                 607
function.ibase-execute.atom                        16-Jul-2024 06:03                 654
function.ibase-fetch-assoc.atom                    16-Jul-2024 06:03                 708
function.ibase-fetch-object.atom                   16-Jul-2024 06:03                 643
function.ibase-fetch-row.atom                      16-Jul-2024 06:03                 622
function.ibase-field-info.atom                     16-Jul-2024 06:03                 625
function.ibase-free-event-handler.atom             16-Jul-2024 06:03                 689
function.ibase-free-query.atom                     16-Jul-2024 06:03                 713
function.ibase-free-result.atom                    16-Jul-2024 06:03                 635
function.ibase-gen-id.atom                         16-Jul-2024 06:03                 679
function.ibase-maintain-db.atom                    16-Jul-2024 06:03                 680
function.ibase-modify-user.atom                    16-Jul-2024 06:03                 681
function.ibase-name-result.atom                    16-Jul-2024 06:03                 653
function.ibase-num-fields.atom                     16-Jul-2024 06:03                 650
function.ibase-num-params.atom                     16-Jul-2024 06:03                 693
function.ibase-param-info.atom                     16-Jul-2024 06:03                 726
function.ibase-pconnect.atom                       16-Jul-2024 06:03                 665
function.ibase-prepare.atom                        16-Jul-2024 06:03                 715
function.ibase-query.atom                          16-Jul-2024 06:03                 630
function.ibase-restore.atom                        16-Jul-2024 06:03                 688
function.ibase-rollback-ret.atom                   16-Jul-2024 06:03                 629
function.ibase-rollback.atom                       16-Jul-2024 06:03                 612
function.ibase-server-info.atom                    16-Jul-2024 06:03                 682
function.ibase-service-attach.atom                 16-Jul-2024 06:03                 634
function.ibase-service-detach.atom                 16-Jul-2024 06:03                 647
function.ibase-set-event-handler.atom              16-Jul-2024 06:03                 689
function.ibase-trans.atom                          16-Jul-2024 06:03                 615
function.ibase-wait-event.atom                     16-Jul-2024 06:03                 637
function.iconv-get-encoding.atom                   16-Jul-2024 06:03                 635
function.iconv-mime-decode-headers.atom            16-Jul-2024 06:03                 668
function.iconv-mime-decode.atom                    16-Jul-2024 06:03                 652
function.iconv-mime-encode.atom                    16-Jul-2024 06:03                 666
function.iconv-set-encoding.atom                   16-Jul-2024 06:03                 655
function.iconv-strlen.atom                         16-Jul-2024 06:03                 645
function.iconv-strpos.atom                         16-Jul-2024 06:03                 672
function.iconv-strrpos.atom                        16-Jul-2024 06:03                 698
function.iconv-substr.atom                         16-Jul-2024 06:03                 610
function.iconv.atom                                16-Jul-2024 06:03                 661
function.idate.atom                                16-Jul-2024 06:03                 622
function.idn-to-ascii.atom                         16-Jul-2024 06:03                 622
function.idn-to-utf8.atom                          16-Jul-2024 06:03                 620
function.igbinary-serialize.atom                   16-Jul-2024 06:03                 698
function.igbinary-unserialize.atom                 16-Jul-2024 06:03                 724
function.ignore-user-abort.atom                    16-Jul-2024 06:03                 664
function.image-type-to-extension.atom              16-Jul-2024 06:03                 669
function.image-type-to-mime-type.atom              16-Jul-2024 06:03                 651
function.image2wbmp.atom                           16-Jul-2024 06:03                 631
function.imageaffine.atom                          16-Jul-2024 06:03                 703
function.imageaffinematrixconcat.atom              16-Jul-2024 06:03                 666
function.imageaffinematrixget.atom                 16-Jul-2024 06:03                 642
function.imagealphablending.atom                   16-Jul-2024 06:03                 636
function.imageantialias.atom                       16-Jul-2024 06:03                 626
function.imagearc.atom                             16-Jul-2024 06:03                 591
function.imageavif.atom                            16-Jul-2024 06:03                 628
function.imagebmp.atom                             16-Jul-2024 06:03                 630
function.imagechar.atom                            16-Jul-2024 06:03                 612
function.imagecharup.atom                          16-Jul-2024 06:03                 616
function.imagecolorallocate.atom                   16-Jul-2024 06:03                 625
function.imagecolorallocatealpha.atom              16-Jul-2024 06:03                 648
function.imagecolorat.atom                         16-Jul-2024 06:03                 642
function.imagecolorclosest.atom                    16-Jul-2024 06:03                 676
function.imagecolorclosestalpha.atom               16-Jul-2024 06:03                 671
function.imagecolorclosesthwb.atom                 16-Jul-2024 06:03                 690
function.imagecolordeallocate.atom                 16-Jul-2024 06:03                 635
function.imagecolorexact.atom                      16-Jul-2024 06:03                 636
function.imagecolorexactalpha.atom                 16-Jul-2024 06:03                 659
function.imagecolormatch.atom                      16-Jul-2024 06:03                 704
function.imagecolorresolve.atom                    16-Jul-2024 06:03                 670
function.imagecolorresolvealpha.atom               16-Jul-2024 06:03                 695
function.imagecolorset.atom                        16-Jul-2024 06:03                 654
function.imagecolorsforindex.atom                  16-Jul-2024 06:03                 656
function.imagecolorstotal.atom                     16-Jul-2024 06:03                 634
function.imagecolortransparent.atom                16-Jul-2024 06:03                 643
function.imageconvolution.atom                     16-Jul-2024 06:03                 678
function.imagecopy.atom                            16-Jul-2024 06:03                 598
function.imagecopymerge.atom                       16-Jul-2024 06:03                 625
function.imagecopymergegray.atom                   16-Jul-2024 06:03                 656
function.imagecopyresampled.atom                   16-Jul-2024 06:03                 661
function.imagecopyresized.atom                     16-Jul-2024 06:03                 636
function.imagecreate.atom                          16-Jul-2024 06:03                 626
function.imagecreatefromavif.atom                  16-Jul-2024 06:03                 658
function.imagecreatefrombmp.atom                   16-Jul-2024 06:03                 655
function.imagecreatefromgd.atom                    16-Jul-2024 06:03                 682
function.imagecreatefromgd2.atom                   16-Jul-2024 06:03                 686
function.imagecreatefromgd2part.atom               16-Jul-2024 06:03                 709
function.imagecreatefromgif.atom                   16-Jul-2024 06:03                 655
function.imagecreatefromjpeg.atom                  16-Jul-2024 06:03                 658
function.imagecreatefrompng.atom                   16-Jul-2024 06:03                 655
function.imagecreatefromstring.atom                16-Jul-2024 06:03                 674
function.imagecreatefromtga.atom                   16-Jul-2024 06:03                 655
function.imagecreatefromwbmp.atom                  16-Jul-2024 06:03                 658
function.imagecreatefromwebp.atom                  16-Jul-2024 06:03                 658
function.imagecreatefromxbm.atom                   16-Jul-2024 06:03                 655
function.imagecreatefromxpm.atom                   16-Jul-2024 06:03                 655
function.imagecreatetruecolor.atom                 16-Jul-2024 06:03                 651
function.imagecrop.atom                            16-Jul-2024 06:03                 616
function.imagecropauto.atom                        16-Jul-2024 06:03                 648
function.imagedashedline.atom                      16-Jul-2024 06:03                 622
function.imagedestroy.atom                         16-Jul-2024 06:03                 602
function.imageellipse.atom                         16-Jul-2024 06:03                 593
function.imagefill.atom                            16-Jul-2024 06:03                 576
function.imagefilledarc.atom                       16-Jul-2024 06:03                 616
function.imagefilledellipse.atom                   16-Jul-2024 06:03                 618
function.imagefilledpolygon.atom                   16-Jul-2024 06:03                 618
function.imagefilledrectangle.atom                 16-Jul-2024 06:03                 625
function.imagefilltoborder.atom                    16-Jul-2024 06:03                 657
function.imagefilter.atom                          16-Jul-2024 06:03                 612
function.imageflip.atom                            16-Jul-2024 06:03                 611
function.imagefontheight.atom                      16-Jul-2024 06:03                 615
function.imagefontwidth.atom                       16-Jul-2024 06:03                 612
function.imageftbbox.atom                          16-Jul-2024 06:03                 670
function.imagefttext.atom                          16-Jul-2024 06:03                 646
function.imagegammacorrect.atom                    16-Jul-2024 06:03                 647
function.imagegd.atom                              16-Jul-2024 06:03                 644
function.imagegd2.atom                             16-Jul-2024 06:03                 648
function.imagegetclip.atom                         16-Jul-2024 06:03                 628
function.imagegetinterpolation.atom                16-Jul-2024 06:03                 674
function.imagegif.atom                             16-Jul-2024 06:03                 625
function.imagegrabscreen.atom                      16-Jul-2024 06:03                 622
function.imagegrabwindow.atom                      16-Jul-2024 06:03                 612
function.imageinterlace.atom                       16-Jul-2024 06:03                 631
function.imageistruecolor.atom                     16-Jul-2024 06:03                 643
function.imagejpeg.atom                            16-Jul-2024 06:03                 628
function.imagelayereffect.atom                     16-Jul-2024 06:03                 663
function.imageline.atom                            16-Jul-2024 06:03                 582
function.imageloadfont.atom                        16-Jul-2024 06:03                 603
function.imageopenpolygon.atom                     16-Jul-2024 06:03                 612
function.imagepalettecopy.atom                     16-Jul-2024 06:03                 645
function.imagepalettetotruecolor.atom              16-Jul-2024 06:03                 676
function.imagepng.atom                             16-Jul-2024 06:03                 615
function.imagepolygon.atom                         16-Jul-2024 06:03                 593
function.imagerectangle.atom                       16-Jul-2024 06:03                 600
function.imageresolution.atom                      16-Jul-2024 06:03                 675
function.imagerotate.atom                          16-Jul-2024 06:03                 609
function.imagesavealpha.atom                       16-Jul-2024 06:03                 738
function.imagescale.atom                           16-Jul-2024 06:03                 669
function.imagesetbrush.atom                        16-Jul-2024 06:03                 620
function.imagesetclip.atom                         16-Jul-2024 06:03                 616
function.imagesetinterpolation.atom                16-Jul-2024 06:03                 661
function.imagesetpixel.atom                        16-Jul-2024 06:03                 593
function.imagesetstyle.atom                        16-Jul-2024 06:03                 621
function.imagesetthickness.atom                    16-Jul-2024 06:03                 640
function.imagesettile.atom                         16-Jul-2024 06:03                 632
function.imagestring.atom                          16-Jul-2024 06:03                 611
function.imagestringup.atom                        16-Jul-2024 06:03                 615
function.imagesx.atom                              16-Jul-2024 06:03                 595
function.imagesy.atom                              16-Jul-2024 06:03                 594
function.imagetruecolortopalette.atom              16-Jul-2024 06:03                 675
function.imagettfbbox.atom                         16-Jul-2024 06:03                 661
function.imagettftext.atom                         16-Jul-2024 06:03                 615
function.imagetypes.atom                           16-Jul-2024 06:03                 652
function.imagewbmp.atom                            16-Jul-2024 06:03                 628
function.imagewebp.atom                            16-Jul-2024 06:03                 620
function.imagexbm.atom                             16-Jul-2024 06:03                 614
function.imap-8bit.atom                            16-Jul-2024 06:03                 678
function.imap-alerts.atom                          16-Jul-2024 06:03                 598
function.imap-append.atom                          16-Jul-2024 06:03                 625
function.imap-base64.atom                          16-Jul-2024 06:03                 625
function.imap-binary.atom                          16-Jul-2024 06:03                 665
function.imap-body.atom                            16-Jul-2024 06:03                 595
function.imap-bodystruct.atom                      16-Jul-2024 06:03                 642
function.imap-check.atom                           16-Jul-2024 06:03                 626
function.imap-clearflag-full.atom                  16-Jul-2024 06:03                 636
function.imap-close.atom                           16-Jul-2024 06:03                 588
function.imap-create.atom                          16-Jul-2024 06:03                 598
function.imap-createmailbox.atom                   16-Jul-2024 06:03                 648
function.imap-delete.atom                          16-Jul-2024 06:03                 657
function.imap-deletemailbox.atom                   16-Jul-2024 06:03                 630
function.imap-errors.atom                          16-Jul-2024 06:03                 613
function.imap-expunge.atom                         16-Jul-2024 06:03                 640
function.imap-fetch-overview.atom                  16-Jul-2024 06:03                 645
function.imap-fetchbody.atom                       16-Jul-2024 06:03                 636
function.imap-fetchheader.atom                     16-Jul-2024 06:03                 637
function.imap-fetchmime.atom                       16-Jul-2024 06:03                 690
function.imap-fetchstructure.atom                  16-Jul-2024 06:03                 629
function.imap-fetchtext.atom                       16-Jul-2024 06:03                 598
function.imap-gc.atom                              16-Jul-2024 06:03                 579
function.imap-get-quota.atom                       16-Jul-2024 06:03                 679
function.imap-get-quotaroot.atom                   16-Jul-2024 06:03                 628
function.imap-getacl.atom                          16-Jul-2024 06:03                 622
function.imap-getmailboxes.atom                    16-Jul-2024 06:03                 674
function.imap-getsubscribed.atom                   16-Jul-2024 06:03                 648
function.imap-header.atom                          16-Jul-2024 06:03                 595
function.imap-headerinfo.atom                      16-Jul-2024 06:03                 622
function.imap-headers.atom                         16-Jul-2024 06:03                 665
function.imap-is-open.atom                         16-Jul-2024 06:03                 629
function.imap-last-error.atom                      16-Jul-2024 06:03                 630
function.imap-list.atom                            16-Jul-2024 06:03                 610
function.imap-listmailbox.atom                     16-Jul-2024 06:03                 604
function.imap-listscan.atom                        16-Jul-2024 06:03                 659
function.imap-listsubscribed.atom                  16-Jul-2024 06:03                 613
function.imap-lsub.atom                            16-Jul-2024 06:03                 634
function.imap-mail-compose.atom                    16-Jul-2024 06:03                 620
function.imap-mail-copy.atom                       16-Jul-2024 06:03                 667
function.imap-mail-move.atom                       16-Jul-2024 06:03                 648
function.imap-mail.atom                            16-Jul-2024 06:03                 587
function.imap-mailboxmsginfo.atom                  16-Jul-2024 06:03                 678
function.imap-mime-header-decode.atom              16-Jul-2024 06:03                 692
function.imap-msgno.atom                           16-Jul-2024 06:03                 660
function.imap-mutf7-to-utf8.atom                   16-Jul-2024 06:03                 688
function.imap-num-msg.atom                         16-Jul-2024 06:03                 649
function.imap-num-recent.atom                      16-Jul-2024 06:03                 677
function.imap-open.atom                            16-Jul-2024 06:03                 620
function.imap-ping.atom                            16-Jul-2024 06:03                 619
function.imap-qprint.atom                          16-Jul-2024 06:03                 669
function.imap-rename.atom                          16-Jul-2024 06:03                 598
function.imap-renamemailbox.atom                   16-Jul-2024 06:03                 631
function.imap-reopen.atom                          16-Jul-2024 06:03                 648
function.imap-rfc822-parse-adrlist.atom            16-Jul-2024 06:03                 638
function.imap-rfc822-parse-headers.atom            16-Jul-2024 06:03                 646
function.imap-rfc822-write-address.atom            16-Jul-2024 06:03                 672
function.imap-savebody.atom                        16-Jul-2024 06:03                 645
function.imap-scan.atom                            16-Jul-2024 06:03                 587
function.imap-scanmailbox.atom                     16-Jul-2024 06:03                 608
function.imap-search.atom                          16-Jul-2024 06:03                 629
function.imap-set-quota.atom                       16-Jul-2024 06:03                 635
function.imap-setacl.atom                          16-Jul-2024 06:03                 619
function.imap-setflag-full.atom                    16-Jul-2024 06:03                 625
function.imap-sort.atom                            16-Jul-2024 06:03                 582
function.imap-status.atom                          16-Jul-2024 06:03                 642
function.imap-subscribe.atom                       16-Jul-2024 06:03                 633
function.imap-thread.atom                          16-Jul-2024 06:03                 637
function.imap-timeout.atom                         16-Jul-2024 06:03                 606
function.imap-uid.atom                             16-Jul-2024 06:03                 599
function.imap-undelete.atom                        16-Jul-2024 06:03                 640
function.imap-unsubscribe.atom                     16-Jul-2024 06:03                 654
function.imap-utf7-decode.atom                     16-Jul-2024 06:03                 671
function.imap-utf7-encode.atom                     16-Jul-2024 06:03                 661
function.imap-utf8-to-mutf7.atom                   16-Jul-2024 06:03                 677
function.imap-utf8.atom                            16-Jul-2024 06:03                 607
function.implode.atom                              16-Jul-2024 06:03                 645
function.in-array.atom                             16-Jul-2024 06:03                 618
function.include-once.atom                         16-Jul-2024 06:03                 586
function.include.atom                              16-Jul-2024 06:03                 566
function.inet-ntop.atom                            16-Jul-2024 06:03                 662
function.inet-pton.atom                            16-Jul-2024 06:03                 637
function.inflate-add.atom                          16-Jul-2024 06:03                 605
function.inflate-get-read-len.atom                 16-Jul-2024 06:03                 629
function.inflate-get-status.atom                   16-Jul-2024 06:03                 616
function.inflate-init.atom                         16-Jul-2024 06:03                 615
function.ini-alter.atom                            16-Jul-2024 06:03                 581
function.ini-get-all.atom                          16-Jul-2024 06:03                 610
function.ini-get.atom                              16-Jul-2024 06:03                 607
function.ini-parse-quantity.atom                   16-Jul-2024 06:03                 638
function.ini-restore.atom                          16-Jul-2024 06:03                 623
function.ini-set.atom                              16-Jul-2024 06:03                 611
function.inotify-add-watch.atom                    16-Jul-2024 06:03                 654
function.inotify-init.atom                         16-Jul-2024 06:03                 605
function.inotify-queue-len.atom                    16-Jul-2024 06:03                 665
function.inotify-read.atom                         16-Jul-2024 06:03                 640
function.inotify-rm-watch.atom                     16-Jul-2024 06:03                 647
function.intdiv.atom                               16-Jul-2024 06:03                 578
function.interface-exists.atom                     16-Jul-2024 06:03                 668
function.intl-error-name.atom                      16-Jul-2024 06:03                 650
function.intl-get-error-code.atom                  16-Jul-2024 06:03                 628
function.intl-get-error-message.atom               16-Jul-2024 06:03                 655
function.intl-is-failure.atom                      16-Jul-2024 06:03                 654
function.intval.atom                               16-Jul-2024 06:03                 657
function.ip2long.atom                              16-Jul-2024 06:03                 696
function.iptcembed.atom                            16-Jul-2024 06:03                 640
function.iptcparse.atom                            16-Jul-2024 06:03                 626
function.is-a.atom                                 16-Jul-2024 06:03                 625
function.is-array.atom                             16-Jul-2024 06:03                 613
function.is-bool.atom                              16-Jul-2024 06:03                 621
function.is-callable.atom                          16-Jul-2024 06:03                 701
function.is-countable.atom                         16-Jul-2024 06:03                 659
function.is-dir.atom                               16-Jul-2024 06:03                 592
function.is-double.atom                            16-Jul-2024 06:03                 582
function.is-executable.atom                        16-Jul-2024 06:03                 624
function.is-file.atom                              16-Jul-2024 06:03                 616
function.is-finite.atom                            16-Jul-2024 06:03                 614
function.is-float.atom                             16-Jul-2024 06:03                 636
function.is-infinite.atom                          16-Jul-2024 06:03                 622
function.is-int.atom                               16-Jul-2024 06:03                 618
function.is-integer.atom                           16-Jul-2024 06:03                 583
function.is-iterable.atom                          16-Jul-2024 06:03                 645
function.is-link.atom                              16-Jul-2024 06:03                 603
function.is-long.atom                              16-Jul-2024 06:03                 574
function.is-nan.atom                               16-Jul-2024 06:03                 604
function.is-null.atom                              16-Jul-2024 06:03                 592
function.is-numeric.atom                           16-Jul-2024 06:03                 663
function.is-object.atom                            16-Jul-2024 06:03                 619
function.is-readable.atom                          16-Jul-2024 06:03                 628
function.is-real.atom                              16-Jul-2024 06:03                 576
function.is-resource.atom                          16-Jul-2024 06:03                 625
function.is-scalar.atom                            16-Jul-2024 06:03                 604
function.is-soap-fault.atom                        16-Jul-2024 06:03                 623
function.is-string.atom                            16-Jul-2024 06:03                 655
function.is-subclass-of.atom                       16-Jul-2024 06:03                 700
function.is-tainted.atom                           16-Jul-2024 06:03                 634
function.is-uploaded-file.atom                     16-Jul-2024 06:03                 693
function.is-writable.atom                          16-Jul-2024 06:03                 630
function.is-writeable.atom                         16-Jul-2024 06:03                 594
function.isset.atom                                16-Jul-2024 06:03                 661
function.iterator-apply.atom                       16-Jul-2024 06:03                 676
function.iterator-count.atom                       16-Jul-2024 06:03                 663
function.iterator-to-array.atom                    16-Jul-2024 06:03                 634
function.jddayofweek.atom                          16-Jul-2024 06:03                 622
function.jdmonthname.atom                          16-Jul-2024 06:03                 594
function.jdtofrench.atom                           16-Jul-2024 06:03                 685
function.jdtogregorian.atom                        16-Jul-2024 06:03                 660
function.jdtojewish.atom                           16-Jul-2024 06:03                 644
function.jdtojulian.atom                           16-Jul-2024 06:03                 646
function.jdtounix.atom                             16-Jul-2024 06:03                 604
function.jewishtojd.atom                           16-Jul-2024 06:03                 645
function.join.atom                                 16-Jul-2024 06:03                 566
function.jpeg2wbmp.atom                            16-Jul-2024 06:03                 603
function.json-decode.atom                          16-Jul-2024 06:03                 614
function.json-encode.atom                          16-Jul-2024 06:03                 631
function.json-last-error-msg.atom                  16-Jul-2024 06:03                 733
function.json-last-error.atom                      16-Jul-2024 06:03                 626
function.json-validate.atom                        16-Jul-2024 06:03                 615
function.juliantojd.atom                           16-Jul-2024 06:03                 650
function.key-exists.atom                           16-Jul-2024 06:03                 593
function.key.atom                                  16-Jul-2024 06:03                 603
function.krsort.atom                               16-Jul-2024 06:03                 635
function.ksort.atom                                16-Jul-2024 06:03                 619
function.lcfirst.atom                              16-Jul-2024 06:03                 607
function.lcg-value.atom                            16-Jul-2024 06:03                 651
function.lchgrp.atom                               16-Jul-2024 06:03                 618
function.lchown.atom                               16-Jul-2024 06:03                 615
function.ldap-8859-to-t61.atom                     16-Jul-2024 06:03                 655
function.ldap-add-ext.atom                         16-Jul-2024 06:03                 623
function.ldap-add.atom                             16-Jul-2024 06:03                 611
function.ldap-bind-ext.atom                        16-Jul-2024 06:03                 596
function.ldap-bind.atom                            16-Jul-2024 06:03                 597
function.ldap-close.atom                           16-Jul-2024 06:03                 588
function.ldap-compare.atom                         16-Jul-2024 06:03                 637
function.ldap-connect-wallet.atom                  16-Jul-2024 06:03                 620
function.ldap-connect.atom                         16-Jul-2024 06:03                 612
function.ldap-control-paged-result-response.atom   16-Jul-2024 06:03                 699
function.ldap-control-paged-result.atom            16-Jul-2024 06:03                 659
function.ldap-count-entries.atom                   16-Jul-2024 06:03                 665
function.ldap-count-references.atom                16-Jul-2024 06:03                 651
function.ldap-delete-ext.atom                      16-Jul-2024 06:03                 631
function.ldap-delete.atom                          16-Jul-2024 06:03                 615
function.ldap-dn2ufn.atom                          16-Jul-2024 06:03                 623
function.ldap-err2str.atom                         16-Jul-2024 06:03                 648
function.ldap-errno.atom                           16-Jul-2024 06:03                 682
function.ldap-error.atom                           16-Jul-2024 06:03                 632
function.ldap-escape.atom                          16-Jul-2024 06:03                 660
function.ldap-exop-passwd.atom                     16-Jul-2024 06:03                 618
function.ldap-exop-refresh.atom                    16-Jul-2024 06:03                 622
function.ldap-exop-sync.atom                       16-Jul-2024 06:03                 610
function.ldap-exop-whoami.atom                     16-Jul-2024 06:03                 618
function.ldap-exop.atom                            16-Jul-2024 06:03                 595
function.ldap-explode-dn.atom                      16-Jul-2024 06:03                 650
function.ldap-first-attribute.atom                 16-Jul-2024 06:03                 626
function.ldap-first-entry.atom                     16-Jul-2024 06:03                 635
function.ldap-first-reference.atom                 16-Jul-2024 06:03                 661
function.ldap-free-result.atom                     16-Jul-2024 06:03                 648
function.ldap-get-attributes.atom                  16-Jul-2024 06:03                 641
function.ldap-get-dn.atom                          16-Jul-2024 06:03                 609
function.ldap-get-entries.atom                     16-Jul-2024 06:03                 642
function.ldap-get-option.atom                      16-Jul-2024 06:03                 640
function.ldap-get-values-len.atom                  16-Jul-2024 06:03                 655
function.ldap-get-values.atom                      16-Jul-2024 06:03                 639
function.ldap-list.atom                            16-Jul-2024 06:03                 589
function.ldap-mod-add.atom                         16-Jul-2024 06:03                 639
function.ldap-mod-del.atom                         16-Jul-2024 06:03                 639
function.ldap-mod-replace.atom                     16-Jul-2024 06:03                 645
function.ldap-mod_add-ext.atom                     16-Jul-2024 06:03                 628
function.ldap-mod_del-ext.atom                     16-Jul-2024 06:03                 633
function.ldap-mod_replace-ext.atom                 16-Jul-2024 06:03                 636
function.ldap-modify-batch.atom                    16-Jul-2024 06:03                 675
function.ldap-modify.atom                          16-Jul-2024 06:03                 596
function.ldap-next-attribute.atom                  16-Jul-2024 06:03                 622
function.ldap-next-entry.atom                      16-Jul-2024 06:03                 617
function.ldap-next-reference.atom                  16-Jul-2024 06:03                 642
function.ldap-parse-exop.atom                      16-Jul-2024 06:03                 634
function.ldap-parse-reference.atom                 16-Jul-2024 06:03                 690
function.ldap-parse-result.atom                    16-Jul-2024 06:03                 643
function.ldap-read.atom                            16-Jul-2024 06:03                 590
function.ldap-rename-ext.atom                      16-Jul-2024 06:03                 610
function.ldap-rename.atom                          16-Jul-2024 06:03                 614
function.ldap-sasl-bind.atom                       16-Jul-2024 06:03                 630
function.ldap-search.atom                          16-Jul-2024 06:03                 600
function.ldap-set-option.atom                      16-Jul-2024 06:03                 623
function.ldap-set-rebind-proc.atom                 16-Jul-2024 06:03                 709
function.ldap-sort.atom                            16-Jul-2024 06:03                 660
function.ldap-start-tls.atom                       16-Jul-2024 06:03                 602
function.ldap-t61-to-8859.atom                     16-Jul-2024 06:03                 655
function.ldap-unbind.atom                          16-Jul-2024 06:03                 615
function.levenshtein.atom                          16-Jul-2024 06:03                 631
function.libxml-clear-errors.atom                  16-Jul-2024 06:03                 630
function.libxml-disable-entity-loader.atom         16-Jul-2024 06:03                 688
function.libxml-get-errors.atom                    16-Jul-2024 06:03                 618
function.libxml-get-external-entity-loader.atom    16-Jul-2024 06:03                 675
function.libxml-get-last-error.atom                16-Jul-2024 06:03                 641
function.libxml-set-external-entity-loader.atom    16-Jul-2024 06:03                 712
function.libxml-set-streams-context.atom           16-Jul-2024 06:03                 691
function.libxml-use-internal-errors.atom           16-Jul-2024 06:03                 717
function.link.atom                                 16-Jul-2024 06:03                 573
function.linkinfo.atom                             16-Jul-2024 06:03                 601
function.list.atom                                 16-Jul-2024 06:03                 616
function.localeconv.atom                           16-Jul-2024 06:03                 595
function.localtime.atom                            16-Jul-2024 06:03                 615
function.log.atom                                  16-Jul-2024 06:03                 598
function.log10.atom                                16-Jul-2024 06:03                 574
function.log1p.atom                                16-Jul-2024 06:03                 610
function.long2ip.atom                              16-Jul-2024 06:03                 653
function.lstat.atom                                16-Jul-2024 06:03                 615
function.ltrim.atom                                16-Jul-2024 06:03                 654
function.lzf-compress.atom                         16-Jul-2024 06:03                 589
function.lzf-decompress.atom                       16-Jul-2024 06:03                 608
function.lzf-optimized-for.atom                    16-Jul-2024 06:03                 661
function.mail.atom                                 16-Jul-2024 06:03                 563
function.mailparse-determine-best-xfer-encoding..> 16-Jul-2024 06:03                 709
function.mailparse-msg-create.atom                 16-Jul-2024 06:03                 638
function.mailparse-msg-extract-part-file.atom      16-Jul-2024 06:03                 682
function.mailparse-msg-extract-part.atom           16-Jul-2024 06:03                 667
function.mailparse-msg-extract-whole-part-file...> 16-Jul-2024 06:03                 764
function.mailparse-msg-free.atom                   16-Jul-2024 06:03                 628
function.mailparse-msg-get-part-data.atom          16-Jul-2024 06:03                 686
function.mailparse-msg-get-part.atom               16-Jul-2024 06:03                 665
function.mailparse-msg-get-structure.atom          16-Jul-2024 06:03                 695
function.mailparse-msg-parse-file.atom             16-Jul-2024 06:03                 628
function.mailparse-msg-parse.atom                  16-Jul-2024 06:03                 668
function.mailparse-rfc822-parse-addresses.atom     16-Jul-2024 06:03                 654
function.mailparse-stream-encode.atom              16-Jul-2024 06:03                 728
function.mailparse-uudecode-all.atom               16-Jul-2024 06:03                 714
function.max.atom                                  16-Jul-2024 06:03                 568
function.mb-check-encoding.atom                    16-Jul-2024 06:03                 696
function.mb-chr.atom                               16-Jul-2024 06:03                 627
function.mb-convert-case.atom                      16-Jul-2024 06:03                 627
function.mb-convert-encoding.atom                  16-Jul-2024 06:03                 689
function.mb-convert-kana.atom                      16-Jul-2024 06:03                 701
function.mb-convert-variables.atom                 16-Jul-2024 06:03                 636
function.mb-decode-mimeheader.atom                 16-Jul-2024 06:03                 641
function.mb-decode-numericentity.atom              16-Jul-2024 06:03                 677
function.mb-detect-encoding.atom                   16-Jul-2024 06:03                 622
function.mb-detect-order.atom                      16-Jul-2024 06:03                 645
function.mb-encode-mimeheader.atom                 16-Jul-2024 06:03                 656
function.mb-encode-numericentity.atom              16-Jul-2024 06:03                 700
function.mb-encoding-aliases.atom                  16-Jul-2024 06:03                 674
function.mb-ereg-match.atom                        16-Jul-2024 06:03                 644
function.mb-ereg-replace-callback.atom             16-Jul-2024 06:03                 741
function.mb-ereg-replace.atom                      16-Jul-2024 06:03                 698
function.mb-ereg-search-getpos.atom                16-Jul-2024 06:03                 721
function.mb-ereg-search-getregs.atom               16-Jul-2024 06:03                 683
function.mb-ereg-search-init.atom                  16-Jul-2024 06:03                 732
function.mb-ereg-search-pos.atom                   16-Jul-2024 06:03                 724
function.mb-ereg-search-regs.atom                  16-Jul-2024 06:03                 695
function.mb-ereg-search-setpos.atom                16-Jul-2024 06:03                 681
function.mb-ereg-search.atom                       16-Jul-2024 06:03                 628
function.mb-ereg.atom                              16-Jul-2024 06:03                 646
function.mb-eregi-replace.atom                     16-Jul-2024 06:03                 690
function.mb-eregi.atom                             16-Jul-2024 06:03                 671
function.mb-get-info.atom                          16-Jul-2024 06:03                 628
function.mb-http-input.atom                        16-Jul-2024 06:03                 655
function.mb-http-output.atom                       16-Jul-2024 06:03                 624
function.mb-internal-encoding.atom                 16-Jul-2024 06:03                 633
function.mb-language.atom                          16-Jul-2024 06:03                 639
function.mb-list-encodings.atom                    16-Jul-2024 06:03                 658
function.mb-ord.atom                               16-Jul-2024 06:03                 642
function.mb-output-handler.atom                    16-Jul-2024 06:03                 626
function.mb-parse-str.atom                         16-Jul-2024 06:03                 659
function.mb-preferred-mime-name.atom               16-Jul-2024 06:03                 643
function.mb-regex-encoding.atom                    16-Jul-2024 06:03                 746
function.mb-regex-set-options.atom                 16-Jul-2024 06:03                 726
function.mb-scrub.atom                             16-Jul-2024 06:03                 678
function.mb-send-mail.atom                         16-Jul-2024 06:03                 606
function.mb-split.atom                             16-Jul-2024 06:03                 644
function.mb-str-pad.atom                           16-Jul-2024 06:03                 640
function.mb-str-split.atom                         16-Jul-2024 06:03                 679
function.mb-strcut.atom                            16-Jul-2024 06:03                 601
function.mb-strimwidth.atom                        16-Jul-2024 06:03                 605
function.mb-stripos.atom                           16-Jul-2024 06:03                 682
function.mb-stristr.atom                           16-Jul-2024 06:03                 682
function.mb-strlen.atom                            16-Jul-2024 06:03                 611
function.mb-strpos.atom                            16-Jul-2024 06:03                 673
function.mb-strrchr.atom                           16-Jul-2024 06:03                 682
function.mb-strrichr.atom                          16-Jul-2024 06:03                 719
function.mb-strripos.atom                          16-Jul-2024 06:03                 706
function.mb-strrpos.atom                           16-Jul-2024 06:03                 676
function.mb-strstr.atom                            16-Jul-2024 06:03                 648
function.mb-strtolower.atom                        16-Jul-2024 06:03                 625
function.mb-strtoupper.atom                        16-Jul-2024 06:03                 625
function.mb-strwidth.atom                          16-Jul-2024 06:03                 617
function.mb-substitute-character.atom              16-Jul-2024 06:03                 698
function.mb-substr-count.atom                      16-Jul-2024 06:03                 651
function.mb-substr.atom                            16-Jul-2024 06:03                 594
function.mcrypt-create-iv.atom                     16-Jul-2024 06:03                 698
function.mcrypt-decrypt.atom                       16-Jul-2024 06:03                 658
function.mcrypt-enc-get-algorithms-name.atom       16-Jul-2024 06:03                 679
function.mcrypt-enc-get-block-size.atom            16-Jul-2024 06:03                 660
function.mcrypt-enc-get-iv-size.atom               16-Jul-2024 06:03                 649
function.mcrypt-enc-get-key-size.atom              16-Jul-2024 06:03                 668
function.mcrypt-enc-get-modes-name.atom            16-Jul-2024 06:03                 636
function.mcrypt-enc-get-supported-key-sizes.atom   16-Jul-2024 06:03                 739
function.mcrypt-enc-is-block-algorithm-mode.atom   16-Jul-2024 06:03                 685
function.mcrypt-enc-is-block-algorithm.atom        16-Jul-2024 06:03                 676
function.mcrypt-enc-is-block-mode.atom             16-Jul-2024 06:03                 668
function.mcrypt-enc-self-test.atom                 16-Jul-2024 06:03                 620
function.mcrypt-encrypt.atom                       16-Jul-2024 06:03                 596
function.mcrypt-generic-deinit.atom                16-Jul-2024 06:03                 661
function.mcrypt-generic-init.atom                  16-Jul-2024 06:03                 645
function.mcrypt-generic.atom                       16-Jul-2024 06:03                 610
function.mcrypt-get-block-size.atom                16-Jul-2024 06:03                 650
function.mcrypt-get-cipher-name.atom               16-Jul-2024 06:03                 648
function.mcrypt-get-iv-size.atom                   16-Jul-2024 06:03                 666
function.mcrypt-get-key-size.atom                  16-Jul-2024 06:03                 649
function.mcrypt-list-algorithms.atom               16-Jul-2024 06:03                 666
function.mcrypt-list-modes.atom                    16-Jul-2024 06:03                 645
function.mcrypt-module-close.atom                  16-Jul-2024 06:03                 639
function.mcrypt-module-get-algo-block-size.atom    16-Jul-2024 06:03                 685
function.mcrypt-module-get-algo-key-size.atom      16-Jul-2024 06:03                 676
function.mcrypt-module-get-supported-key-sizes...> 16-Jul-2024 06:03                 760
function.mcrypt-module-is-block-algorithm-mode...> 16-Jul-2024 06:03                 688
function.mcrypt-module-is-block-algorithm.atom     16-Jul-2024 06:03                 679
function.mcrypt-module-is-block-mode.atom          16-Jul-2024 06:03                 657
function.mcrypt-module-open.atom                   16-Jul-2024 06:03                 661
function.mcrypt-module-self-test.atom              16-Jul-2024 06:03                 620
function.md5-file.atom                             16-Jul-2024 06:03                 594
function.md5.atom                                  16-Jul-2024 06:03                 589
function.mdecrypt-generic.atom                     16-Jul-2024 06:03                 629
function.memcache-debug.atom                       16-Jul-2024 06:03                 651
function.memory-get-peak-usage.atom                16-Jul-2024 06:03                 690
function.memory-get-usage.atom                     16-Jul-2024 06:03                 666
function.memory-reset-peak-usage.atom              16-Jul-2024 06:03                 634
function.metaphone.atom                            16-Jul-2024 06:03                 600
function.method-exists.atom                        16-Jul-2024 06:03                 643
function.mhash-count.atom                          16-Jul-2024 06:03                 636
function.mhash-get-block-size.atom                 16-Jul-2024 06:03                 632
function.mhash-get-hash-name.atom                  16-Jul-2024 06:03                 618
function.mhash-keygen-s2k.atom                     16-Jul-2024 06:03                 633
function.mhash.atom                                16-Jul-2024 06:03                 568
function.microtime.atom                            16-Jul-2024 06:03                 621
function.mime-content-type.atom                    16-Jul-2024 06:03                 644
function.min.atom                                  16-Jul-2024 06:03                 568
function.mkdir.atom                                16-Jul-2024 06:03                 579
function.mktime.atom                               16-Jul-2024 06:03                 603
function.money-format.atom                         16-Jul-2024 06:03                 618
function.mongodb.bson-fromjson.atom                16-Jul-2024 06:03                 666
function.mongodb.bson-fromphp.atom                 16-Jul-2024 06:03                 662
function.mongodb.bson-tocanonicalextendedjson.atom 16-Jul-2024 06:03                 712
function.mongodb.bson-tojson.atom                  16-Jul-2024 06:03                 709
function.mongodb.bson-tophp.atom                   16-Jul-2024 06:03                 638
function.mongodb.bson-torelaxedextendedjson.atom   16-Jul-2024 06:03                 704
function.mongodb.driver.monitoring.addsubscribe..> 16-Jul-2024 06:03                 734
function.mongodb.driver.monitoring.removesubscr..> 16-Jul-2024 06:03                 746
function.move-uploaded-file.atom                   16-Jul-2024 06:03                 665
function.mqseries-back.atom                        16-Jul-2024 06:03                 592
function.mqseries-begin.atom                       16-Jul-2024 06:03                 596
function.mqseries-close.atom                       16-Jul-2024 06:03                 596
function.mqseries-cmit.atom                        16-Jul-2024 06:03                 592
function.mqseries-conn.atom                        16-Jul-2024 06:03                 592
function.mqseries-connx.atom                       16-Jul-2024 06:03                 596
function.mqseries-disc.atom                        16-Jul-2024 06:03                 592
function.mqseries-get.atom                         16-Jul-2024 06:03                 588
function.mqseries-inq.atom                         16-Jul-2024 06:03                 588
function.mqseries-open.atom                        16-Jul-2024 06:03                 592
function.mqseries-put.atom                         16-Jul-2024 06:03                 588
function.mqseries-put1.atom                        16-Jul-2024 06:03                 592
function.mqseries-set.atom                         16-Jul-2024 06:03                 588
function.mqseries-strerror.atom                    16-Jul-2024 06:03                 667
function.msg-get-queue.atom                        16-Jul-2024 06:03                 644
function.msg-queue-exists.atom                     16-Jul-2024 06:03                 635
function.msg-receive.atom                          16-Jul-2024 06:03                 627
function.msg-remove-queue.atom                     16-Jul-2024 06:03                 625
function.msg-send.atom                             16-Jul-2024 06:03                 593
function.msg-set-queue.atom                        16-Jul-2024 06:03                 626
function.msg-stat-queue.atom                       16-Jul-2024 06:03                 629
function.mt-getrandmax.atom                        16-Jul-2024 06:03                 628
function.mt-rand.atom                              16-Jul-2024 06:03                 707
function.mt-srand.atom                             16-Jul-2024 06:03                 658
function.mysql-affected-rows.atom                  16-Jul-2024 06:03                 702
function.mysql-client-encoding.atom                16-Jul-2024 06:03                 687
function.mysql-close.atom                          16-Jul-2024 06:03                 595
function.mysql-connect.atom                        16-Jul-2024 06:03                 626
function.mysql-create-db.atom                      16-Jul-2024 06:03                 635
function.mysql-data-seek.atom                      16-Jul-2024 06:03                 650
function.mysql-db-name.atom                        16-Jul-2024 06:03                 688
function.mysql-db-query.atom                       16-Jul-2024 06:03                 679
function.mysql-drop-db.atom                        16-Jul-2024 06:03                 620
function.mysql-errno.atom                          16-Jul-2024 06:03                 655
function.mysql-error.atom                          16-Jul-2024 06:03                 721
function.mysql-escape-string.atom                  16-Jul-2024 06:03                 663
function.mysql-fetch-array.atom                    16-Jul-2024 06:03                 732
function.mysql-fetch-assoc.atom                    16-Jul-2024 06:03                 658
function.mysql-fetch-field.atom                    16-Jul-2024 06:03                 694
function.mysql-fetch-lengths.atom                  16-Jul-2024 06:03                 677
function.mysql-fetch-object.atom                   16-Jul-2024 06:03                 669
function.mysql-fetch-row.atom                      16-Jul-2024 06:03                 662
function.mysql-field-flags.atom                    16-Jul-2024 06:03                 642
function.mysql-field-len.atom                      16-Jul-2024 06:03                 646
function.mysql-field-name.atom                     16-Jul-2024 06:03                 654
function.mysql-field-seek.atom                     16-Jul-2024 06:03                 675
function.mysql-field-table.atom                    16-Jul-2024 06:03                 658
function.mysql-field-type.atom                     16-Jul-2024 06:03                 649
function.mysql-free-result.atom                    16-Jul-2024 06:03                 654
function.mysql-get-client-info.atom                16-Jul-2024 06:03                 641
function.mysql-get-host-info.atom                  16-Jul-2024 06:03                 647
function.mysql-get-proto-info.atom                 16-Jul-2024 06:03                 641
function.mysql-get-server-info.atom                16-Jul-2024 06:03                 642
function.mysql-info.atom                           16-Jul-2024 06:03                 658
function.mysql-insert-id.atom                      16-Jul-2024 06:03                 695
function.mysql-list-dbs.atom                       16-Jul-2024 06:03                 650
function.mysql-list-fields.atom                    16-Jul-2024 06:03                 628
function.mysql-list-processes.atom                 16-Jul-2024 06:03                 623
function.mysql-list-tables.atom                    16-Jul-2024 06:03                 649
function.mysql-num-fields.atom                     16-Jul-2024 06:03                 650
function.mysql-num-rows.atom                       16-Jul-2024 06:03                 644
function.mysql-pconnect.atom                       16-Jul-2024 06:03                 641
function.mysql-ping.atom                           16-Jul-2024 06:03                 650
function.mysql-query.atom                          16-Jul-2024 06:03                 629
function.mysql-real-escape-string.atom             16-Jul-2024 06:03                 716
function.mysql-result.atom                         16-Jul-2024 06:03                 627
function.mysql-select-db.atom                      16-Jul-2024 06:03                 642
function.mysql-set-charset.atom                    16-Jul-2024 06:03                 655
function.mysql-stat.atom                           16-Jul-2024 06:03                 611
function.mysql-tablename.atom                      16-Jul-2024 06:03                 627
function.mysql-thread-id.atom                      16-Jul-2024 06:03                 634
function.mysql-unbuffered-query.atom               16-Jul-2024 06:03                 694
function.mysql-xdevapi-expression.atom             16-Jul-2024 06:03                 657
function.mysql-xdevapi-getsession.atom             16-Jul-2024 06:03                 635
function.mysqli-connect.atom                       16-Jul-2024 06:03                 608
function.mysqli-escape-string.atom                 16-Jul-2024 06:03                 632
function.mysqli-execute.atom                       16-Jul-2024 06:03                 608
function.mysqli-get-client-stats.atom              16-Jul-2024 06:03                 653
function.mysqli-get-links-stats.atom               16-Jul-2024 06:03                 667
function.mysqli-report.atom                        16-Jul-2024 06:03                 619
function.mysqli-set-opt.atom                       16-Jul-2024 06:03                 603
function.natcasesort.atom                          16-Jul-2024 06:03                 689
function.natsort.atom                              16-Jul-2024 06:03                 644
function.net-get-interfaces.atom                   16-Jul-2024 06:03                 614
function.next.atom                                 16-Jul-2024 06:03                 594
function.ngettext.atom                             16-Jul-2024 06:03                 590
function.nl-langinfo.atom                          16-Jul-2024 06:03                 638
function.nl2br.atom                                16-Jul-2024 06:03                 642
function.number-format.atom                        16-Jul-2024 06:03                 616
function.oauth-get-sbs.atom                        16-Jul-2024 06:03                 647
function.oauth-urlencode.atom                      16-Jul-2024 06:03                 643
function.ob-clean.atom                             16-Jul-2024 06:03                 618
function.ob-end-clean.atom                         16-Jul-2024 06:03                 658
function.ob-end-flush.atom                         16-Jul-2024 06:03                 692
function.ob-flush.atom                             16-Jul-2024 06:03                 628
function.ob-get-clean.atom                         16-Jul-2024 06:03                 645
function.ob-get-contents.atom                      16-Jul-2024 06:03                 622
function.ob-get-flush.atom                         16-Jul-2024 06:03                 716
function.ob-get-length.atom                        16-Jul-2024 06:03                 628
function.ob-get-level.atom                         16-Jul-2024 06:03                 672
function.ob-get-status.atom                        16-Jul-2024 06:03                 610
function.ob-gzhandler.atom                         16-Jul-2024 06:03                 636
function.ob-iconv-handler.atom                     16-Jul-2024 06:03                 675
function.ob-implicit-flush.atom                    16-Jul-2024 06:03                 639
function.ob-list-handlers.atom                     16-Jul-2024 06:03                 646
function.ob-start.atom                             16-Jul-2024 06:03                 598
function.ob-tidyhandler.atom                       16-Jul-2024 06:03                 641
function.oci-bind-array-by-name.atom               16-Jul-2024 06:03                 684
function.oci-bind-by-name.atom                     16-Jul-2024 06:03                 642
function.oci-cancel.atom                           16-Jul-2024 06:03                 605
function.oci-client-version.atom                   16-Jul-2024 06:03                 656
function.oci-close.atom                            16-Jul-2024 06:03                 591
function.oci-commit.atom                           16-Jul-2024 06:03                 607
function.oci-connect.atom                          16-Jul-2024 06:03                 626
function.oci-define-by-name.atom                   16-Jul-2024 06:03                 720
function.oci-error.atom                            16-Jul-2024 06:03                 610
function.oci-execute.atom                          16-Jul-2024 06:03                 613
function.oci-fetch-all.atom                        16-Jul-2024 06:03                 661
function.oci-fetch-array.atom                      16-Jul-2024 06:03                 683
function.oci-fetch-assoc.atom                      16-Jul-2024 06:03                 659
function.oci-fetch-object.atom                     16-Jul-2024 06:03                 653
function.oci-fetch-row.atom                        16-Jul-2024 06:03                 671
function.oci-fetch.atom                            16-Jul-2024 06:03                 647
function.oci-field-is-null.atom                    16-Jul-2024 06:03                 670
function.oci-field-name.atom                       16-Jul-2024 06:03                 618
function.oci-field-precision.atom                  16-Jul-2024 06:03                 645
function.oci-field-scale.atom                      16-Jul-2024 06:03                 638
function.oci-field-size.atom                       16-Jul-2024 06:03                 621
function.oci-field-type-raw.atom                   16-Jul-2024 06:03                 649
function.oci-field-type.atom                       16-Jul-2024 06:03                 641
function.oci-free-descriptor.atom                  16-Jul-2024 06:03                 627
function.oci-free-statement.atom                   16-Jul-2024 06:03                 697
function.oci-get-implicit-resultset.atom           16-Jul-2024 06:03                 796
function.oci-internal-debug.atom                   16-Jul-2024 06:03                 633
function.oci-lob-copy.atom                         16-Jul-2024 06:03                 593
function.oci-lob-is-equal.atom                     16-Jul-2024 06:03                 614
function.oci-new-collection.atom                   16-Jul-2024 06:03                 633
function.oci-new-connect.atom                      16-Jul-2024 06:03                 643
function.oci-new-cursor.atom                       16-Jul-2024 06:03                 624
function.oci-new-descriptor.atom                   16-Jul-2024 06:03                 646
function.oci-num-fields.atom                       16-Jul-2024 06:03                 645
function.oci-num-rows.atom                         16-Jul-2024 06:03                 669
function.oci-parse.atom                            16-Jul-2024 06:03                 621
function.oci-password-change.atom                  16-Jul-2024 06:03                 647
function.oci-pconnect.atom                         16-Jul-2024 06:03                 636
function.oci-register-taf-callback.atom            16-Jul-2024 06:03                 678
function.oci-result.atom                           16-Jul-2024 06:03                 640
function.oci-rollback.atom                         16-Jul-2024 06:03                 613
function.oci-server-version.atom                   16-Jul-2024 06:03                 629
function.oci-set-action.atom                       16-Jul-2024 06:03                 622
function.oci-set-call-timout.atom                  16-Jul-2024 06:03                 640
function.oci-set-client-identifier.atom            16-Jul-2024 06:03                 660
function.oci-set-client-info.atom                  16-Jul-2024 06:03                 653
function.oci-set-db-operation.atom                 16-Jul-2024 06:03                 625
function.oci-set-edition.atom                      16-Jul-2024 06:03                 660
function.oci-set-module-name.atom                  16-Jul-2024 06:03                 630
function.oci-set-prefetch-lob.atom                 16-Jul-2024 06:03                 655
function.oci-set-prefetch.atom                     16-Jul-2024 06:03                 683
function.oci-statement-type.atom                   16-Jul-2024 06:03                 639
function.oci-unregister-taf-callback.atom          16-Jul-2024 06:03                 686
function.ocibindbyname.atom                        16-Jul-2024 06:03                 602
function.ocicancel.atom                            16-Jul-2024 06:03                 584
function.ocicloselob.atom                          16-Jul-2024 06:03                 593
function.ocicollappend.atom                        16-Jul-2024 06:03                 607
function.ocicollassign.atom                        16-Jul-2024 06:03                 607
function.ocicollassignelem.atom                    16-Jul-2024 06:03                 623
function.ocicollgetelem.atom                       16-Jul-2024 06:03                 611
function.ocicollmax.atom                           16-Jul-2024 06:03                 595
function.ocicollsize.atom                          16-Jul-2024 06:03                 599
function.ocicolltrim.atom                          16-Jul-2024 06:03                 599
function.ocicolumnisnull.atom                      16-Jul-2024 06:03                 609
function.ocicolumnname.atom                        16-Jul-2024 06:03                 600
function.ocicolumnprecision.atom                   16-Jul-2024 06:03                 620
function.ocicolumnscale.atom                       16-Jul-2024 06:03                 604
function.ocicolumnsize.atom                        16-Jul-2024 06:03                 600
function.ocicolumntype.atom                        16-Jul-2024 06:03                 600
function.ocicolumntyperaw.atom                     16-Jul-2024 06:03                 613
function.ocicommit.atom                            16-Jul-2024 06:03                 584
function.ocidefinebyname.atom                      16-Jul-2024 06:03                 610
function.ocierror.atom                             16-Jul-2024 06:03                 580
function.ociexecute.atom                           16-Jul-2024 06:03                 588
function.ocifetch.atom                             16-Jul-2024 06:03                 580
function.ocifetchinto.atom                         16-Jul-2024 06:03                 692
function.ocifetchstatement.atom                    16-Jul-2024 06:03                 611
function.ocifreecollection.atom                    16-Jul-2024 06:03                 617
function.ocifreecursor.atom                        16-Jul-2024 06:03                 604
function.ocifreedesc.atom                          16-Jul-2024 06:03                 592
function.ocifreestatement.atom                     16-Jul-2024 06:03                 613
function.ociinternaldebug.atom                     16-Jul-2024 06:03                 613
function.ociloadlob.atom                           16-Jul-2024 06:03                 589
function.ocilogoff.atom                            16-Jul-2024 06:03                 583
function.ocilogon.atom                             16-Jul-2024 06:03                 582
function.ocinewcollection.atom                     16-Jul-2024 06:03                 613
function.ocinewcursor.atom                         16-Jul-2024 06:03                 597
function.ocinewdescriptor.atom                     16-Jul-2024 06:03                 613
function.ocinlogon.atom                            16-Jul-2024 06:03                 589
function.ocinumcols.atom                           16-Jul-2024 06:03                 591
function.ociparse.atom                             16-Jul-2024 06:03                 580
function.ociplogon.atom                            16-Jul-2024 06:03                 586
function.ociresult.atom                            16-Jul-2024 06:03                 584
function.ocirollback.atom                          16-Jul-2024 06:03                 592
function.ocirowcount.atom                          16-Jul-2024 06:03                 592
function.ocisavelob.atom                           16-Jul-2024 06:03                 589
function.ocisavelobfile.atom                       16-Jul-2024 06:03                 603
function.ociserverversion.atom                     16-Jul-2024 06:03                 613
function.ocisetprefetch.atom                       16-Jul-2024 06:03                 605
function.ocistatementtype.atom                     16-Jul-2024 06:03                 613
function.ociwritelobtofile.atom                    16-Jul-2024 06:03                 612
function.ociwritetemporarylob.atom                 16-Jul-2024 06:03                 629
function.octdec.atom                               16-Jul-2024 06:03                 601
function.odbc-autocommit.atom                      16-Jul-2024 06:03                 619
function.odbc-binmode.atom                         16-Jul-2024 06:03                 636
function.odbc-close-all.atom                       16-Jul-2024 06:03                 612
function.odbc-close.atom                           16-Jul-2024 06:03                 592
function.odbc-columnprivileges.atom                16-Jul-2024 06:03                 655
function.odbc-columns.atom                         16-Jul-2024 06:03                 609
function.odbc-commit.atom                          16-Jul-2024 06:03                 598
function.odbc-connect.atom                         16-Jul-2024 06:03                 607
function.odbc-connection-string-is-quoted.atom     16-Jul-2024 06:03                 689
function.odbc-connection-string-quote.atom         16-Jul-2024 06:03                 660
function.odbc-connection-string-should-quote.atom  16-Jul-2024 06:03                 705
function.odbc-cursor.atom                          16-Jul-2024 06:03                 624
function.odbc-data-source.atom                     16-Jul-2024 06:03                 636
function.odbc-do.atom                              16-Jul-2024 06:03                 577
function.odbc-error.atom                           16-Jul-2024 06:03                 601
function.odbc-errormsg.atom                        16-Jul-2024 06:03                 613
function.odbc-exec.atom                            16-Jul-2024 06:03                 621
function.odbc-execute.atom                         16-Jul-2024 06:03                 649
function.odbc-fetch-array.atom                     16-Jul-2024 06:03                 649
function.odbc-fetch-into.atom                      16-Jul-2024 06:03                 648
function.odbc-fetch-object.atom                    16-Jul-2024 06:03                 639
function.odbc-fetch-row.atom                       16-Jul-2024 06:03                 616
function.odbc-field-len.atom                       16-Jul-2024 06:03                 611
function.odbc-field-name.atom                      16-Jul-2024 06:03                 607
function.odbc-field-num.atom                       16-Jul-2024 06:03                 608
function.odbc-field-precision.atom                 16-Jul-2024 06:03                 621
function.odbc-field-scale.atom                     16-Jul-2024 06:03                 631
function.odbc-field-type.atom                      16-Jul-2024 06:03                 625
function.odbc-foreignkeys.atom                     16-Jul-2024 06:03                 644
function.odbc-free-result.atom                     16-Jul-2024 06:03                 675
function.odbc-gettypeinfo.atom                     16-Jul-2024 06:03                 659
function.odbc-longreadlen.atom                     16-Jul-2024 06:03                 619
function.odbc-next-result.atom                     16-Jul-2024 06:03                 655
function.odbc-num-fields.atom                      16-Jul-2024 06:03                 629
function.odbc-num-rows.atom                        16-Jul-2024 06:03                 621
function.odbc-pconnect.atom                        16-Jul-2024 06:03                 654
function.odbc-prepare.atom                         16-Jul-2024 06:03                 638
function.odbc-primarykeys.atom                     16-Jul-2024 06:03                 658
function.odbc-procedurecolumns.atom                16-Jul-2024 06:03                 658
function.odbc-procedures.atom                      16-Jul-2024 06:03                 634
function.odbc-result-all.atom                      16-Jul-2024 06:03                 649
function.odbc-result.atom                          16-Jul-2024 06:03                 612
function.odbc-rollback.atom                        16-Jul-2024 06:03                 599
function.odbc-setoption.atom                       16-Jul-2024 06:03                 618
function.odbc-specialcolumns.atom                  16-Jul-2024 06:03                 639
function.odbc-statistics.atom                      16-Jul-2024 06:03                 620
function.odbc-tableprivileges.atom                 16-Jul-2024 06:03                 645
function.odbc-tables.atom                          16-Jul-2024 06:03                 605
function.opcache-compile-file.atom                 16-Jul-2024 06:03                 667
function.opcache-get-configuration.atom            16-Jul-2024 06:03                 686
function.opcache-get-status.atom                   16-Jul-2024 06:03                 658
function.opcache-invalidate.atom                   16-Jul-2024 06:03                 623
function.opcache-is-script-cached.atom             16-Jul-2024 06:03                 663
function.opcache-reset.atom                        16-Jul-2024 06:03                 628
function.openal-buffer-create.atom                 16-Jul-2024 06:03                 643
function.openal-buffer-data.atom                   16-Jul-2024 06:03                 636
function.openal-buffer-destroy.atom                16-Jul-2024 06:03                 636
function.openal-buffer-get.atom                    16-Jul-2024 06:03                 673
function.openal-buffer-loadwav.atom                16-Jul-2024 06:03                 638
function.openal-context-create.atom                16-Jul-2024 06:03                 648
function.openal-context-current.atom               16-Jul-2024 06:03                 659
function.openal-context-destroy.atom               16-Jul-2024 06:03                 634
function.openal-context-process.atom               16-Jul-2024 06:03                 653
function.openal-context-suspend.atom               16-Jul-2024 06:03                 654
function.openal-device-close.atom                  16-Jul-2024 06:03                 645
function.openal-device-open.atom                   16-Jul-2024 06:03                 629
function.openal-listener-get.atom                  16-Jul-2024 06:03                 677
function.openal-listener-set.atom                  16-Jul-2024 06:03                 665
function.openal-source-create.atom                 16-Jul-2024 06:03                 650
function.openal-source-destroy.atom                16-Jul-2024 06:03                 643
function.openal-source-get.atom                    16-Jul-2024 06:03                 672
function.openal-source-pause.atom                  16-Jul-2024 06:03                 626
function.openal-source-play.atom                   16-Jul-2024 06:03                 634
function.openal-source-rewind.atom                 16-Jul-2024 06:03                 642
function.openal-source-set.atom                    16-Jul-2024 06:03                 656
function.openal-source-stop.atom                   16-Jul-2024 06:03                 632
function.openal-stream.atom                        16-Jul-2024 06:03                 626
function.opendir.atom                              16-Jul-2024 06:03                 629
function.openlog.atom                              16-Jul-2024 06:03                 627
function.openssl-cipher-iv-length.atom             16-Jul-2024 06:03                 662
function.openssl-cipher-key-length.atom            16-Jul-2024 06:03                 639
function.openssl-cms-decrypt.atom                  16-Jul-2024 06:03                 616
function.openssl-cms-encrypt.atom                  16-Jul-2024 06:03                 616
function.openssl-cms-read.atom                     16-Jul-2024 06:03                 637
function.openssl-cms-sign.atom                     16-Jul-2024 06:03                 597
function.openssl-cms-verify.atom                   16-Jul-2024 06:03                 614
function.openssl-csr-export-to-file.atom           16-Jul-2024 06:03                 647
function.openssl-csr-export.atom                   16-Jul-2024 06:03                 638
function.openssl-csr-get-public-key.atom           16-Jul-2024 06:03                 665
function.openssl-csr-get-subject.atom              16-Jul-2024 06:03                 639
function.openssl-csr-new.atom                      16-Jul-2024 06:03                 619
function.openssl-csr-sign.atom                     16-Jul-2024 06:03                 693
function.openssl-decrypt.atom                      16-Jul-2024 06:03                 627
function.openssl-dh-compute-key.atom               16-Jul-2024 06:03                 738
function.openssl-digest.atom                       16-Jul-2024 06:03                 597
function.openssl-encrypt.atom                      16-Jul-2024 06:03                 613
function.openssl-error-string.atom                 16-Jul-2024 06:03                 639
function.openssl-free-key.atom                     16-Jul-2024 06:03                 618
function.openssl-get-cert-locations.atom           16-Jul-2024 06:03                 691
function.openssl-get-cipher-methods.atom           16-Jul-2024 06:03                 707
function.openssl-get-curve-names.atom              16-Jul-2024 06:03                 687
function.openssl-get-md-methods.atom               16-Jul-2024 06:03                 686
function.openssl-get-privatekey.atom               16-Jul-2024 06:03                 637
function.openssl-get-publickey.atom                16-Jul-2024 06:03                 633
function.openssl-open.atom                         16-Jul-2024 06:03                 622
function.openssl-pbkdf2.atom                       16-Jul-2024 06:03                 645
function.openssl-pkcs12-export-to-file.atom        16-Jul-2024 06:03                 665
function.openssl-pkcs12-export.atom                16-Jul-2024 06:03                 659
function.openssl-pkcs12-read.atom                  16-Jul-2024 06:03                 636
function.openssl-pkcs7-decrypt.atom                16-Jul-2024 06:03                 639
function.openssl-pkcs7-encrypt.atom                16-Jul-2024 06:03                 626
function.openssl-pkcs7-read.atom                   16-Jul-2024 06:03                 651
function.openssl-pkcs7-sign.atom                   16-Jul-2024 06:03                 615
function.openssl-pkcs7-verify.atom                 16-Jul-2024 06:03                 654
function.openssl-pkey-derive.atom                  16-Jul-2024 06:03                 669
function.openssl-pkey-export-to-file.atom          16-Jul-2024 06:03                 675
function.openssl-pkey-export.atom                  16-Jul-2024 06:03                 714
function.openssl-pkey-free.atom                    16-Jul-2024 06:03                 643
function.openssl-pkey-get-details.atom             16-Jul-2024 06:03                 683
function.openssl-pkey-get-private.atom             16-Jul-2024 06:03                 650
function.openssl-pkey-get-public.atom              16-Jul-2024 06:03                 689
function.openssl-pkey-new.atom                     16-Jul-2024 06:03                 660
function.openssl-private-decrypt.atom              16-Jul-2024 06:03                 692
function.openssl-private-encrypt.atom              16-Jul-2024 06:03                 679
function.openssl-public-decrypt.atom               16-Jul-2024 06:03                 680
function.openssl-public-encrypt.atom               16-Jul-2024 06:03                 667
function.openssl-random-pseudo-bytes.atom          16-Jul-2024 06:03                 700
function.openssl-seal.atom                         16-Jul-2024 06:03                 603
function.openssl-sign.atom                         16-Jul-2024 06:03                 602
function.openssl-spki-export-challenge.atom        16-Jul-2024 06:03                 714
function.openssl-spki-export.atom                  16-Jul-2024 06:03                 687
function.openssl-spki-new.atom                     16-Jul-2024 06:03                 685
function.openssl-spki-verify.atom                  16-Jul-2024 06:03                 685
function.openssl-verify.atom                       16-Jul-2024 06:03                 612
function.openssl-x509-check-private-key.atom       16-Jul-2024 06:03                 724
function.openssl-x509-checkpurpose.atom            16-Jul-2024 06:03                 665
function.openssl-x509-export-to-file.atom          16-Jul-2024 06:03                 656
function.openssl-x509-export.atom                  16-Jul-2024 06:03                 667
function.openssl-x509-fingerprint.atom             16-Jul-2024 06:03                 692
function.openssl-x509-free.atom                    16-Jul-2024 06:03                 646
function.openssl-x509-parse.atom                   16-Jul-2024 06:03                 618
function.openssl-x509-read.atom                    16-Jul-2024 06:03                 637
function.openssl-x509-verify.atom                  16-Jul-2024 06:03                 714
function.ord.atom                                  16-Jul-2024 06:03                 630
function.output-add-rewrite-var.atom               16-Jul-2024 06:03                 678
function.output-reset-rewrite-vars.atom            16-Jul-2024 06:03                 666
function.pack.atom                                 16-Jul-2024 06:03                 615
function.parse-ini-file.atom                       16-Jul-2024 06:03                 615
function.parse-ini-string.atom                     16-Jul-2024 06:03                 631
function.parse-str.atom                            16-Jul-2024 06:03                 638
function.parse-url.atom                            16-Jul-2024 06:03                 607
function.passthru.atom                             16-Jul-2024 06:03                 640
function.password-algos.atom                       16-Jul-2024 06:03                 688
function.password-get-info.atom                    16-Jul-2024 06:03                 652
function.password-hash.atom                        16-Jul-2024 06:03                 643
function.password-needs-rehash.atom                16-Jul-2024 06:03                 733
function.password-verify.atom                      16-Jul-2024 06:03                 660
function.pathinfo.atom                             16-Jul-2024 06:03                 620
function.pclose.atom                               16-Jul-2024 06:03                 597
function.pcntl-alarm.atom                          16-Jul-2024 06:03                 625
function.pcntl-async-signals.atom                  16-Jul-2024 06:03                 664
function.pcntl-errno.atom                          16-Jul-2024 06:03                 600
function.pcntl-exec.atom                           16-Jul-2024 06:03                 658
function.pcntl-fork.atom                           16-Jul-2024 06:03                 595
function.pcntl-get-last-error.atom                 16-Jul-2024 06:03                 769
function.pcntl-getpriority.atom                    16-Jul-2024 06:03                 640
function.pcntl-rfork.atom                          16-Jul-2024 06:03                 600
function.pcntl-setpriority.atom                    16-Jul-2024 06:03                 638
function.pcntl-signal-dispatch.atom                16-Jul-2024 06:03                 667
function.pcntl-signal-get-handler.atom             16-Jul-2024 06:03                 710
function.pcntl-signal.atom                         16-Jul-2024 06:03                 609
function.pcntl-sigprocmask.atom                    16-Jul-2024 06:03                 638
function.pcntl-sigtimedwait.atom                   16-Jul-2024 06:03                 650
function.pcntl-sigwaitinfo.atom                    16-Jul-2024 06:03                 605
function.pcntl-strerror.atom                       16-Jul-2024 06:03                 698
function.pcntl-unshare.atom                        16-Jul-2024 06:03                 627
function.pcntl-wait.atom                           16-Jul-2024 06:03                 621
function.pcntl-waitpid.atom                        16-Jul-2024 06:03                 646
function.pcntl-wexitstatus.atom                    16-Jul-2024 06:03                 649
function.pcntl-wifexited.atom                      16-Jul-2024 06:03                 660
function.pcntl-wifsignaled.atom                    16-Jul-2024 06:03                 677
function.pcntl-wifstopped.atom                     16-Jul-2024 06:03                 642
function.pcntl-wstopsig.atom                       16-Jul-2024 06:03                 662
function.pcntl-wtermsig.atom                       16-Jul-2024 06:03                 649
function.pfsockopen.atom                           16-Jul-2024 06:03                 625
function.pg-affected-rows.atom                     16-Jul-2024 06:03                 635
function.pg-cancel-query.atom                      16-Jul-2024 06:03                 622
function.pg-client-encoding.atom                   16-Jul-2024 06:03                 621
function.pg-close.atom                             16-Jul-2024 06:03                 594
function.pg-connect-poll.atom                      16-Jul-2024 06:03                 662
function.pg-connect.atom                           16-Jul-2024 06:03                 611
function.pg-connection-busy.atom                   16-Jul-2024 06:03                 660
function.pg-connection-reset.atom                  16-Jul-2024 06:03                 637
function.pg-connection-status.atom                 16-Jul-2024 06:03                 638
function.pg-consume-input.atom                     16-Jul-2024 06:03                 630
function.pg-convert.atom                           16-Jul-2024 06:03                 676
function.pg-copy-from.atom                         16-Jul-2024 06:03                 655
function.pg-copy-to.atom                           16-Jul-2024 06:03                 599
function.pg-dbname.atom                            16-Jul-2024 06:03                 624
function.pg-delete.atom                            16-Jul-2024 06:03                 593
function.pg-end-copy.atom                          16-Jul-2024 06:03                 609
function.pg-escape-bytea.atom                      16-Jul-2024 06:03                 657
function.pg-escape-identifier.atom                 16-Jul-2024 06:03                 674
function.pg-escape-literal.atom                    16-Jul-2024 06:03                 706
function.pg-escape-string.atom                     16-Jul-2024 06:03                 681
function.pg-execute.atom                           16-Jul-2024 06:03                 650
function.pg-fetch-all-columns.atom                 16-Jul-2024 06:03                 733
function.pg-fetch-all.atom                         16-Jul-2024 06:03                 625
function.pg-fetch-array.atom                       16-Jul-2024 06:03                 643
function.pg-fetch-assoc.atom                       16-Jul-2024 06:03                 660
function.pg-fetch-object.atom                      16-Jul-2024 06:03                 644
function.pg-fetch-result.atom                      16-Jul-2024 06:03                 633
function.pg-fetch-row.atom                         16-Jul-2024 06:03                 603
function.pg-field-is-null.atom                     16-Jul-2024 06:03                 636
function.pg-field-name.atom                        16-Jul-2024 06:03                 619
function.pg-field-num.atom                         16-Jul-2024 06:03                 622
function.pg-field-prtlen.atom                      16-Jul-2024 06:03                 621
function.pg-field-size.atom                        16-Jul-2024 06:03                 648
function.pg-field-table.atom                       16-Jul-2024 06:03                 626
function.pg-field-type-oid.atom                    16-Jul-2024 06:03                 663
function.pg-field-type.atom                        16-Jul-2024 06:03                 647
function.pg-flush.atom                             16-Jul-2024 06:03                 637
function.pg-free-result.atom                       16-Jul-2024 06:03                 619
function.pg-get-notify.atom                        16-Jul-2024 06:03                 602
function.pg-get-pid.atom                           16-Jul-2024 06:03                 625
function.pg-get-result.atom                        16-Jul-2024 06:03                 625
function.pg-host.atom                              16-Jul-2024 06:03                 596
function.pg-insert.atom                            16-Jul-2024 06:03                 608
function.pg-last-error.atom                        16-Jul-2024 06:03                 630
function.pg-last-notice.atom                       16-Jul-2024 06:03                 638
function.pg-last-oid.atom                          16-Jul-2024 06:03                 630
function.pg-lo-close.atom                          16-Jul-2024 06:03                 613
function.pg-lo-create.atom                         16-Jul-2024 06:03                 626
function.pg-lo-export.atom                         16-Jul-2024 06:03                 623
function.pg-lo-import.atom                         16-Jul-2024 06:03                 625
function.pg-lo-open.atom                           16-Jul-2024 06:03                 610
function.pg-lo-read-all.atom                       16-Jul-2024 06:03                 632
function.pg-lo-read.atom                           16-Jul-2024 06:03                 597
function.pg-lo-seek.atom                           16-Jul-2024 06:03                 618
function.pg-lo-tell.atom                           16-Jul-2024 06:03                 639
function.pg-lo-truncate.atom                       16-Jul-2024 06:03                 602
function.pg-lo-unlink.atom                         16-Jul-2024 06:03                 617
function.pg-lo-write.atom                          16-Jul-2024 06:03                 624
function.pg-meta-data.atom                         16-Jul-2024 06:03                 638
function.pg-num-fields.atom                        16-Jul-2024 06:03                 604
function.pg-num-rows.atom                          16-Jul-2024 06:03                 610
function.pg-options.atom                           16-Jul-2024 06:03                 599
function.pg-parameter-status.atom                  16-Jul-2024 06:03                 663
function.pg-pconnect.atom                          16-Jul-2024 06:03                 626
function.pg-ping.atom                              16-Jul-2024 06:03                 597
function.pg-port.atom                              16-Jul-2024 06:03                 596
function.pg-prepare.atom                           16-Jul-2024 06:03                 761
function.pg-put-line.atom                          16-Jul-2024 06:03                 620
function.pg-query-params.atom                      16-Jul-2024 06:03                 774
function.pg-query.atom                             16-Jul-2024 06:03                 613
function.pg-result-error-field.atom                16-Jul-2024 06:03                 661
function.pg-result-error.atom                      16-Jul-2024 06:03                 666
function.pg-result-seek.atom                       16-Jul-2024 06:03                 650
function.pg-result-status.atom                     16-Jul-2024 06:03                 622
function.pg-select.atom                            16-Jul-2024 06:03                 609
function.pg-send-execute.atom                      16-Jul-2024 06:03                 785
function.pg-send-prepare.atom                      16-Jul-2024 06:03                 788
function.pg-send-query-params.atom                 16-Jul-2024 06:03                 721
function.pg-send-query.atom                        16-Jul-2024 06:03                 639
function.pg-set-client-encoding.atom               16-Jul-2024 06:03                 648
function.pg-set-error-context-visibility.atom      16-Jul-2024 06:03                 782
function.pg-set-error-verbosity.atom               16-Jul-2024 06:03                 721
function.pg-socket.atom                            16-Jul-2024 06:03                 685
function.pg-trace.atom                             16-Jul-2024 06:03                 609
function.pg-transaction-status.atom                16-Jul-2024 06:03                 657
function.pg-tty.atom                               16-Jul-2024 06:03                 623
function.pg-unescape-bytea.atom                    16-Jul-2024 06:03                 653
function.pg-untrace.atom                           16-Jul-2024 06:03                 616
function.pg-update.atom                            16-Jul-2024 06:03                 600
function.pg-version.atom                           16-Jul-2024 06:03                 659
function.php-ini-loaded-file.atom                  16-Jul-2024 06:03                 679
function.php-ini-scanned-files.atom                16-Jul-2024 06:03                 718
function.php-sapi-name.atom                        16-Jul-2024 06:03                 658
function.php-strip-whitespace.atom                 16-Jul-2024 06:03                 653
function.php-uname.atom                            16-Jul-2024 06:03                 636
function.phpcredits.atom                           16-Jul-2024 06:03                 605
function.phpdbg-break-file.atom                    16-Jul-2024 06:03                 671
function.phpdbg-break-function.atom                16-Jul-2024 06:03                 708
function.phpdbg-break-method.atom                  16-Jul-2024 06:03                 712
function.phpdbg-break-next.atom                    16-Jul-2024 06:03                 657
function.phpdbg-clear.atom                         16-Jul-2024 06:03                 621
function.phpdbg-color.atom                         16-Jul-2024 06:03                 647
function.phpdbg-end-oplog.atom                     16-Jul-2024 06:03                 597
function.phpdbg-exec.atom                          16-Jul-2024 06:03                 638
function.phpdbg-get-executable.atom                16-Jul-2024 06:03                 612
function.phpdbg-prompt.atom                        16-Jul-2024 06:03                 621
function.phpdbg-start-oplog.atom                   16-Jul-2024 06:03                 603
function.phpinfo.atom                              16-Jul-2024 06:03                 621
function.phpversion.atom                           16-Jul-2024 06:03                 627
function.pi.atom                                   16-Jul-2024 06:03                 568
function.png2wbmp.atom                             16-Jul-2024 06:03                 599
function.popen.atom                                16-Jul-2024 06:03                 604
function.pos.atom                                  16-Jul-2024 06:03                 563
function.posix-access.atom                         16-Jul-2024 06:03                 644
function.posix-ctermid.atom                        16-Jul-2024 06:03                 607
function.posix-eaccess.atom                        16-Jul-2024 06:03                 610
function.posix-errno.atom                          16-Jul-2024 06:03                 600
function.posix-fpathconf.atom                      16-Jul-2024 06:03                 624
function.posix-get-last-error.atom                 16-Jul-2024 06:03                 761
function.posix-getcwd.atom                         16-Jul-2024 06:03                 610
function.posix-getegid.atom                        16-Jul-2024 06:03                 635
function.posix-geteuid.atom                        16-Jul-2024 06:03                 648
function.posix-getgid.atom                         16-Jul-2024 06:03                 624
function.posix-getgrgid.atom                       16-Jul-2024 06:03                 619
function.posix-getgrnam.atom                       16-Jul-2024 06:03                 619
function.posix-getgroups.atom                      16-Jul-2024 06:03                 639
function.posix-getlogin.atom                       16-Jul-2024 06:03                 597
function.posix-getpgid.atom                        16-Jul-2024 06:03                 618
function.posix-getpgrp.atom                        16-Jul-2024 06:03                 627
function.posix-getpid.atom                         16-Jul-2024 06:03                 622
function.posix-getppid.atom                        16-Jul-2024 06:03                 624
function.posix-getpwnam.atom                       16-Jul-2024 06:03                 624
function.posix-getpwuid.atom                       16-Jul-2024 06:03                 624
function.posix-getrlimit.atom                      16-Jul-2024 06:03                 665
function.posix-getsid.atom                         16-Jul-2024 06:03                 602
function.posix-getuid.atom                         16-Jul-2024 06:03                 635
function.posix-initgroups.atom                     16-Jul-2024 06:03                 633
function.posix-isatty.atom                         16-Jul-2024 06:03                 647
function.posix-kill.atom                           16-Jul-2024 06:03                 610
function.posix-mkfifo.atom                         16-Jul-2024 06:03                 654
function.posix-mknod.atom                          16-Jul-2024 06:03                 639
function.posix-pathconf.atom                       16-Jul-2024 06:03                 621
function.posix-setegid.atom                        16-Jul-2024 06:03                 628
function.posix-seteuid.atom                        16-Jul-2024 06:03                 665
function.posix-setgid.atom                         16-Jul-2024 06:03                 615
function.posix-setpgid.atom                        16-Jul-2024 06:03                 623
function.posix-setrlimit.atom                      16-Jul-2024 06:03                 651
function.posix-setsid.atom                         16-Jul-2024 06:03                 618
function.posix-setuid.atom                         16-Jul-2024 06:03                 620
function.posix-strerror.atom                       16-Jul-2024 06:03                 681
function.posix-sysconf.atom                        16-Jul-2024 06:03                 611
function.posix-times.atom                          16-Jul-2024 06:03                 597
function.posix-ttyname.atom                        16-Jul-2024 06:03                 614
function.posix-uname.atom                          16-Jul-2024 06:03                 608
function.pow.atom                                  16-Jul-2024 06:03                 571
function.preg-filter.atom                          16-Jul-2024 06:03                 624
function.preg-grep.atom                            16-Jul-2024 06:03                 630
function.preg-last-error-msg.atom                  16-Jul-2024 06:03                 653
function.preg-last-error.atom                      16-Jul-2024 06:03                 679
function.preg-match-all.atom                       16-Jul-2024 06:03                 610
function.preg-match.atom                           16-Jul-2024 06:03                 649
function.preg-quote.atom                           16-Jul-2024 06:03                 673
function.preg-replace-callback-array.atom          16-Jul-2024 06:03                 786
function.preg-replace-callback.atom                16-Jul-2024 06:03                 698
function.preg-replace.atom                         16-Jul-2024 06:03                 633
function.preg-split.atom                           16-Jul-2024 06:03                 633
function.prev.atom                                 16-Jul-2024 06:03                 587
function.print-r.atom                              16-Jul-2024 06:03                 610
function.print.atom                                16-Jul-2024 06:03                 606
function.printf.atom                               16-Jul-2024 06:03                 629
function.proc-close.atom                           16-Jul-2024 06:03                 607
function.proc-get-status.atom                      16-Jul-2024 06:03                 648
function.proc-nice.atom                            16-Jul-2024 06:03                 643
function.proc-open.atom                            16-Jul-2024 06:03                 669
function.proc-terminate.atom                       16-Jul-2024 06:03                 621
function.property-exists.atom                      16-Jul-2024 06:03                 682
function.ps-add-bookmark.atom                      16-Jul-2024 06:03                 629
function.ps-add-launchlink.atom                    16-Jul-2024 06:03                 637
function.ps-add-locallink.atom                     16-Jul-2024 06:03                 654
function.ps-add-note.atom                          16-Jul-2024 06:03                 616
function.ps-add-pdflink.atom                       16-Jul-2024 06:03                 652
function.ps-add-weblink.atom                       16-Jul-2024 06:03                 626
function.ps-arc.atom                               16-Jul-2024 06:03                 625
function.ps-arcn.atom                              16-Jul-2024 06:03                 618
function.ps-begin-page.atom                        16-Jul-2024 06:03                 613
function.ps-begin-pattern.atom                     16-Jul-2024 06:03                 621
function.ps-begin-template.atom                    16-Jul-2024 06:03                 636
function.ps-circle.atom                            16-Jul-2024 06:03                 582
function.ps-clip.atom                              16-Jul-2024 06:03                 594
function.ps-close-image.atom                       16-Jul-2024 06:03                 641
function.ps-close.atom                             16-Jul-2024 06:03                 590
function.ps-closepath-stroke.atom                  16-Jul-2024 06:03                 619
function.ps-closepath.atom                         16-Jul-2024 06:03                 589
function.ps-continue-text.atom                     16-Jul-2024 06:03                 634
function.ps-curveto.atom                           16-Jul-2024 06:03                 586
function.ps-delete.atom                            16-Jul-2024 06:03                 625
function.ps-end-page.atom                          16-Jul-2024 06:03                 587
function.ps-end-pattern.atom                       16-Jul-2024 06:03                 596
function.ps-end-template.atom                      16-Jul-2024 06:03                 611
function.ps-fill-stroke.atom                       16-Jul-2024 06:03                 614
function.ps-fill.atom                              16-Jul-2024 06:03                 584
function.ps-findfont.atom                          16-Jul-2024 06:03                 588
function.ps-get-buffer.atom                        16-Jul-2024 06:03                 703
function.ps-get-parameter.atom                     16-Jul-2024 06:03                 647
function.ps-get-value.atom                         16-Jul-2024 06:03                 622
function.ps-hyphenate.atom                         16-Jul-2024 06:03                 586
function.ps-include-file.atom                      16-Jul-2024 06:03                 634
function.ps-lineto.atom                            16-Jul-2024 06:03                 582
function.ps-makespotcolor.atom                     16-Jul-2024 06:03                 622
function.ps-moveto.atom                            16-Jul-2024 06:03                 586
function.ps-new.atom                               16-Jul-2024 06:03                 607
function.ps-open-file.atom                         16-Jul-2024 06:03                 615
function.ps-open-image-file.atom                   16-Jul-2024 06:03                 645
function.ps-open-image.atom                        16-Jul-2024 06:03                 611
function.ps-open-memory-image.atom                 16-Jul-2024 06:03                 678
function.ps-place-image.atom                       16-Jul-2024 06:03                 607
function.ps-rect.atom                              16-Jul-2024 06:03                 579
function.ps-restore.atom                           16-Jul-2024 06:03                 645
function.ps-rotate.atom                            16-Jul-2024 06:03                 592
function.ps-save.atom                              16-Jul-2024 06:03                 589
function.ps-scale.atom                             16-Jul-2024 06:03                 598
function.ps-set-border-color.atom                  16-Jul-2024 06:03                 645
function.ps-set-border-dash.atom                   16-Jul-2024 06:03                 654
function.ps-set-border-style.atom                  16-Jul-2024 06:03                 636
function.ps-set-info.atom                          16-Jul-2024 06:03                 628
function.ps-set-parameter.atom                     16-Jul-2024 06:03                 621
function.ps-set-text-pos.atom                      16-Jul-2024 06:03                 635
function.ps-set-value.atom                         16-Jul-2024 06:03                 596
function.ps-setcolor.atom                          16-Jul-2024 06:03                 595
function.ps-setdash.atom                           16-Jul-2024 06:03                 628
function.ps-setflat.atom                           16-Jul-2024 06:03                 602
function.ps-setfont.atom                           16-Jul-2024 06:03                 642
function.ps-setgray.atom                           16-Jul-2024 06:03                 590
function.ps-setlinecap.atom                        16-Jul-2024 06:03                 616
function.ps-setlinejoin.atom                       16-Jul-2024 06:03                 637
function.ps-setlinewidth.atom                      16-Jul-2024 06:03                 615
function.ps-setmiterlimit.atom                     16-Jul-2024 06:03                 619
function.ps-setoverprintmode.atom                  16-Jul-2024 06:03                 651
function.ps-setpolydash.atom                       16-Jul-2024 06:03                 640
function.ps-shading-pattern.atom                   16-Jul-2024 06:03                 643
function.ps-shading.atom                           16-Jul-2024 06:03                 607
function.ps-shfill.atom                            16-Jul-2024 06:03                 594
function.ps-show-boxed.atom                        16-Jul-2024 06:03                 630
function.ps-show-xy.atom                           16-Jul-2024 06:03                 636
function.ps-show-xy2.atom                          16-Jul-2024 06:03                 612
function.ps-show.atom                              16-Jul-2024 06:03                 584
function.ps-show2.atom                             16-Jul-2024 06:03                 612
function.ps-string-geometry.atom                   16-Jul-2024 06:03                 712
function.ps-stringwidth.atom                       16-Jul-2024 06:03                 674
function.ps-stroke.atom                            16-Jul-2024 06:03                 590
function.ps-symbol-name.atom                       16-Jul-2024 06:03                 634
function.ps-symbol-width.atom                      16-Jul-2024 06:03                 641
function.ps-symbol.atom                            16-Jul-2024 06:03                 591
function.ps-translate.atom                         16-Jul-2024 06:03                 594
function.pspell-add-to-personal.atom               16-Jul-2024 06:03                 643
function.pspell-add-to-session.atom                16-Jul-2024 06:03                 663
function.pspell-check.atom                         16-Jul-2024 06:03                 599
function.pspell-clear-session.atom                 16-Jul-2024 06:03                 652
function.pspell-config-create.atom                 16-Jul-2024 06:03                 679
function.pspell-config-data-dir.atom               16-Jul-2024 06:03                 673
function.pspell-config-dict-dir.atom               16-Jul-2024 06:03                 662
function.pspell-config-ignore.atom                 16-Jul-2024 06:03                 649
function.pspell-config-mode.atom                   16-Jul-2024 06:03                 620
function.pspell-config-personal.atom               16-Jul-2024 06:03                 661
function.pspell-config-repl.atom                   16-Jul-2024 06:03                 650
function.pspell-config-runtogether.atom            16-Jul-2024 06:03                 690
function.pspell-config-save-repl.atom              16-Jul-2024 06:03                 699
function.pspell-new-config.atom                    16-Jul-2024 06:03                 705
function.pspell-new-personal.atom                  16-Jul-2024 06:03                 656
function.pspell-new.atom                           16-Jul-2024 06:03                 598
function.pspell-save-wordlist.atom                 16-Jul-2024 06:03                 645
function.pspell-store-replacement.atom             16-Jul-2024 06:03                 658
function.pspell-suggest.atom                       16-Jul-2024 06:03                 631
function.putenv.atom                               16-Jul-2024 06:03                 611
function.quoted-printable-decode.atom              16-Jul-2024 06:03                 681
function.quoted-printable-encode.atom              16-Jul-2024 06:03                 685
function.quotemeta.atom                            16-Jul-2024 06:03                 624
function.rad2deg.atom                              16-Jul-2024 06:03                 601
function.radius-acct-open.atom                     16-Jul-2024 06:03                 639
function.radius-add-server.atom                    16-Jul-2024 06:03                 606
function.radius-auth-open.atom                     16-Jul-2024 06:03                 649
function.radius-close.atom                         16-Jul-2024 06:03                 620
function.radius-config.atom                        16-Jul-2024 06:03                 677
function.radius-create-request.atom                16-Jul-2024 06:03                 663
function.radius-cvt-addr.atom                      16-Jul-2024 06:03                 636
function.radius-cvt-int.atom                       16-Jul-2024 06:03                 629
function.radius-cvt-string.atom                    16-Jul-2024 06:03                 673
function.radius-demangle-mppe-key.atom             16-Jul-2024 06:03                 682
function.radius-demangle.atom                      16-Jul-2024 06:03                 624
function.radius-get-attr.atom                      16-Jul-2024 06:03                 602
function.radius-get-tagged-attr-data.atom          16-Jul-2024 06:03                 668
function.radius-get-tagged-attr-tag.atom           16-Jul-2024 06:03                 649
function.radius-get-vendor-attr.atom               16-Jul-2024 06:03                 656
function.radius-put-addr.atom                      16-Jul-2024 06:03                 630
function.radius-put-attr.atom                      16-Jul-2024 06:03                 610
function.radius-put-int.atom                       16-Jul-2024 06:03                 606
function.radius-put-string.atom                    16-Jul-2024 06:03                 650
function.radius-put-vendor-addr.atom               16-Jul-2024 06:03                 672
function.radius-put-vendor-attr.atom               16-Jul-2024 06:03                 677
function.radius-put-vendor-int.atom                16-Jul-2024 06:03                 673
function.radius-put-vendor-string.atom             16-Jul-2024 06:03                 717
function.radius-request-authenticator.atom         16-Jul-2024 06:03                 668
function.radius-salt-encrypt-attr.atom             16-Jul-2024 06:03                 649
function.radius-send-request.atom                  16-Jul-2024 06:03                 656
function.radius-server-secret.atom                 16-Jul-2024 06:03                 635
function.radius-strerror.atom                      16-Jul-2024 06:03                 616
function.rand.atom                                 16-Jul-2024 06:03                 610
function.random-bytes.atom                         16-Jul-2024 06:03                 689
function.random-int.atom                           16-Jul-2024 06:03                 728
function.range.atom                                16-Jul-2024 06:03                 641
function.rar-wrapper-cache-stats.atom              16-Jul-2024 06:03                 652
function.rawurldecode.atom                         16-Jul-2024 06:03                 616
function.rawurlencode.atom                         16-Jul-2024 06:03                 627
function.read-exif-data.atom                       16-Jul-2024 06:03                 603
function.readdir.atom                              16-Jul-2024 06:03                 595
function.readfile.atom                             16-Jul-2024 06:03                 580
function.readgzfile.atom                           16-Jul-2024 06:03                 608
function.readline-add-history.atom                 16-Jul-2024 06:03                 645
function.readline-callback-handler-install.atom    16-Jul-2024 06:03                 757
function.readline-callback-handler-remove.atom     16-Jul-2024 06:03                 675
function.readline-callback-read-char.atom          16-Jul-2024 06:03                 693
function.readline-clear-history.atom               16-Jul-2024 06:03                 628
function.readline-completion-function.atom         16-Jul-2024 06:03                 670
function.readline-info.atom                        16-Jul-2024 06:03                 631
function.readline-list-history.atom                16-Jul-2024 06:03                 624
function.readline-on-new-line.atom                 16-Jul-2024 06:03                 682
function.readline-read-history.atom                16-Jul-2024 06:03                 622
function.readline-redisplay.atom                   16-Jul-2024 06:03                 649
function.readline-write-history.atom               16-Jul-2024 06:03                 643
function.readline.atom                             16-Jul-2024 06:03                 575
function.readlink.atom                             16-Jul-2024 06:03                 606
function.realpath-cache-get.atom                   16-Jul-2024 06:03                 663
function.realpath-cache-size.atom                  16-Jul-2024 06:03                 653
function.realpath.atom                             16-Jul-2024 06:03                 597
function.recode-file.atom                          16-Jul-2024 06:03                 638
function.recode-string.atom                        16-Jul-2024 06:03                 640
function.recode.atom                               16-Jul-2024 06:03                 578
function.register-shutdown-function.atom           16-Jul-2024 06:03                 706
function.register-tick-function.atom               16-Jul-2024 06:03                 683
function.rename.atom                               16-Jul-2024 06:03                 588
function.require-once.atom                         16-Jul-2024 06:03                 586
function.require.atom                              16-Jul-2024 06:03                 566
function.reset.atom                                16-Jul-2024 06:03                 609
function.restore-error-handler.atom                16-Jul-2024 06:03                 668
function.restore-exception-handler.atom            16-Jul-2024 06:03                 686
function.restore-include-path.atom                 16-Jul-2024 06:03                 662
function.return.atom                               16-Jul-2024 06:03                 562
function.rewind.atom                               16-Jul-2024 06:03                 606
function.rewinddir.atom                            16-Jul-2024 06:03                 638
function.rmdir.atom                                16-Jul-2024 06:03                 570
function.rnp-backend-string.atom                   16-Jul-2024 06:03                 633
function.rnp-backend-version.atom                  16-Jul-2024 06:03                 639
function.rnp-decrypt.atom                          16-Jul-2024 06:03                 590
function.rnp-dump-packets-to-json.atom             16-Jul-2024 06:03                 668
function.rnp-dump-packets.atom                     16-Jul-2024 06:03                 651
function.rnp-ffi-create.atom                       16-Jul-2024 06:03                 645
function.rnp-ffi-destroy.atom                      16-Jul-2024 06:03                 649
function.rnp-ffi-set-pass-provider.atom            16-Jul-2024 06:03                 652
function.rnp-import-keys.atom                      16-Jul-2024 06:03                 670
function.rnp-import-signatures.atom                16-Jul-2024 06:03                 685
function.rnp-key-export-autocrypt.atom             16-Jul-2024 06:03                 721
function.rnp-key-export-revocation.atom            16-Jul-2024 06:03                 665
function.rnp-key-export.atom                       16-Jul-2024 06:03                 592
function.rnp-key-get-info.atom                     16-Jul-2024 06:03                 615
function.rnp-key-remove.atom                       16-Jul-2024 06:03                 608
function.rnp-key-revoke.atom                       16-Jul-2024 06:03                 648
function.rnp-list-keys.atom                        16-Jul-2024 06:03                 644
function.rnp-load-keys-from-path.atom              16-Jul-2024 06:03                 636
function.rnp-load-keys.atom                        16-Jul-2024 06:03                 602
function.rnp-locate-key.atom                       16-Jul-2024 06:03                 598
function.rnp-op-encrypt.atom                       16-Jul-2024 06:03                 595
function.rnp-op-generate-key.atom                  16-Jul-2024 06:03                 607
function.rnp-op-sign-cleartext.atom                16-Jul-2024 06:03                 677
function.rnp-op-sign-detached.atom                 16-Jul-2024 06:03                 653
function.rnp-op-sign.atom                          16-Jul-2024 06:03                 643
function.rnp-op-verify-detached.atom               16-Jul-2024 06:03                 630
function.rnp-op-verify.atom                        16-Jul-2024 06:03                 616
function.rnp-save-keys-to-path.atom                16-Jul-2024 06:03                 628
function.rnp-save-keys.atom                        16-Jul-2024 06:03                 600
function.rnp-supported-features.atom               16-Jul-2024 06:03                 641
function.rnp-version-string-full.atom              16-Jul-2024 06:03                 641
function.rnp-version-string.atom                   16-Jul-2024 06:03                 611
function.round.atom                                16-Jul-2024 06:03                 602
function.rpmaddtag.atom                            16-Jul-2024 06:03                 591
function.rpmdbinfo.atom                            16-Jul-2024 06:03                 599
function.rpmdbsearch.atom                          16-Jul-2024 06:03                 590
function.rpmgetsymlink.atom                        16-Jul-2024 06:03                 600
function.rpminfo.atom                              16-Jul-2024 06:03                 590
function.rpmvercmp.atom                            16-Jul-2024 06:03                 587
function.rrd-create.atom                           16-Jul-2024 06:03                 628
function.rrd-error.atom                            16-Jul-2024 06:03                 648
function.rrd-fetch.atom                            16-Jul-2024 06:03                 636
function.rrd-first.atom                            16-Jul-2024 06:03                 665
function.rrd-graph.atom                            16-Jul-2024 06:03                 620
function.rrd-info.atom                             16-Jul-2024 06:03                 628
function.rrd-last.atom                             16-Jul-2024 06:03                 644
function.rrd-lastupdate.atom                       16-Jul-2024 06:03                 699
function.rrd-restore.atom                          16-Jul-2024 06:03                 620
function.rrd-tune.atom                             16-Jul-2024 06:03                 657
function.rrd-update.atom                           16-Jul-2024 06:03                 624
function.rrd-version.atom                          16-Jul-2024 06:03                 667
function.rrd-xport.atom                            16-Jul-2024 06:03                 627
function.rrdc-disconnect.atom                      16-Jul-2024 06:03                 646
function.rsort.atom                                16-Jul-2024 06:03                 600
function.rtrim.atom                                16-Jul-2024 06:03                 641
function.runkit7-constant-add.atom                 16-Jul-2024 06:03                 667
function.runkit7-constant-redefine.atom            16-Jul-2024 06:03                 649
function.runkit7-constant-remove.atom              16-Jul-2024 06:03                 648
function.runkit7-function-add.atom                 16-Jul-2024 06:03                 644
function.runkit7-function-copy.atom                16-Jul-2024 06:03                 639
function.runkit7-function-redefine.atom            16-Jul-2024 06:03                 668
function.runkit7-function-remove.atom              16-Jul-2024 06:03                 635
function.runkit7-function-rename.atom              16-Jul-2024 06:03                 636
function.runkit7-import.atom                       16-Jul-2024 06:03                 670
function.runkit7-method-add.atom                   16-Jul-2024 06:03                 638
function.runkit7-method-copy.atom                  16-Jul-2024 06:03                 632
function.runkit7-method-redefine.atom              16-Jul-2024 06:03                 655
function.runkit7-method-remove.atom                16-Jul-2024 06:03                 637
function.runkit7-method-rename.atom                16-Jul-2024 06:03                 649
function.runkit7-object-id.atom                    16-Jul-2024 06:03                 638
function.runkit7-superglobals.atom                 16-Jul-2024 06:03                 657
function.runkit7-zval-inspect.atom                 16-Jul-2024 06:03                 682
function.sapi-windows-cp-conv.atom                 16-Jul-2024 06:03                 641
function.sapi-windows-cp-get.atom                  16-Jul-2024 06:03                 615
function.sapi-windows-cp-is-utf8.atom              16-Jul-2024 06:03                 657
function.sapi-windows-cp-set.atom                  16-Jul-2024 06:03                 615
function.sapi-windows-generate-ctrl-event.atom     16-Jul-2024 06:03                 670
function.sapi-windows-set-ctrl-handler.atom        16-Jul-2024 06:03                 659
function.sapi-windows-vt100-support.atom           16-Jul-2024 06:03                 718
function.scandir.atom                              16-Jul-2024 06:03                 605
function.scoutapm-get-calls.atom                   16-Jul-2024 06:03                 647
function.scoutapm-list-instrumented-functions.atom 16-Jul-2024 06:03                 686
function.seaslog-get-author.atom                   16-Jul-2024 06:03                 611
function.seaslog-get-version.atom                  16-Jul-2024 06:03                 615
function.sem-acquire.atom                          16-Jul-2024 06:03                 613
function.sem-get.atom                              16-Jul-2024 06:03                 606
function.sem-release.atom                          16-Jul-2024 06:03                 612
function.sem-remove.atom                           16-Jul-2024 06:03                 610
function.serialize.atom                            16-Jul-2024 06:03                 651
function.session-abort.atom                        16-Jul-2024 06:03                 650
function.session-cache-expire.atom                 16-Jul-2024 06:03                 700
function.session-cache-limiter.atom                16-Jul-2024 06:03                 650
function.session-commit.atom                       16-Jul-2024 06:03                 608
function.session-create-id.atom                    16-Jul-2024 06:03                 629
function.session-decode.atom                       16-Jul-2024 06:03                 651
function.session-destroy.atom                      16-Jul-2024 06:03                 613
function.session-encode.atom                       16-Jul-2024 06:03                 620
function.session-gc.atom                           16-Jul-2024 06:03                 638
function.session-get-cookie-params.atom            16-Jul-2024 06:03                 654
function.session-id.atom                           16-Jul-2024 06:03                 623
function.session-module-name.atom                  16-Jul-2024 06:03                 641
function.session-name.atom                         16-Jul-2024 06:03                 612
function.session-regenerate-id.atom                16-Jul-2024 06:03                 662
function.session-register-shutdown.atom            16-Jul-2024 06:03                 645
function.session-reset.atom                        16-Jul-2024 06:03                 650
function.session-save-path.atom                    16-Jul-2024 06:03                 643
function.session-set-cookie-params.atom            16-Jul-2024 06:03                 667
function.session-set-save-handler.atom             16-Jul-2024 06:03                 657
function.session-start.atom                        16-Jul-2024 06:03                 649
function.session-status.atom                       16-Jul-2024 06:03                 633
function.session-unset.atom                        16-Jul-2024 06:03                 635
function.session-write-close.atom                  16-Jul-2024 06:03                 665
function.set-error-handler.atom                    16-Jul-2024 06:03                 667
function.set-exception-handler.atom                16-Jul-2024 06:03                 673
function.set-file-buffer.atom                      16-Jul-2024 06:03                 615
function.set-include-path.atom                     16-Jul-2024 06:03                 649
function.set-time-limit.atom                       16-Jul-2024 06:03                 646
function.setcookie.atom                            16-Jul-2024 06:03                 581
function.setlocale.atom                            16-Jul-2024 06:03                 605
function.setrawcookie.atom                         16-Jul-2024 06:03                 620
function.settype.atom                              16-Jul-2024 06:03                 600
function.sha1-file.atom                            16-Jul-2024 06:03                 598
function.sha1.atom                                 16-Jul-2024 06:03                 618
function.shell-exec.atom                           16-Jul-2024 06:03                 678
function.shm-attach.atom                           16-Jul-2024 06:03                 645
function.shm-detach.atom                           16-Jul-2024 06:03                 638
function.shm-get-var.atom                          16-Jul-2024 06:03                 634
function.shm-has-var.atom                          16-Jul-2024 06:03                 654
function.shm-put-var.atom                          16-Jul-2024 06:03                 657
function.shm-remove-var.atom                       16-Jul-2024 06:03                 644
function.shm-remove.atom                           16-Jul-2024 06:03                 639
function.shmop-close.atom                          16-Jul-2024 06:03                 626
function.shmop-delete.atom                         16-Jul-2024 06:03                 642
function.shmop-open.atom                           16-Jul-2024 06:03                 642
function.shmop-read.atom                           16-Jul-2024 06:03                 629
function.shmop-size.atom                           16-Jul-2024 06:03                 632
function.shmop-write.atom                          16-Jul-2024 06:03                 643
function.show-source.atom                          16-Jul-2024 06:03                 594
function.shuffle.atom                              16-Jul-2024 06:03                 630
function.simdjson-decode.atom                      16-Jul-2024 06:03                 604
function.simdjson-is-valid.atom                    16-Jul-2024 06:03                 620
function.simdjson-key-count.atom                   16-Jul-2024 06:03                 628
function.simdjson-key-exists.atom                  16-Jul-2024 06:03                 662
function.simdjson-key-value.atom                   16-Jul-2024 06:03                 665
function.similar-text.atom                         16-Jul-2024 06:03                 632
function.simplexml-import-dom.atom                 16-Jul-2024 06:03                 676
function.simplexml-load-file.atom                  16-Jul-2024 06:03                 628
function.simplexml-load-string.atom                16-Jul-2024 06:03                 644
function.sin.atom                                  16-Jul-2024 06:03                 552
function.sinh.atom                                 16-Jul-2024 06:03                 568
function.sizeof.atom                               16-Jul-2024 06:03                 570
function.sleep.atom                                16-Jul-2024 06:03                 622
function.snmp-get-quick-print.atom                 16-Jul-2024 06:03                 688
function.snmp-get-valueretrieval.atom              16-Jul-2024 06:03                 697
function.snmp-read-mib.atom                        16-Jul-2024 06:03                 634
function.snmp-set-enum-print.atom                  16-Jul-2024 06:03                 753
function.snmp-set-oid-numeric-print.atom           16-Jul-2024 06:03                 651
function.snmp-set-oid-output-format.atom           16-Jul-2024 06:03                 658
function.snmp-set-quick-print.atom                 16-Jul-2024 06:03                 696
function.snmp-set-valueretrieval.atom              16-Jul-2024 06:03                 708
function.snmp2-get.atom                            16-Jul-2024 06:03                 609
function.snmp2-getnext.atom                        16-Jul-2024 06:03                 704
function.snmp2-real-walk.atom                      16-Jul-2024 06:03                 663
function.snmp2-set.atom                            16-Jul-2024 06:03                 614
function.snmp2-walk.atom                           16-Jul-2024 06:03                 635
function.snmp3-get.atom                            16-Jul-2024 06:03                 609
function.snmp3-getnext.atom                        16-Jul-2024 06:03                 679
function.snmp3-real-walk.atom                      16-Jul-2024 06:03                 663
function.snmp3-set.atom                            16-Jul-2024 06:03                 614
function.snmp3-walk.atom                           16-Jul-2024 06:03                 635
function.snmpget.atom                              16-Jul-2024 06:03                 590
function.snmpgetnext.atom                          16-Jul-2024 06:03                 672
function.snmprealwalk.atom                         16-Jul-2024 06:03                 662
function.snmpset.atom                              16-Jul-2024 06:03                 608
function.snmpwalk.atom                             16-Jul-2024 06:03                 616
function.snmpwalkoid.atom                          16-Jul-2024 06:03                 658
function.socket-accept.atom                        16-Jul-2024 06:03                 612
function.socket-addrinfo-bind.atom                 16-Jul-2024 06:03                 647
function.socket-addrinfo-connect.atom              16-Jul-2024 06:03                 659
function.socket-addrinfo-explain.atom              16-Jul-2024 06:03                 637
function.socket-addrinfo-lookup.atom               16-Jul-2024 06:03                 667
function.socket-atmark.atom                        16-Jul-2024 06:03                 625
function.socket-bind.atom                          16-Jul-2024 06:03                 604
function.socket-clear-error.atom                   16-Jul-2024 06:03                 708
function.socket-close.atom                         16-Jul-2024 06:03                 602
function.socket-cmsg-space.atom                    16-Jul-2024 06:03                 616
function.socket-connect.atom                       16-Jul-2024 06:03                 623
function.socket-create-listen.atom                 16-Jul-2024 06:03                 654
function.socket-create-pair.atom                   16-Jul-2024 06:03                 669
function.socket-create.atom                        16-Jul-2024 06:03                 602
function.socket-export-stream.atom                 16-Jul-2024 06:03                 654
function.socket-get-option.atom                    16-Jul-2024 06:03                 614
function.socket-get-status.atom                    16-Jul-2024 06:03                 618
function.socket-getopt.atom                        16-Jul-2024 06:03                 603
function.socket-getpeername.atom                   16-Jul-2024 06:03                 666
function.socket-getsockname.atom                   16-Jul-2024 06:03                 617
function.socket-import-stream.atom                 16-Jul-2024 06:03                 613
function.socket-last-error.atom                    16-Jul-2024 06:03                 677
function.socket-listen.atom                        16-Jul-2024 06:03                 611
function.socket-read.atom                          16-Jul-2024 06:03                 614
function.socket-recv.atom                          16-Jul-2024 06:03                 648
function.socket-recvfrom.atom                      16-Jul-2024 06:03                 668
function.socket-recvmsg.atom                       16-Jul-2024 06:03                 594
function.socket-select.atom                        16-Jul-2024 06:03                 706
function.socket-send.atom                          16-Jul-2024 06:03                 643
function.socket-sendmsg.atom                       16-Jul-2024 06:03                 596
function.socket-sendto.atom                        16-Jul-2024 06:03                 661
function.socket-set-block.atom                     16-Jul-2024 06:03                 616
function.socket-set-blocking.atom                  16-Jul-2024 06:03                 623
function.socket-set-nonblock.atom                  16-Jul-2024 06:03                 668
function.socket-set-option.atom                    16-Jul-2024 06:03                 618
function.socket-set-timeout.atom                   16-Jul-2024 06:03                 619
function.socket-setopt.atom                        16-Jul-2024 06:03                 603
function.socket-shutdown.atom                      16-Jul-2024 06:03                 647
function.socket-strerror.atom                      16-Jul-2024 06:03                 658
function.socket-write.atom                         16-Jul-2024 06:03                 605
function.socket-wsaprotocol-info-export.atom       16-Jul-2024 06:03                 666
function.socket-wsaprotocol-info-import.atom       16-Jul-2024 06:03                 665
function.socket-wsaprotocol-info-release.atom      16-Jul-2024 06:03                 678
function.sodium-add.atom                           16-Jul-2024 06:03                 585
function.sodium-base642bin.atom                    16-Jul-2024 06:03                 637
function.sodium-bin2base64.atom                    16-Jul-2024 06:03                 629
function.sodium-bin2hex.atom                       16-Jul-2024 06:03                 601
function.sodium-compare.atom                       16-Jul-2024 06:03                 601
function.sodium-crypto-aead-aes256gcm-decrypt.atom 16-Jul-2024 06:03                 692
function.sodium-crypto-aead-aes256gcm-encrypt.atom 16-Jul-2024 06:03                 688
function.sodium-crypto-aead-aes256gcm-is-availa..> 16-Jul-2024 06:03                 698
function.sodium-crypto-aead-aes256gcm-keygen.atom  16-Jul-2024 06:03                 676
function.sodium-crypto-aead-chacha20poly1305-de..> 16-Jul-2024 06:03                 709
function.sodium-crypto-aead-chacha20poly1305-en..> 16-Jul-2024 06:03                 715
function.sodium-crypto-aead-chacha20poly1305-ie..> 16-Jul-2024 06:03                 729
function.sodium-crypto-aead-chacha20poly1305-ie..> 16-Jul-2024 06:03                 699
function.sodium-crypto-aead-chacha20poly1305-ie..> 16-Jul-2024 06:03                 726
function.sodium-crypto-aead-chacha20poly1305-ke..> 16-Jul-2024 06:03                 704
function.sodium-crypto-aead-xchacha20poly1305-i..> 16-Jul-2024 06:03                 740
function.sodium-crypto-aead-xchacha20poly1305-i..> 16-Jul-2024 06:03                 746
function.sodium-crypto-aead-xchacha20poly1305-i..> 16-Jul-2024 06:03                 723
function.sodium-crypto-auth-keygen.atom            16-Jul-2024 06:03                 657
function.sodium-crypto-auth-verify.atom            16-Jul-2024 06:03                 659
function.sodium-crypto-auth.atom                   16-Jul-2024 06:03                 621
function.sodium-crypto-box-keypair-from-secretk..> 16-Jul-2024 06:03                 764
function.sodium-crypto-box-keypair.atom            16-Jul-2024 06:03                 674
function.sodium-crypto-box-open.atom               16-Jul-2024 06:03                 639
function.sodium-crypto-box-publickey-from-secre..> 16-Jul-2024 06:03                 706
function.sodium-crypto-box-publickey.atom          16-Jul-2024 06:03                 667
function.sodium-crypto-box-seal-open.atom          16-Jul-2024 06:03                 650
function.sodium-crypto-box-seal.atom               16-Jul-2024 06:03                 635
function.sodium-crypto-box-secretkey.atom          16-Jul-2024 06:03                 668
function.sodium-crypto-box-seed-keypair.atom       16-Jul-2024 06:03                 683
function.sodium-crypto-box.atom                    16-Jul-2024 06:03                 624
function.sodium-crypto-core-ristretto255-add.atom  16-Jul-2024 06:03                 658
function.sodium-crypto-core-ristretto255-from-h..> 16-Jul-2024 06:03                 674
function.sodium-crypto-core-ristretto255-is-val..> 16-Jul-2024 06:03                 723
function.sodium-crypto-core-ristretto255-random..> 16-Jul-2024 06:03                 674
function.sodium-crypto-core-ristretto255-scalar..> 16-Jul-2024 06:03                 683
function.sodium-crypto-core-ristretto255-scalar..> 16-Jul-2024 06:03                 746
function.sodium-crypto-core-ristretto255-scalar..> 16-Jul-2024 06:03                 695
function.sodium-crypto-core-ristretto255-scalar..> 16-Jul-2024 06:03                 689
function.sodium-crypto-core-ristretto255-scalar..> 16-Jul-2024 06:03                 695
function.sodium-crypto-core-ristretto255-scalar..> 16-Jul-2024 06:03                 695
function.sodium-crypto-core-ristretto255-scalar..> 16-Jul-2024 06:03                 695
function.sodium-crypto-core-ristretto255-scalar..> 16-Jul-2024 06:03                 688
function.sodium-crypto-core-ristretto255-sub.atom  16-Jul-2024 06:03                 663
function.sodium-crypto-generichash-final.atom      16-Jul-2024 06:03                 648
function.sodium-crypto-generichash-init.atom       16-Jul-2024 06:03                 659
function.sodium-crypto-generichash-keygen.atom     16-Jul-2024 06:03                 667
function.sodium-crypto-generichash-update.atom     16-Jul-2024 06:03                 655
function.sodium-crypto-generichash.atom            16-Jul-2024 06:03                 638
function.sodium-crypto-kdf-derive-from-key.atom    16-Jul-2024 06:03                 652
function.sodium-crypto-kdf-keygen.atom             16-Jul-2024 06:03                 658
function.sodium-crypto-kx-client-session-keys.atom 16-Jul-2024 06:03                 685
function.sodium-crypto-kx-keypair.atom             16-Jul-2024 06:03                 638
function.sodium-crypto-kx-publickey.atom           16-Jul-2024 06:03                 663
function.sodium-crypto-kx-secretkey.atom           16-Jul-2024 06:03                 664
function.sodium-crypto-kx-seed-keypair.atom        16-Jul-2024 06:03                 636
function.sodium-crypto-kx-server-session-keys.atom 16-Jul-2024 06:03                 685
function.sodium-crypto-pwhash-scryptsalsa208sha..> 16-Jul-2024 06:03                 758
function.sodium-crypto-pwhash-scryptsalsa208sha..> 16-Jul-2024 06:03                 698
function.sodium-crypto-pwhash-scryptsalsa208sha..> 16-Jul-2024 06:03                 704
function.sodium-crypto-pwhash-str-needs-rehash...> 16-Jul-2024 06:03                 694
function.sodium-crypto-pwhash-str-verify.atom      16-Jul-2024 06:03                 670
function.sodium-crypto-pwhash-str.atom             16-Jul-2024 06:03                 635
function.sodium-crypto-pwhash.atom                 16-Jul-2024 06:03                 640
function.sodium-crypto-scalarmult-base.atom        16-Jul-2024 06:03                 676
function.sodium-crypto-scalarmult-ristretto255-..> 16-Jul-2024 06:03                 707
function.sodium-crypto-scalarmult-ristretto255...> 16-Jul-2024 06:03                 673
function.sodium-crypto-scalarmult.atom             16-Jul-2024 06:03                 699
function.sodium-crypto-secretbox-keygen.atom       16-Jul-2024 06:03                 675
function.sodium-crypto-secretbox-open.atom         16-Jul-2024 06:03                 657
function.sodium-crypto-secretbox.atom              16-Jul-2024 06:03                 642
function.sodium-crypto-secretstream-xchacha20po..> 16-Jul-2024 06:03                 748
function.sodium-crypto-secretstream-xchacha20po..> 16-Jul-2024 06:03                 748
function.sodium-crypto-secretstream-xchacha20po..> 16-Jul-2024 06:03                 726
function.sodium-crypto-secretstream-xchacha20po..> 16-Jul-2024 06:03                 733
function.sodium-crypto-secretstream-xchacha20po..> 16-Jul-2024 06:03                 762
function.sodium-crypto-secretstream-xchacha20po..> 16-Jul-2024 06:03                 739
function.sodium-crypto-shorthash-keygen.atom       16-Jul-2024 06:03                 652
function.sodium-crypto-shorthash.atom              16-Jul-2024 06:03                 648
function.sodium-crypto-sign-detached.atom          16-Jul-2024 06:03                 635
function.sodium-crypto-sign-ed25519-pk-to-curve..> 16-Jul-2024 06:03                 723
function.sodium-crypto-sign-ed25519-sk-to-curve..> 16-Jul-2024 06:03                 723
function.sodium-crypto-sign-keypair-from-secret..> 16-Jul-2024 06:03                 744
function.sodium-crypto-sign-keypair.atom           16-Jul-2024 06:03                 677
function.sodium-crypto-sign-open.atom              16-Jul-2024 06:03                 658
function.sodium-crypto-sign-publickey-from-secr..> 16-Jul-2024 06:03                 717
function.sodium-crypto-sign-publickey.atom         16-Jul-2024 06:03                 667
function.sodium-crypto-sign-secretkey.atom         16-Jul-2024 06:03                 667
function.sodium-crypto-sign-seed-keypair.atom      16-Jul-2024 06:03                 686
function.sodium-crypto-sign-verify-detached.atom   16-Jul-2024 06:03                 672
function.sodium-crypto-sign.atom                   16-Jul-2024 06:03                 606
function.sodium-crypto-stream-keygen.atom          16-Jul-2024 06:03                 662
function.sodium-crypto-stream-xchacha20-keygen...> 16-Jul-2024 06:03                 676
function.sodium-crypto-stream-xchacha20-xor-ic...> 16-Jul-2024 06:03                 718
function.sodium-crypto-stream-xchacha20-xor.atom   16-Jul-2024 06:03                 709
function.sodium-crypto-stream-xchacha20.atom       16-Jul-2024 06:03                 692
function.sodium-crypto-stream-xor.atom             16-Jul-2024 06:03                 650
function.sodium-crypto-stream.atom                 16-Jul-2024 06:03                 652
function.sodium-hex2bin.atom                       16-Jul-2024 06:03                 625
function.sodium-increment.atom                     16-Jul-2024 06:03                 608
function.sodium-memcmp.atom                        16-Jul-2024 06:03                 611
function.sodium-memzero.atom                       16-Jul-2024 06:03                 618
function.sodium-pad.atom                           16-Jul-2024 06:03                 584
function.sodium-unpad.atom                         16-Jul-2024 06:03                 593
function.solr-get-version.atom                     16-Jul-2024 06:03                 670
function.sort.atom                                 16-Jul-2024 06:03                 584
function.soundex.atom                              16-Jul-2024 06:03                 592
function.spl-autoload-call.atom                    16-Jul-2024 06:03                 695
function.spl-autoload-extensions.atom              16-Jul-2024 06:03                 697
function.spl-autoload-functions.atom               16-Jul-2024 06:03                 670
function.spl-autoload-register.atom                16-Jul-2024 06:03                 682
function.spl-autoload-unregister.atom              16-Jul-2024 06:03                 693
function.spl-autoload.atom                         16-Jul-2024 06:03                 641
function.spl-classes.atom                          16-Jul-2024 06:03                 607
function.spl-object-hash.atom                      16-Jul-2024 06:03                 652
function.spl-object-id.atom                        16-Jul-2024 06:03                 652
function.sprintf.atom                              16-Jul-2024 06:03                 608
function.sqlsrv-begin-transaction.atom             16-Jul-2024 06:03                 634
function.sqlsrv-cancel.atom                        16-Jul-2024 06:03                 605
function.sqlsrv-client-info.atom                   16-Jul-2024 06:03                 690
function.sqlsrv-close.atom                         16-Jul-2024 06:03                 681
function.sqlsrv-commit.atom                        16-Jul-2024 06:03                 662
function.sqlsrv-configure.atom                     16-Jul-2024 06:03                 676
function.sqlsrv-connect.atom                       16-Jul-2024 06:03                 655
function.sqlsrv-errors.atom                        16-Jul-2024 06:03                 705
function.sqlsrv-execute.atom                       16-Jul-2024 06:03                 683
function.sqlsrv-fetch-array.atom                   16-Jul-2024 06:03                 642
function.sqlsrv-fetch-object.atom                  16-Jul-2024 06:03                 727
function.sqlsrv-fetch.atom                         16-Jul-2024 06:03                 659
function.sqlsrv-field-metadata.atom                16-Jul-2024 06:03                 808
function.sqlsrv-free-stmt.atom                     16-Jul-2024 06:03                 681
function.sqlsrv-get-config.atom                    16-Jul-2024 06:03                 659
function.sqlsrv-get-field.atom                     16-Jul-2024 06:03                 712
function.sqlsrv-has-rows.atom                      16-Jul-2024 06:03                 666
function.sqlsrv-next-result.atom                   16-Jul-2024 06:03                 690
function.sqlsrv-num-fields.atom                    16-Jul-2024 06:03                 677
function.sqlsrv-num-rows.atom                      16-Jul-2024 06:03                 671
function.sqlsrv-prepare.atom                       16-Jul-2024 06:03                 646
function.sqlsrv-query.atom                         16-Jul-2024 06:03                 636
function.sqlsrv-rollback.atom                      16-Jul-2024 06:03                 726
function.sqlsrv-rows-affected.atom                 16-Jul-2024 06:03                 729
function.sqlsrv-send-stream-data.atom              16-Jul-2024 06:03                 667
function.sqlsrv-server-info.atom                   16-Jul-2024 06:03                 632
function.sqrt.atom                                 16-Jul-2024 06:03                 574
function.srand.atom                                16-Jul-2024 06:03                 632
function.sscanf.atom                               16-Jul-2024 06:03                 626
function.ssdeep-fuzzy-compare.atom                 16-Jul-2024 06:03                 669
function.ssdeep-fuzzy-hash-filename.atom           16-Jul-2024 06:03                 665
function.ssdeep-fuzzy-hash.atom                    16-Jul-2024 06:03                 673
function.ssh2-auth-agent.atom                      16-Jul-2024 06:03                 633
function.ssh2-auth-hostbased-file.atom             16-Jul-2024 06:03                 687
function.ssh2-auth-none.atom                       16-Jul-2024 06:03                 631
function.ssh2-auth-password.atom                   16-Jul-2024 06:03                 652
function.ssh2-auth-pubkey-file.atom                16-Jul-2024 06:03                 656
function.ssh2-connect.atom                         16-Jul-2024 06:03                 611
function.ssh2-disconnect.atom                      16-Jul-2024 06:03                 638
function.ssh2-exec.atom                            16-Jul-2024 06:03                 619
function.ssh2-fetch-stream.atom                    16-Jul-2024 06:03                 645
function.ssh2-fingerprint.atom                     16-Jul-2024 06:03                 659
function.ssh2-forward-accept.atom                  16-Jul-2024 06:03                 636
function.ssh2-forward-listen.atom                  16-Jul-2024 06:03                 654
function.ssh2-methods-negotiated.atom              16-Jul-2024 06:03                 680
function.ssh2-poll.atom                            16-Jul-2024 06:03                 611
function.ssh2-publickey-add.atom                   16-Jul-2024 06:03                 647
function.ssh2-publickey-init.atom                  16-Jul-2024 06:03                 681
function.ssh2-publickey-list.atom                  16-Jul-2024 06:03                 665
function.ssh2-publickey-remove.atom                16-Jul-2024 06:03                 657
function.ssh2-scp-recv.atom                        16-Jul-2024 06:03                 603
function.ssh2-scp-send.atom                        16-Jul-2024 06:03                 602
function.ssh2-send-eof.atom                        16-Jul-2024 06:03                 595
function.ssh2-sftp-chmod.atom                      16-Jul-2024 06:03                 616
function.ssh2-sftp-lstat.atom                      16-Jul-2024 06:03                 608
function.ssh2-sftp-mkdir.atom                      16-Jul-2024 06:03                 609
function.ssh2-sftp-readlink.atom                   16-Jul-2024 06:03                 635
function.ssh2-sftp-realpath.atom                   16-Jul-2024 06:03                 659
function.ssh2-sftp-rename.atom                     16-Jul-2024 06:03                 612
function.ssh2-sftp-rmdir.atom                      16-Jul-2024 06:03                 600
function.ssh2-sftp-stat.atom                       16-Jul-2024 06:03                 643
function.ssh2-sftp-symlink.atom                    16-Jul-2024 06:03                 623
function.ssh2-sftp-unlink.atom                     16-Jul-2024 06:03                 603
function.ssh2-sftp.atom                            16-Jul-2024 06:03                 607
function.ssh2-shell.atom                           16-Jul-2024 06:03                 595
function.ssh2-tunnel.atom                          16-Jul-2024 06:03                 626
function.stat.atom                                 16-Jul-2024 06:03                 612
function.stats-absolute-deviation.atom             16-Jul-2024 06:03                 662
function.stats-cdf-beta.atom                       16-Jul-2024 06:03                 661
function.stats-cdf-binomial.atom                   16-Jul-2024 06:03                 677
function.stats-cdf-cauchy.atom                     16-Jul-2024 06:03                 669
function.stats-cdf-chisquare.atom                  16-Jul-2024 06:03                 682
function.stats-cdf-exponential.atom                16-Jul-2024 06:03                 689
function.stats-cdf-f.atom                          16-Jul-2024 06:03                 649
function.stats-cdf-gamma.atom                      16-Jul-2024 06:03                 665
function.stats-cdf-laplace.atom                    16-Jul-2024 06:03                 673
function.stats-cdf-logistic.atom                   16-Jul-2024 06:03                 677
function.stats-cdf-negative-binomial.atom          16-Jul-2024 06:03                 713
function.stats-cdf-noncentral-chisquare.atom       16-Jul-2024 06:03                 727
function.stats-cdf-noncentral-f.atom               16-Jul-2024 06:03                 694
function.stats-cdf-noncentral-t.atom               16-Jul-2024 06:03                 693
function.stats-cdf-normal.atom                     16-Jul-2024 06:03                 669
function.stats-cdf-poisson.atom                    16-Jul-2024 06:03                 673
function.stats-cdf-t.atom                          16-Jul-2024 06:03                 649
function.stats-cdf-uniform.atom                    16-Jul-2024 06:03                 673
function.stats-cdf-weibull.atom                    16-Jul-2024 06:03                 673
function.stats-covariance.atom                     16-Jul-2024 06:03                 626
function.stats-dens-beta.atom                      16-Jul-2024 06:03                 636
function.stats-dens-cauchy.atom                    16-Jul-2024 06:03                 644
function.stats-dens-chisquare.atom                 16-Jul-2024 06:03                 657
function.stats-dens-exponential.atom               16-Jul-2024 06:03                 664
function.stats-dens-f.atom                         16-Jul-2024 06:03                 624
function.stats-dens-gamma.atom                     16-Jul-2024 06:03                 640
function.stats-dens-laplace.atom                   16-Jul-2024 06:03                 648
function.stats-dens-logistic.atom                  16-Jul-2024 06:03                 652
function.stats-dens-normal.atom                    16-Jul-2024 06:03                 644
function.stats-dens-pmf-binomial.atom              16-Jul-2024 06:03                 661
function.stats-dens-pmf-hypergeometric.atom        16-Jul-2024 06:03                 685
function.stats-dens-pmf-negative-binomial.atom     16-Jul-2024 06:03                 697
function.stats-dens-pmf-poisson.atom               16-Jul-2024 06:03                 657
function.stats-dens-t.atom                         16-Jul-2024 06:03                 624
function.stats-dens-uniform.atom                   16-Jul-2024 06:03                 648
function.stats-dens-weibull.atom                   16-Jul-2024 06:03                 648
function.stats-harmonic-mean.atom                  16-Jul-2024 06:03                 642
function.stats-kurtosis.atom                       16-Jul-2024 06:03                 626
function.stats-rand-gen-beta.atom                  16-Jul-2024 06:03                 648
function.stats-rand-gen-chisquare.atom             16-Jul-2024 06:03                 669
function.stats-rand-gen-exponential.atom           16-Jul-2024 06:03                 676
function.stats-rand-gen-f.atom                     16-Jul-2024 06:03                 636
function.stats-rand-gen-funiform.atom              16-Jul-2024 06:03                 675
function.stats-rand-gen-gamma.atom                 16-Jul-2024 06:03                 652
function.stats-rand-gen-ibinomial-negative.atom    16-Jul-2024 06:03                 703
function.stats-rand-gen-ibinomial.atom             16-Jul-2024 06:03                 667
function.stats-rand-gen-int.atom                   16-Jul-2024 06:03                 641
function.stats-rand-gen-ipoisson.atom              16-Jul-2024 06:03                 668
function.stats-rand-gen-iuniform.atom              16-Jul-2024 06:03                 691
function.stats-rand-gen-noncentral-chisquare.atom  16-Jul-2024 06:03                 714
function.stats-rand-gen-noncentral-f.atom          16-Jul-2024 06:03                 680
function.stats-rand-gen-noncentral-t.atom          16-Jul-2024 06:03                 686
function.stats-rand-gen-normal.atom                16-Jul-2024 06:03                 661
function.stats-rand-gen-t.atom                     16-Jul-2024 06:03                 641
function.stats-rand-get-seeds.atom                 16-Jul-2024 06:03                 648
function.stats-rand-phrase-to-seeds.atom           16-Jul-2024 06:03                 670
function.stats-rand-ranf.atom                      16-Jul-2024 06:03                 639
function.stats-rand-setall.atom                    16-Jul-2024 06:03                 628
function.stats-skew.atom                           16-Jul-2024 06:03                 614
function.stats-standard-deviation.atom             16-Jul-2024 06:03                 640
function.stats-stat-binomial-coef.atom             16-Jul-2024 06:03                 640
function.stats-stat-correlation.atom               16-Jul-2024 06:03                 664
function.stats-stat-factorial.atom                 16-Jul-2024 06:03                 633
function.stats-stat-independent-t.atom             16-Jul-2024 06:03                 668
function.stats-stat-innerproduct.atom              16-Jul-2024 06:03                 647
function.stats-stat-paired-t.atom                  16-Jul-2024 06:03                 657
function.stats-stat-percentile.atom                16-Jul-2024 06:03                 629
function.stats-stat-powersum.atom                  16-Jul-2024 06:03                 628
function.stats-variance.atom                       16-Jul-2024 06:03                 600
function.stomp-connect-error.atom                  16-Jul-2024 06:03                 688
function.stomp-version.atom                        16-Jul-2024 06:03                 644
function.str-contains.atom                         16-Jul-2024 06:03                 671
function.str-decrement.atom                        16-Jul-2024 06:03                 670
function.str-ends-with.atom                        16-Jul-2024 06:03                 680
function.str-getcsv.atom                           16-Jul-2024 06:03                 641
function.str-increment.atom                        16-Jul-2024 06:03                 670
function.str-ireplace.atom                         16-Jul-2024 06:03                 629
function.str-pad.atom                              16-Jul-2024 06:03                 652
function.str-repeat.atom                           16-Jul-2024 06:03                 617
function.str-replace.atom                          16-Jul-2024 06:03                 628
function.str-rot13.atom                            16-Jul-2024 06:03                 598
function.str-shuffle.atom                          16-Jul-2024 06:03                 668
function.str-split.atom                            16-Jul-2024 06:03                 631
function.str-starts-with.atom                      16-Jul-2024 06:03                 684
function.str-word-count.atom                       16-Jul-2024 06:03                 650
function.strcasecmp.atom                           16-Jul-2024 06:03                 642
function.strchr.atom                               16-Jul-2024 06:03                 571
function.strcmp.atom                               16-Jul-2024 06:03                 596
function.strcoll.atom                              16-Jul-2024 06:03                 613
function.strcspn.atom                              16-Jul-2024 06:03                 644
function.stream-bucket-append.atom                 16-Jul-2024 06:03                 629
function.stream-bucket-make-writeable.atom         16-Jul-2024 06:03                 715
function.stream-bucket-new.atom                    16-Jul-2024 06:03                 669
function.stream-bucket-prepend.atom                16-Jul-2024 06:03                 648
function.stream-context-create.atom                16-Jul-2024 06:03                 636
function.stream-context-get-default.atom           16-Jul-2024 06:03                 662
function.stream-context-get-options.atom           16-Jul-2024 06:03                 676
function.stream-context-get-params.atom            16-Jul-2024 06:03                 661
function.stream-context-set-default.atom           16-Jul-2024 06:03                 668
function.stream-context-set-option.atom            16-Jul-2024 06:03                 668
function.stream-context-set-options.atom           16-Jul-2024 06:03                 653
function.stream-context-set-params.atom            16-Jul-2024 06:03                 683
function.stream-copy-to-stream.atom                16-Jul-2024 06:03                 658
function.stream-filter-append.atom                 16-Jul-2024 06:03                 652
function.stream-filter-prepend.atom                16-Jul-2024 06:03                 668
function.stream-filter-register.atom               16-Jul-2024 06:03                 632
function.stream-filter-remove.atom                 16-Jul-2024 06:03                 629
function.stream-get-contents.atom                  16-Jul-2024 06:03                 637
function.stream-get-filters.atom                   16-Jul-2024 06:03                 632
function.stream-get-line.atom                      16-Jul-2024 06:03                 609
function.stream-get-meta-data.atom                 16-Jul-2024 06:03                 671
function.stream-get-transports.atom                16-Jul-2024 06:03                 661
function.stream-get-wrappers.atom                  16-Jul-2024 06:03                 626
function.stream-is-local.atom                      16-Jul-2024 06:03                 622
function.stream-isatty.atom                        16-Jul-2024 06:03                 617
function.stream-notification-callback.atom         16-Jul-2024 06:03                 698
function.stream-register-wrapper.atom              16-Jul-2024 06:03                 639
function.stream-resolve-include-path.atom          16-Jul-2024 06:03                 711
function.stream-select.atom                        16-Jul-2024 06:03                 630
function.stream-set-blocking.atom                  16-Jul-2024 06:03                 636
function.stream-set-chunk-size.atom                16-Jul-2024 06:03                 636
function.stream-set-read-buffer.atom               16-Jul-2024 06:03                 649
function.stream-set-timeout.atom                   16-Jul-2024 06:03                 654
function.stream-set-write-buffer.atom              16-Jul-2024 06:03                 668
function.stream-socket-accept.atom                 16-Jul-2024 06:03                 685
function.stream-socket-client.atom                 16-Jul-2024 06:03                 641
function.stream-socket-enable-crypto.atom          16-Jul-2024 06:03                 710
function.stream-socket-get-name.atom               16-Jul-2024 06:03                 646
function.stream-socket-pair.atom                   16-Jul-2024 06:03                 668
function.stream-socket-recvfrom.atom               16-Jul-2024 06:03                 675
function.stream-socket-sendto.atom                 16-Jul-2024 06:03                 653
function.stream-socket-server.atom                 16-Jul-2024 06:03                 648
function.stream-socket-shutdown.atom               16-Jul-2024 06:03                 646
function.stream-supports-lock.atom                 16-Jul-2024 06:03                 637
function.stream-wrapper-register.atom              16-Jul-2024 06:03                 644
function.stream-wrapper-restore.atom               16-Jul-2024 06:03                 659
function.stream-wrapper-unregister.atom            16-Jul-2024 06:03                 648
function.strftime.atom                             16-Jul-2024 06:03                 620
function.strip-tags.atom                           16-Jul-2024 06:03                 628
function.stripcslashes.atom                        16-Jul-2024 06:03                 651
function.stripos.atom                              16-Jul-2024 06:03                 674
function.stripslashes.atom                         16-Jul-2024 06:03                 625
function.stristr.atom                              16-Jul-2024 06:03                 609
function.strlen.atom                               16-Jul-2024 06:03                 601
function.strnatcasecmp.atom                        16-Jul-2024 06:03                 708
function.strnatcmp.atom                            16-Jul-2024 06:03                 661
function.strncasecmp.atom                          16-Jul-2024 06:03                 636
function.strncmp.atom                              16-Jul-2024 06:03                 615
function.strpbrk.atom                              16-Jul-2024 06:03                 656
function.strpos.atom                               16-Jul-2024 06:03                 638
function.strptime.atom                             16-Jul-2024 06:03                 632
function.strrchr.atom                              16-Jul-2024 06:03                 656
function.strrev.atom                               16-Jul-2024 06:03                 584
function.strripos.atom                             16-Jul-2024 06:03                 727
function.strrpos.atom                              16-Jul-2024 06:03                 674
function.strspn.atom                               16-Jul-2024 06:03                 699
function.strstr.atom                               16-Jul-2024 06:03                 622
function.strtok.atom                               16-Jul-2024 06:03                 594
function.strtolower.atom                           16-Jul-2024 06:03                 610
function.strtotime.atom                            16-Jul-2024 06:03                 605
function.strtoupper.atom                           16-Jul-2024 06:03                 610
function.strtr.atom                                16-Jul-2024 06:03                 613
function.strval.atom                               16-Jul-2024 06:03                 644
function.substr-compare.atom                       16-Jul-2024 06:03                 689
function.substr-count.atom                         16-Jul-2024 06:03                 647
function.substr-replace.atom                       16-Jul-2024 06:03                 625
function.substr.atom                               16-Jul-2024 06:03                 595
function.svn-add.atom                              16-Jul-2024 06:03                 657
function.svn-auth-get-parameter.atom               16-Jul-2024 06:03                 680
function.svn-auth-set-parameter.atom               16-Jul-2024 06:03                 669
function.svn-blame.atom                            16-Jul-2024 06:03                 633
function.svn-cat.atom                              16-Jul-2024 06:03                 655
function.svn-checkout.atom                         16-Jul-2024 06:03                 646
function.svn-cleanup.atom                          16-Jul-2024 06:03                 722
function.svn-client-version.atom                   16-Jul-2024 06:03                 675
function.svn-commit.atom                           16-Jul-2024 06:03                 657
function.svn-delete.atom                           16-Jul-2024 06:03                 676
function.svn-diff.atom                             16-Jul-2024 06:03                 608
function.svn-export.atom                           16-Jul-2024 06:03                 608
function.svn-fs-abort-txn.atom                     16-Jul-2024 06:03                 613
function.svn-fs-apply-text.atom                    16-Jul-2024 06:03                 671
function.svn-fs-begin-txn2.atom                    16-Jul-2024 06:03                 629
function.svn-fs-change-node-prop.atom              16-Jul-2024 06:03                 648
function.svn-fs-check-path.atom                    16-Jul-2024 06:03                 709
function.svn-fs-contents-changed.atom              16-Jul-2024 06:03                 672
function.svn-fs-copy.atom                          16-Jul-2024 06:03                 601
function.svn-fs-delete.atom                        16-Jul-2024 06:03                 610
function.svn-fs-dir-entries.atom                   16-Jul-2024 06:03                 674
function.svn-fs-file-contents.atom                 16-Jul-2024 06:03                 721
function.svn-fs-file-length.atom                   16-Jul-2024 06:03                 675
function.svn-fs-is-dir.atom                        16-Jul-2024 06:03                 650
function.svn-fs-is-file.atom                       16-Jul-2024 06:03                 653
function.svn-fs-make-dir.atom                      16-Jul-2024 06:03                 622
function.svn-fs-make-file.atom                     16-Jul-2024 06:03                 625
function.svn-fs-node-created-rev.atom              16-Jul-2024 06:03                 731
function.svn-fs-node-prop.atom                     16-Jul-2024 06:03                 672
function.svn-fs-props-changed.atom                 16-Jul-2024 06:03                 692
function.svn-fs-revision-prop.atom                 16-Jul-2024 06:03                 699
function.svn-fs-revision-root.atom                 16-Jul-2024 06:03                 745
function.svn-fs-txn-root.atom                      16-Jul-2024 06:03                 626
function.svn-fs-youngest-rev.atom                  16-Jul-2024 06:03                 711
function.svn-import.atom                           16-Jul-2024 06:03                 652
function.svn-log.atom                              16-Jul-2024 06:03                 673
function.svn-ls.atom                               16-Jul-2024 06:03                 707
function.svn-mkdir.atom                            16-Jul-2024 06:03                 661
function.svn-repos-create.atom                     16-Jul-2024 06:03                 657
function.svn-repos-fs-begin-txn-for-commit.atom    16-Jul-2024 06:03                 677
function.svn-repos-fs-commit-txn.atom              16-Jul-2024 06:03                 672
function.svn-repos-fs.atom                         16-Jul-2024 06:03                 654
function.svn-repos-hotcopy.atom                    16-Jul-2024 06:03                 663
function.svn-repos-open.atom                       16-Jul-2024 06:03                 655
function.svn-repos-recover.atom                    16-Jul-2024 06:03                 708
function.svn-revert.atom                           16-Jul-2024 06:03                 640
function.svn-status.atom                           16-Jul-2024 06:03                 660
function.svn-update.atom                           16-Jul-2024 06:03                 609
function.swoole-async-dns-lookup.atom              16-Jul-2024 06:03                 651
function.swoole-async-read.atom                    16-Jul-2024 06:03                 620
function.swoole-async-readfile.atom                16-Jul-2024 06:03                 627
function.swoole-async-set.atom                     16-Jul-2024 06:03                 614
function.swoole-async-write.atom                   16-Jul-2024 06:03                 634
function.swoole-async-writefile.atom               16-Jul-2024 06:03                 639
function.swoole-clear-error.atom                   16-Jul-2024 06:03                 644
function.swoole-client-select.atom                 16-Jul-2024 06:03                 661
function.swoole-cpu-num.atom                       16-Jul-2024 06:03                 601
function.swoole-errno.atom                         16-Jul-2024 06:03                 618
function.swoole-error-log.atom                     16-Jul-2024 06:03                 618
function.swoole-event-add.atom                     16-Jul-2024 06:03                 643
function.swoole-event-defer.atom                   16-Jul-2024 06:03                 636
function.swoole-event-del.atom                     16-Jul-2024 06:03                 633
function.swoole-event-exit.atom                    16-Jul-2024 06:03                 642
function.swoole-event-set.atom                     16-Jul-2024 06:03                 633
function.swoole-event-wait.atom                    16-Jul-2024 06:03                 609
function.swoole-event-write.atom                   16-Jul-2024 06:03                 614
function.swoole-get-local-ip.atom                  16-Jul-2024 06:03                 647
function.swoole-last-error.atom                    16-Jul-2024 06:03                 618
function.swoole-load-module.atom                   16-Jul-2024 06:03                 615
function.swoole-select.atom                        16-Jul-2024 06:03                 661
function.swoole-set-process-name.atom              16-Jul-2024 06:03                 627
function.swoole-strerror.atom                      16-Jul-2024 06:03                 620
function.swoole-timer-after.atom                   16-Jul-2024 06:03                 642
function.swoole-timer-exists.atom                  16-Jul-2024 06:03                 640
function.swoole-timer-tick.atom                    16-Jul-2024 06:03                 644
function.swoole-version.atom                       16-Jul-2024 06:03                 605
function.symlink.atom                              16-Jul-2024 06:03                 593
function.sys-get-temp-dir.atom                     16-Jul-2024 06:03                 678
function.sys-getloadavg.atom                       16-Jul-2024 06:03                 650
function.syslog.atom                               16-Jul-2024 06:03                 637
function.system.atom                               16-Jul-2024 06:03                 629
function.taint.atom                                16-Jul-2024 06:03                 581
function.tan.atom                                  16-Jul-2024 06:03                 555
function.tanh.atom                                 16-Jul-2024 06:03                 571
function.tcpwrap-check.atom                        16-Jul-2024 06:03                 608
function.tempnam.atom                              16-Jul-2024 06:03                 604
function.textdomain.atom                           16-Jul-2024 06:03                 619
function.tidy-access-count.atom                    16-Jul-2024 06:03                 699
function.tidy-config-count.atom                    16-Jul-2024 06:03                 687
function.tidy-error-count.atom                     16-Jul-2024 06:03                 667
function.tidy-get-output.atom                      16-Jul-2024 06:03                 693
function.tidy-warning-count.atom                   16-Jul-2024 06:03                 701
function.time-nanosleep.atom                       16-Jul-2024 06:03                 637
function.time-sleep-until.atom                     16-Jul-2024 06:03                 673
function.time.atom                                 16-Jul-2024 06:03                 588
function.timezone-abbreviations-list.atom          16-Jul-2024 06:03                 659
function.timezone-identifiers-list.atom            16-Jul-2024 06:03                 651
function.timezone-location-get.atom                16-Jul-2024 06:03                 635
function.timezone-name-from-abbr.atom              16-Jul-2024 06:03                 731
function.timezone-name-get.atom                    16-Jul-2024 06:03                 619
function.timezone-offset-get.atom                  16-Jul-2024 06:03                 627
function.timezone-open.atom                        16-Jul-2024 06:03                 611
function.timezone-transitions-get.atom             16-Jul-2024 06:03                 647
function.timezone-version-get.atom                 16-Jul-2024 06:03                 629
function.tmpfile.atom                              16-Jul-2024 06:03                 596
function.token-get-all.atom                        16-Jul-2024 06:03                 640
function.token-name.atom                           16-Jul-2024 06:03                 638
function.touch.atom                                16-Jul-2024 06:03                 633
function.trader-acos.atom                          16-Jul-2024 06:03                 596
function.trader-ad.atom                            16-Jul-2024 06:03                 581
function.trader-add.atom                           16-Jul-2024 06:03                 609
function.trader-adosc.atom                         16-Jul-2024 06:03                 596
function.trader-adx.atom                           16-Jul-2024 06:03                 602
function.trader-adxr.atom                          16-Jul-2024 06:03                 612
function.trader-apo.atom                           16-Jul-2024 06:03                 593
function.trader-aroon.atom                         16-Jul-2024 06:03                 579
function.trader-aroonosc.atom                      16-Jul-2024 06:03                 599
function.trader-asin.atom                          16-Jul-2024 06:03                 596
function.trader-atan.atom                          16-Jul-2024 06:03                 598
function.trader-atr.atom                           16-Jul-2024 06:03                 586
function.trader-avgprice.atom                      16-Jul-2024 06:03                 596
function.trader-bbands.atom                        16-Jul-2024 06:03                 592
function.trader-beta.atom                          16-Jul-2024 06:03                 575
function.trader-bop.atom                           16-Jul-2024 06:03                 584
function.trader-cci.atom                           16-Jul-2024 06:03                 591
function.trader-cdl2crows.atom                     16-Jul-2024 06:03                 595
function.trader-cdl3blackcrows.atom                16-Jul-2024 06:03                 618
function.trader-cdl3inside.atom                    16-Jul-2024 06:03                 609
function.trader-cdl3linestrike.atom                16-Jul-2024 06:03                 618
function.trader-cdl3outside.atom                   16-Jul-2024 06:03                 613
function.trader-cdl3starsinsouth.atom              16-Jul-2024 06:03                 631
function.trader-cdl3whitesoldiers.atom             16-Jul-2024 06:03                 640
function.trader-cdlabandonedbaby.atom              16-Jul-2024 06:03                 621
function.trader-cdladvanceblock.atom               16-Jul-2024 06:03                 617
function.trader-cdlbelthold.atom                   16-Jul-2024 06:03                 601
function.trader-cdlbreakaway.atom                  16-Jul-2024 06:03                 604
function.trader-cdlclosingmarubozu.atom            16-Jul-2024 06:03                 629
function.trader-cdlconcealbabyswall.atom           16-Jul-2024 06:03                 639
function.trader-cdlcounterattack.atom              16-Jul-2024 06:03                 620
function.trader-cdldarkcloudcover.atom             16-Jul-2024 06:03                 626
function.trader-cdldoji.atom                       16-Jul-2024 06:03                 584
function.trader-cdldojistar.atom                   16-Jul-2024 06:03                 601
function.trader-cdldragonflydoji.atom              16-Jul-2024 06:03                 621
function.trader-cdlengulfing.atom                  16-Jul-2024 06:03                 612
function.trader-cdleveningdojistar.atom            16-Jul-2024 06:03                 630
function.trader-cdleveningstar.atom                16-Jul-2024 06:03                 613
function.trader-cdlgapsidesidewhite.atom           16-Jul-2024 06:03                 652
function.trader-cdlgravestonedoji.atom             16-Jul-2024 06:03                 625
function.trader-cdlhammer.atom                     16-Jul-2024 06:03                 592
function.trader-cdlhangingman.atom                 16-Jul-2024 06:03                 609
function.trader-cdlharami.atom                     16-Jul-2024 06:03                 600
function.trader-cdlharamicross.atom                16-Jul-2024 06:03                 621
function.trader-cdlhighwave.atom                   16-Jul-2024 06:03                 608
function.trader-cdlhikkake.atom                    16-Jul-2024 06:03                 604
function.trader-cdlhikkakemod.atom                 16-Jul-2024 06:03                 622
function.trader-cdlhomingpigeon.atom               16-Jul-2024 06:03                 617
function.trader-cdlidentical3crows.atom            16-Jul-2024 06:03                 634
function.trader-cdlinneck.atom                     16-Jul-2024 06:03                 600
function.trader-cdlinvertedhammer.atom             16-Jul-2024 06:03                 636
function.trader-cdlkicking.atom                    16-Jul-2024 06:03                 596
function.trader-cdlkickingbylength.atom            16-Jul-2024 06:03                 685
function.trader-cdlladderbottom.atom               16-Jul-2024 06:03                 636
function.trader-cdllongleggeddoji.atom             16-Jul-2024 06:03                 636
function.trader-cdllongline.atom                   16-Jul-2024 06:03                 608
function.trader-cdlmarubozu.atom                   16-Jul-2024 06:03                 600
function.trader-cdlmatchinglow.atom                16-Jul-2024 06:03                 613
function.trader-cdlmathold.atom                    16-Jul-2024 06:03                 597
function.trader-cdlmorningdojistar.atom            16-Jul-2024 06:03                 633
function.trader-cdlmorningstar.atom                16-Jul-2024 06:03                 616
function.trader-cdlonneck.atom                     16-Jul-2024 06:03                 600
function.trader-cdlpiercing.atom                   16-Jul-2024 06:03                 607
function.trader-cdlrickshawman.atom                16-Jul-2024 06:03                 613
function.trader-cdlrisefall3methods.atom           16-Jul-2024 06:03                 655
function.trader-cdlseparatinglines.atom            16-Jul-2024 06:03                 650
function.trader-cdlshootingstar.atom               16-Jul-2024 06:03                 618
function.trader-cdlshortline.atom                  16-Jul-2024 06:03                 617
function.trader-cdlspinningtop.atom                16-Jul-2024 06:03                 607
function.trader-cdlstalledpattern.atom             16-Jul-2024 06:03                 634
function.trader-cdlsticksandwich.atom              16-Jul-2024 06:03                 645
function.trader-cdltakuri.atom                     16-Jul-2024 06:03                 669
function.trader-cdltasukigap.atom                  16-Jul-2024 06:03                 607
function.trader-cdlthrusting.atom                  16-Jul-2024 06:03                 623
function.trader-cdltristar.atom                    16-Jul-2024 06:03                 603
function.trader-cdlunique3river.atom               16-Jul-2024 06:03                 618
function.trader-cdlupsidegap2crows.atom            16-Jul-2024 06:03                 647
function.trader-cdlxsidegap3methods.atom           16-Jul-2024 06:03                 689
function.trader-ceil.atom                          16-Jul-2024 06:03                 598
function.trader-cmo.atom                           16-Jul-2024 06:03                 596
function.trader-correl.atom                        16-Jul-2024 06:03                 629
function.trader-cos.atom                           16-Jul-2024 06:03                 606
function.trader-cosh.atom                          16-Jul-2024 06:03                 610
function.trader-dema.atom                          16-Jul-2024 06:03                 606
function.trader-div.atom                           16-Jul-2024 06:03                 603
function.trader-dx.atom                            16-Jul-2024 06:03                 597
function.trader-ema.atom                           16-Jul-2024 06:03                 596
function.trader-errno.atom                         16-Jul-2024 06:03                 619
function.trader-exp.atom                           16-Jul-2024 06:03                 603
function.trader-floor.atom                         16-Jul-2024 06:03                 591
function.trader-get-compat.atom                    16-Jul-2024 06:03                 655
function.trader-get-unstable-period.atom           16-Jul-2024 06:03                 698
function.trader-ht-dcperiod.atom                   16-Jul-2024 06:03                 656
function.trader-ht-dcphase.atom                    16-Jul-2024 06:03                 640
function.trader-ht-phasor.atom                     16-Jul-2024 06:03                 636
function.trader-ht-sine.atom                       16-Jul-2024 06:03                 633
function.trader-ht-trendline.atom                  16-Jul-2024 06:03                 654
function.trader-ht-trendmode.atom                  16-Jul-2024 06:03                 650
function.trader-kama.atom                          16-Jul-2024 06:03                 604
function.trader-linearreg-angle.atom               16-Jul-2024 06:03                 654
function.trader-linearreg-intercept.atom           16-Jul-2024 06:03                 673
function.trader-linearreg-slope.atom               16-Jul-2024 06:03                 654
function.trader-linearreg.atom                     16-Jul-2024 06:03                 627
function.trader-ln.atom                            16-Jul-2024 06:03                 587
function.trader-log10.atom                         16-Jul-2024 06:03                 587
function.trader-ma.atom                            16-Jul-2024 06:03                 579
function.trader-macd.atom                          16-Jul-2024 06:03                 627
function.trader-macdext.atom                       16-Jul-2024 06:03                 620
function.trader-macdfix.atom                       16-Jul-2024 06:03                 669
function.trader-mama.atom                          16-Jul-2024 06:03                 601
function.trader-mavp.atom                          16-Jul-2024 06:03                 616
function.trader-max.atom                           16-Jul-2024 06:03                 671
function.trader-maxindex.atom                      16-Jul-2024 06:03                 699
function.trader-medprice.atom                      16-Jul-2024 06:03                 605
function.trader-mfi.atom                           16-Jul-2024 06:03                 614
function.trader-midpoint.atom                      16-Jul-2024 06:03                 615
function.trader-midprice.atom                      16-Jul-2024 06:03                 619
function.trader-min.atom                           16-Jul-2024 06:03                 637
function.trader-minindex.atom                      16-Jul-2024 06:03                 676
function.trader-minmax.atom                        16-Jul-2024 06:03                 652
function.trader-minmaxindex.atom                   16-Jul-2024 06:03                 679
function.trader-minus-di.atom                      16-Jul-2024 06:03                 614
function.trader-minus-dm.atom                      16-Jul-2024 06:03                 613
function.trader-mom.atom                           16-Jul-2024 06:03                 572
function.trader-mult.atom                          16-Jul-2024 06:03                 607
function.trader-natr.atom                          16-Jul-2024 06:03                 624
function.trader-obv.atom                           16-Jul-2024 06:03                 605
function.trader-plus-di.atom                       16-Jul-2024 06:03                 611
function.trader-plus-dm.atom                       16-Jul-2024 06:03                 610
function.trader-ppo.atom                           16-Jul-2024 06:03                 602
function.trader-roc.atom                           16-Jul-2024 06:03                 613
function.trader-rocp.atom                          16-Jul-2024 06:03                 633
function.trader-rocr.atom                          16-Jul-2024 06:03                 620
function.trader-rocr100.atom                       16-Jul-2024 06:03                 665
function.trader-rsi.atom                           16-Jul-2024 06:03                 592
function.trader-sar.atom                           16-Jul-2024 06:03                 583
function.trader-sarext.atom                        16-Jul-2024 06:03                 601
function.trader-set-compat.atom                    16-Jul-2024 06:03                 643
function.trader-set-unstable-period.atom           16-Jul-2024 06:03                 666
function.trader-sin.atom                           16-Jul-2024 06:03                 606
function.trader-sinh.atom                          16-Jul-2024 06:03                 610
function.trader-sma.atom                           16-Jul-2024 06:03                 589
function.trader-sqrt.atom                          16-Jul-2024 06:03                 606
function.trader-stddev.atom                        16-Jul-2024 06:03                 606
function.trader-stoch.atom                         16-Jul-2024 06:03                 586
function.trader-stochf.atom                        16-Jul-2024 06:03                 609
function.trader-stochrsi.atom                      16-Jul-2024 06:03                 614
function.trader-sub.atom                           16-Jul-2024 06:03                 615
function.trader-sum.atom                           16-Jul-2024 06:03                 596
function.trader-t3.atom                            16-Jul-2024 06:03                 605
function.trader-tan.atom                           16-Jul-2024 06:03                 604
function.trader-tanh.atom                          16-Jul-2024 06:03                 608
function.trader-tema.atom                          16-Jul-2024 06:03                 606
function.trader-trange.atom                        16-Jul-2024 06:03                 603
function.trader-trima.atom                         16-Jul-2024 06:03                 601
function.trader-trix.atom                          16-Jul-2024 06:03                 659
function.trader-tsf.atom                           16-Jul-2024 06:03                 626
function.trader-typprice.atom                      16-Jul-2024 06:03                 601
function.trader-ultosc.atom                        16-Jul-2024 06:03                 595
function.trader-var.atom                           16-Jul-2024 06:03                 576
function.trader-wclprice.atom                      16-Jul-2024 06:03                 628
function.trader-willr.atom                         16-Jul-2024 06:03                 591
function.trader-wma.atom                           16-Jul-2024 06:03                 613
function.trait-exists.atom                         16-Jul-2024 06:03                 611
function.trigger-error.atom                        16-Jul-2024 06:03                 620
function.trim.atom                                 16-Jul-2024 06:03                 658
function.uasort.atom                               16-Jul-2024 06:03                 607
function.ucfirst.atom                              16-Jul-2024 06:03                 607
function.ucwords.atom                              16-Jul-2024 06:03                 622
function.ui-draw-text-font-fontfamilies.atom       16-Jul-2024 06:03                 682
function.ui-quit.atom                              16-Jul-2024 06:03                 578
function.ui-run.atom                               16-Jul-2024 06:03                 579
function.uksort.atom                               16-Jul-2024 06:03                 631
function.umask.atom                                16-Jul-2024 06:03                 596
function.uniqid.atom                               16-Jul-2024 06:03                 606
function.unixtojd.atom                             16-Jul-2024 06:03                 607
function.unlink.atom                               16-Jul-2024 06:03                 575
function.unpack.atom                               16-Jul-2024 06:03                 639
function.unregister-tick-function.atom             16-Jul-2024 06:03                 684
function.unserialize.atom                          16-Jul-2024 06:03                 674
function.unset.atom                                16-Jul-2024 06:03                 584
function.untaint.atom                              16-Jul-2024 06:03                 594
function.uopz-add-function.atom                    16-Jul-2024 06:03                 625
function.uopz-allow-exit.atom                      16-Jul-2024 06:03                 623
function.uopz-backup.atom                          16-Jul-2024 06:03                 594
function.uopz-compose.atom                         16-Jul-2024 06:03                 592
function.uopz-copy.atom                            16-Jul-2024 06:03                 583
function.uopz-del-function.atom                    16-Jul-2024 06:03                 632
function.uopz-delete.atom                          16-Jul-2024 06:03                 592
function.uopz-extend.atom                          16-Jul-2024 06:03                 628
function.uopz-flags.atom                           16-Jul-2024 06:03                 673
function.uopz-function.atom                        16-Jul-2024 06:03                 646
function.uopz-get-exit-status.atom                 16-Jul-2024 06:03                 631
function.uopz-get-hook.atom                        16-Jul-2024 06:03                 623
function.uopz-get-mock.atom                        16-Jul-2024 06:03                 609
function.uopz-get-property.atom                    16-Jul-2024 06:03                 629
function.uopz-get-return.atom                      16-Jul-2024 06:03                 630
function.uopz-get-static.atom                      16-Jul-2024 06:03                 638
function.uopz-implement.atom                       16-Jul-2024 06:03                 656
function.uopz-overload.atom                        16-Jul-2024 06:03                 599
function.uopz-redefine.atom                        16-Jul-2024 06:03                 611
function.uopz-rename.atom                          16-Jul-2024 06:03                 632
function.uopz-restore.atom                         16-Jul-2024 06:03                 618
function.uopz-set-hook.atom                        16-Jul-2024 06:03                 632
function.uopz-set-mock.atom                        16-Jul-2024 06:03                 618
function.uopz-set-property.atom                    16-Jul-2024 06:03                 638
function.uopz-set-return.atom                      16-Jul-2024 06:03                 630
function.uopz-set-static.atom                      16-Jul-2024 06:03                 636
function.uopz-undefine.atom                        16-Jul-2024 06:03                 599
function.uopz-unset-hook.atom                      16-Jul-2024 06:03                 632
function.uopz-unset-mock.atom                      16-Jul-2024 06:03                 608
function.uopz-unset-return.atom                    16-Jul-2024 06:03                 640
function.urldecode.atom                            16-Jul-2024 06:03                 626
function.urlencode.atom                            16-Jul-2024 06:03                 599
function.use-soap-error-handler.atom               16-Jul-2024 06:03                 652
function.user-error.atom                           16-Jul-2024 06:03                 590
function.usleep.atom                               16-Jul-2024 06:03                 630
function.usort.atom                                16-Jul-2024 06:03                 609
function.utf8-decode.atom                          16-Jul-2024 06:03                 717
function.utf8-encode.atom                          16-Jul-2024 06:03                 621
function.var-dump.atom                             16-Jul-2024 06:03                 606
function.var-export.atom                           16-Jul-2024 06:03                 655
function.var-representation.atom                   16-Jul-2024 06:03                 663
function.variant-abs.atom                          16-Jul-2024 06:03                 615
function.variant-add.atom                          16-Jul-2024 06:03                 657
function.variant-and.atom                          16-Jul-2024 06:03                 640
function.variant-cast.atom                         16-Jul-2024 06:03                 650
function.variant-cat.atom                          16-Jul-2024 06:03                 646
function.variant-cmp.atom                          16-Jul-2024 06:03                 592
function.variant-date-from-timestamp.atom          16-Jul-2024 06:03                 698
function.variant-date-to-timestamp.atom            16-Jul-2024 06:03                 674
function.variant-div.atom                          16-Jul-2024 06:03                 634
function.variant-eqv.atom                          16-Jul-2024 06:03                 631
function.variant-fix.atom                          16-Jul-2024 06:03                 649
function.variant-get-type.atom                     16-Jul-2024 06:03                 626
function.variant-idiv.atom                         16-Jul-2024 06:03                 659
function.variant-imp.atom                          16-Jul-2024 06:03                 635
function.variant-int.atom                          16-Jul-2024 06:03                 626
function.variant-mod.atom                          16-Jul-2024 06:03                 613
function.variant-mul.atom                          16-Jul-2024 06:03                 609
function.variant-neg.atom                          16-Jul-2024 06:03                 626
function.variant-not.atom                          16-Jul-2024 06:03                 641
function.variant-or.atom                           16-Jul-2024 06:03                 618
function.variant-pow.atom                          16-Jul-2024 06:03                 646
function.variant-round.atom                        16-Jul-2024 06:03                 661
function.variant-set-type.atom                     16-Jul-2024 06:03                 653
function.variant-set.atom                          16-Jul-2024 06:03                 620
function.variant-sub.atom                          16-Jul-2024 06:03                 643
function.variant-xor.atom                          16-Jul-2024 06:03                 629
function.version-compare.atom                      16-Jul-2024 06:03                 651
function.vfprintf.atom                             16-Jul-2024 06:03                 632
function.virtual.atom                              16-Jul-2024 06:03                 601
function.vprintf.atom                              16-Jul-2024 06:03                 607
function.vsprintf.atom                             16-Jul-2024 06:03                 611
function.wddx-add-vars.atom                        16-Jul-2024 06:03                 625
function.wddx-deserialize.atom                     16-Jul-2024 06:03                 634
function.wddx-packet-end.atom                      16-Jul-2024 06:03                 612
function.wddx-packet-start.atom                    16-Jul-2024 06:03                 639
function.wddx-serialize-value.atom                 16-Jul-2024 06:03                 639
function.wddx-serialize-vars.atom                  16-Jul-2024 06:03                 643
function.win32-continue-service.atom               16-Jul-2024 06:03                 638
function.win32-create-service.atom                 16-Jul-2024 06:03                 696
function.win32-delete-service.atom                 16-Jul-2024 06:03                 676
function.win32-get-last-control-message.atom       16-Jul-2024 06:03                 751
function.win32-pause-service.atom                  16-Jul-2024 06:03                 618
function.win32-query-service-status.atom           16-Jul-2024 06:03                 654
function.win32-send-custom-control.atom            16-Jul-2024 06:03                 677
function.win32-set-service-exit-code.atom          16-Jul-2024 06:03                 720
function.win32-set-service-exit-mode.atom          16-Jul-2024 06:03                 720
function.win32-set-service-status.atom             16-Jul-2024 06:03                 659
function.win32-start-service-ctrl-dispatcher.atom  16-Jul-2024 06:03                 784
function.win32-start-service.atom                  16-Jul-2024 06:03                 624
function.win32-stop-service.atom                   16-Jul-2024 06:03                 619
function.wincache-fcache-fileinfo.atom             16-Jul-2024 06:03                 690
function.wincache-fcache-meminfo.atom              16-Jul-2024 06:03                 701
function.wincache-lock.atom                        16-Jul-2024 06:03                 656
function.wincache-ocache-fileinfo.atom             16-Jul-2024 06:03                 685
function.wincache-ocache-meminfo.atom              16-Jul-2024 06:03                 670
function.wincache-refresh-if-changed.atom          16-Jul-2024 06:03                 691
function.wincache-rplist-fileinfo.atom             16-Jul-2024 06:03                 709
function.wincache-rplist-meminfo.atom              16-Jul-2024 06:03                 754
function.wincache-scache-info.atom                 16-Jul-2024 06:03                 675
function.wincache-scache-meminfo.atom              16-Jul-2024 06:03                 711
function.wincache-ucache-add.atom                  16-Jul-2024 06:03                 644
function.wincache-ucache-cas.atom                  16-Jul-2024 06:03                 674
function.wincache-ucache-clear.atom                16-Jul-2024 06:03                 670
function.wincache-ucache-dec.atom                  16-Jul-2024 06:03                 689
function.wincache-ucache-delete.atom               16-Jul-2024 06:03                 647
function.wincache-ucache-exists.atom               16-Jul-2024 06:03                 671
function.wincache-ucache-get.atom                  16-Jul-2024 06:03                 682
function.wincache-ucache-inc.atom                  16-Jul-2024 06:03                 678
function.wincache-ucache-info.atom                 16-Jul-2024 06:03                 717
function.wincache-ucache-meminfo.atom              16-Jul-2024 06:03                 717
function.wincache-ucache-set.atom                  16-Jul-2024 06:03                 724
function.wincache-unlock.atom                      16-Jul-2024 06:03                 660
function.wordwrap.atom                             16-Jul-2024 06:03                 619
function.xattr-get.atom                            16-Jul-2024 06:03                 625
function.xattr-list.atom                           16-Jul-2024 06:03                 644
function.xattr-remove.atom                         16-Jul-2024 06:03                 610
function.xattr-set.atom                            16-Jul-2024 06:03                 613
function.xattr-supported.atom                      16-Jul-2024 06:03                 680
function.xdiff-file-bdiff-size.atom                16-Jul-2024 06:03                 709
function.xdiff-file-bdiff.atom                     16-Jul-2024 06:03                 631
function.xdiff-file-bpatch.atom                    16-Jul-2024 06:03                 627
function.xdiff-file-diff-binary.atom               16-Jul-2024 06:03                 629
function.xdiff-file-diff.atom                      16-Jul-2024 06:03                 655
function.xdiff-file-merge3.atom                    16-Jul-2024 06:03                 623
function.xdiff-file-patch-binary.atom              16-Jul-2024 06:03                 633
function.xdiff-file-patch.atom                     16-Jul-2024 06:03                 634
function.xdiff-file-rabdiff.atom                   16-Jul-2024 06:03                 713
function.xdiff-string-bdiff-size.atom              16-Jul-2024 06:03                 695
function.xdiff-string-bdiff.atom                   16-Jul-2024 06:03                 646
function.xdiff-string-bpatch.atom                  16-Jul-2024 06:03                 643
function.xdiff-string-diff-binary.atom             16-Jul-2024 06:03                 637
function.xdiff-string-diff.atom                    16-Jul-2024 06:03                 670
function.xdiff-string-merge3.atom                  16-Jul-2024 06:03                 640
function.xdiff-string-patch-binary.atom            16-Jul-2024 06:03                 641
function.xdiff-string-patch.atom                   16-Jul-2024 06:03                 650
function.xdiff-string-rabdiff.atom                 16-Jul-2024 06:03                 728
function.xhprof-disable.atom                       16-Jul-2024 06:03                 606
function.xhprof-enable.atom                        16-Jul-2024 06:03                 615
function.xhprof-sample-disable.atom                16-Jul-2024 06:03                 654
function.xhprof-sample-enable.atom                 16-Jul-2024 06:03                 664
function.xml-error-string.atom                     16-Jul-2024 06:03                 638
function.xml-get-current-byte-index.atom           16-Jul-2024 06:03                 685
function.xml-get-current-column-number.atom        16-Jul-2024 06:03                 697
function.xml-get-current-line-number.atom          16-Jul-2024 06:03                 689
function.xml-get-error-code.atom                   16-Jul-2024 06:03                 661
function.xml-parse-into-struct.atom                16-Jul-2024 06:03                 626
function.xml-parse.atom                            16-Jul-2024 06:03                 611
function.xml-parser-create-ns.atom                 16-Jul-2024 06:03                 630
function.xml-parser-create.atom                    16-Jul-2024 06:03                 632
function.xml-parser-free.atom                      16-Jul-2024 06:03                 618
function.xml-parser-get-option.atom                16-Jul-2024 06:03                 640
function.xml-parser-set-option.atom                16-Jul-2024 06:03                 644
function.xml-set-character-data-handler.atom       16-Jul-2024 06:03                 682
function.xml-set-default-handler.atom              16-Jul-2024 06:03                 656
function.xml-set-element-handler.atom              16-Jul-2024 06:03                 676
function.xml-set-end-namespace-decl-handler.atom   16-Jul-2024 06:03                 691
function.xml-set-external-entity-ref-handler.atom  16-Jul-2024 06:03                 717
function.xml-set-notation-decl-handler.atom        16-Jul-2024 06:03                 667
function.xml-set-object.atom                       16-Jul-2024 06:03                 618
function.xml-set-processing-instruction-handler..> 16-Jul-2024 06:03                 711
function.xml-set-start-namespace-decl-handler.atom 16-Jul-2024 06:03                 696
function.xml-set-unparsed-entity-decl-handler.atom 16-Jul-2024 06:03                 733
function.xmlrpc-decode-request.atom                16-Jul-2024 06:03                 655
function.xmlrpc-decode.atom                        16-Jul-2024 06:03                 621
function.xmlrpc-encode-request.atom                16-Jul-2024 06:03                 664
function.xmlrpc-encode.atom                        16-Jul-2024 06:03                 637
function.xmlrpc-get-type.atom                      16-Jul-2024 06:03                 628
function.xmlrpc-is-fault.atom                      16-Jul-2024 06:03                 660
function.xmlrpc-parse-method-descriptions.atom     16-Jul-2024 06:03                 715
function.xmlrpc-server-add-introspection-data.atom 16-Jul-2024 06:03                 696
function.xmlrpc-server-call-method.atom            16-Jul-2024 06:03                 702
function.xmlrpc-server-create.atom                 16-Jul-2024 06:03                 631
function.xmlrpc-server-destroy.atom                16-Jul-2024 06:03                 637
function.xmlrpc-server-register-introspection-c..> 16-Jul-2024 06:03                 752
function.xmlrpc-server-register-method.atom        16-Jul-2024 06:03                 680
function.xmlrpc-set-type.atom                      16-Jul-2024 06:03                 659
function.yaml-emit-file.atom                       16-Jul-2024 06:03                 637
function.yaml-emit.atom                            16-Jul-2024 06:03                 634
function.yaml-parse-file.atom                      16-Jul-2024 06:03                 621
function.yaml-parse-url.atom                       16-Jul-2024 06:03                 615
function.yaml-parse.atom                           16-Jul-2024 06:03                 588
function.yaz-addinfo.atom                          16-Jul-2024 06:03                 634
function.yaz-ccl-conf.atom                         16-Jul-2024 06:03                 604
function.yaz-ccl-parse.atom                        16-Jul-2024 06:03                 605
function.yaz-close.atom                            16-Jul-2024 06:03                 588
function.yaz-connect.atom                          16-Jul-2024 06:03                 634
function.yaz-database.atom                         16-Jul-2024 06:03                 624
function.yaz-element.atom                          16-Jul-2024 06:03                 658
function.yaz-errno.atom                            16-Jul-2024 06:03                 608
function.yaz-error.atom                            16-Jul-2024 06:03                 606
function.yaz-es-result.atom                        16-Jul-2024 06:03                 644
function.yaz-es.atom                               16-Jul-2024 06:03                 630
function.yaz-get-option.atom                       16-Jul-2024 06:03                 633
function.yaz-hits.atom                             16-Jul-2024 06:03                 640
function.yaz-itemorder.atom                        16-Jul-2024 06:03                 662
function.yaz-present.atom                          16-Jul-2024 06:03                 630
function.yaz-range.atom                            16-Jul-2024 06:03                 644
function.yaz-record.atom                           16-Jul-2024 06:03                 599
function.yaz-scan-result.atom                      16-Jul-2024 06:03                 629
function.yaz-scan.atom                             16-Jul-2024 06:03                 592
function.yaz-schema.atom                           16-Jul-2024 06:03                 619
function.yaz-search.atom                           16-Jul-2024 06:03                 600
function.yaz-set-option.atom                       16-Jul-2024 06:03                 629
function.yaz-sort.atom                             16-Jul-2024 06:03                 602
function.yaz-syntax.atom                           16-Jul-2024 06:03                 620
function.yaz-wait.atom                             16-Jul-2024 06:03                 625
function.zend-thread-id.atom                       16-Jul-2024 06:03                 628
function.zend-version.atom                         16-Jul-2024 06:03                 612
function.zip-close.atom                            16-Jul-2024 06:03                 586
function.zip-entry-close.atom                      16-Jul-2024 06:03                 614
function.zip-entry-compressedsize.atom             16-Jul-2024 06:03                 679
function.zip-entry-compressionmethod.atom          16-Jul-2024 06:03                 710
function.zip-entry-filesize.atom                   16-Jul-2024 06:03                 674
function.zip-entry-name.atom                       16-Jul-2024 06:03                 624
function.zip-entry-open.atom                       16-Jul-2024 06:03                 623
function.zip-entry-read.atom                       16-Jul-2024 06:03                 628
function.zip-open.atom                             16-Jul-2024 06:03                 583
function.zip-read.atom                             16-Jul-2024 06:03                 617
function.zlib-decode.atom                          16-Jul-2024 06:03                 650
function.zlib-encode.atom                          16-Jul-2024 06:03                 655
function.zlib-get-coding-type.atom                 16-Jul-2024 06:03                 673
function.zookeeper-dispatch.atom                   16-Jul-2024 06:03                 630
functional.parallel.atom                           16-Jul-2024 06:03                1058
functions.anonymous.atom                           16-Jul-2024 06:03                 586
functions.arguments.atom                           16-Jul-2024 06:03                 593
functions.arrow.atom                               16-Jul-2024 06:03                 594
functions.first_class_callable_syntax.atom         16-Jul-2024 06:03                 668
functions.internal.atom                            16-Jul-2024 06:03                 583
functions.returning-values.atom                    16-Jul-2024 06:03                 610
functions.user-defined.atom                        16-Jul-2024 06:03                 633
functions.variable-functions.atom                  16-Jul-2024 06:03                 614
gearman.constants.atom                             16-Jul-2024 06:03                 607
gearman.examples-reverse-bg.atom                   16-Jul-2024 06:03                 592
gearman.examples-reverse-task.atom                 16-Jul-2024 06:03                 598
gearman.examples-reverse.atom                      16-Jul-2024 06:03                 601
gearman.examples.atom                              16-Jul-2024 06:03                1279
gearman.installation.atom                          16-Jul-2024 06:03                 583
gearman.requirements.atom                          16-Jul-2024 06:03                 592
gearman.resources.atom                             16-Jul-2024 06:03                 581
gearman.setup.atom                                 16-Jul-2024 06:03                1272
gearmanclient.addoptions.atom                      16-Jul-2024 06:03                 611
gearmanclient.addserver.atom                       16-Jul-2024 06:03                 627
gearmanclient.addservers.atom                      16-Jul-2024 06:03                 641
gearmanclient.addtask.atom                         16-Jul-2024 06:03                 657
gearmanclient.addtaskbackground.atom               16-Jul-2024 06:03                 715
gearmanclient.addtaskhigh.atom                     16-Jul-2024 06:03                 688
gearmanclient.addtaskhighbackground.atom           16-Jul-2024 06:03                 726
gearmanclient.addtasklow.atom                      16-Jul-2024 06:03                 686
gearmanclient.addtasklowbackground.atom            16-Jul-2024 06:03                 724
gearmanclient.addtaskstatus.atom                   16-Jul-2024 06:03                 641
gearmanclient.clearcallbacks.atom                  16-Jul-2024 06:03                 653
gearmanclient.clone.atom                           16-Jul-2024 06:03                 623
gearmanclient.construct.atom                       16-Jul-2024 06:03                 622
gearmanclient.context.atom                         16-Jul-2024 06:03                 638
gearmanclient.data.atom                            16-Jul-2024 06:03                 662
gearmanclient.do.atom                              16-Jul-2024 06:03                 660
gearmanclient.dobackground.atom                    16-Jul-2024 06:03                 654
gearmanclient.dohigh.atom                          16-Jul-2024 06:03                 644
gearmanclient.dohighbackground.atom                16-Jul-2024 06:03                 695
gearmanclient.dojobhandle.atom                     16-Jul-2024 06:03                 676
gearmanclient.dolow.atom                           16-Jul-2024 06:03                 641
gearmanclient.dolowbackground.atom                 16-Jul-2024 06:03                 692
gearmanclient.donormal.atom                        16-Jul-2024 06:03                 650
gearmanclient.dostatus.atom                        16-Jul-2024 06:03                 648
gearmanclient.echo.atom                            16-Jul-2024 06:03                 721
gearmanclient.error.atom                           16-Jul-2024 06:03                 684
gearmanclient.geterrno.atom                        16-Jul-2024 06:03                 630
gearmanclient.jobstatus.atom                       16-Jul-2024 06:03                 665
gearmanclient.ping.atom                            16-Jul-2024 06:03                 708
gearmanclient.removeoptions.atom                   16-Jul-2024 06:03                 622
gearmanclient.returncode.atom                      16-Jul-2024 06:03                 657
gearmanclient.runtasks.atom                        16-Jul-2024 06:03                 649
gearmanclient.setclientcallback.atom               16-Jul-2024 06:03                 756
gearmanclient.setcompletecallback.atom             16-Jul-2024 06:03                 710
gearmanclient.setcontext.atom                      16-Jul-2024 06:03                 636
gearmanclient.setcreatedcallback.atom              16-Jul-2024 06:03                 751
gearmanclient.setdata.atom                         16-Jul-2024 06:03                 659
gearmanclient.setdatacallback.atom                 16-Jul-2024 06:03                 749
gearmanclient.setexceptioncallback.atom            16-Jul-2024 06:03                 709
gearmanclient.setfailcallback.atom                 16-Jul-2024 06:03                 701
gearmanclient.setoptions.atom                      16-Jul-2024 06:03                 623
gearmanclient.setstatuscallback.atom               16-Jul-2024 06:03                 699
gearmanclient.settimeout.atom                      16-Jul-2024 06:03                 681
gearmanclient.setwarningcallback.atom              16-Jul-2024 06:03                 717
gearmanclient.setworkloadcallback.atom             16-Jul-2024 06:03                 757
gearmanclient.timeout.atom                         16-Jul-2024 06:03                 675
gearmanclient.wait.atom                            16-Jul-2024 06:03                 617
gearmanjob.complete.atom                           16-Jul-2024 06:03                 649
gearmanjob.construct.atom                          16-Jul-2024 06:03                 619
gearmanjob.data.atom                               16-Jul-2024 06:03                 660
gearmanjob.exception.atom                          16-Jul-2024 06:03                 666
gearmanjob.fail.atom                               16-Jul-2024 06:03                 618
gearmanjob.functionname.atom                       16-Jul-2024 06:03                 632
gearmanjob.handle.atom                             16-Jul-2024 06:03                 619
gearmanjob.returncode.atom                         16-Jul-2024 06:03                 640
gearmanjob.sendcomplete.atom                       16-Jul-2024 06:03                 637
gearmanjob.senddata.atom                           16-Jul-2024 06:03                 650
gearmanjob.sendexception.atom                      16-Jul-2024 06:03                 656
gearmanjob.sendfail.atom                           16-Jul-2024 06:03                 608
gearmanjob.sendstatus.atom                         16-Jul-2024 06:03                 590
gearmanjob.sendwarning.atom                        16-Jul-2024 06:03                 594
gearmanjob.setreturn.atom                          16-Jul-2024 06:03                 610
gearmanjob.status.atom                             16-Jul-2024 06:03                 600
gearmanjob.unique.atom                             16-Jul-2024 06:03                 618
gearmanjob.warning.atom                            16-Jul-2024 06:03                 604
gearmanjob.workload.atom                           16-Jul-2024 06:03                 619
gearmanjob.workloadsize.atom                       16-Jul-2024 06:03                 644
gearmantask.construct.atom                         16-Jul-2024 06:03                 614
gearmantask.create.atom                            16-Jul-2024 06:03                 622
gearmantask.data.atom                              16-Jul-2024 06:03                 658
gearmantask.datasize.atom                          16-Jul-2024 06:03                 656
gearmantask.function.atom                          16-Jul-2024 06:03                 665
gearmantask.functionname.atom                      16-Jul-2024 06:03                 655
gearmantask.isknown.atom                           16-Jul-2024 06:03                 620
gearmantask.isrunning.atom                         16-Jul-2024 06:03                 649
gearmantask.jobhandle.atom                         16-Jul-2024 06:03                 631
gearmantask.recvdata.atom                          16-Jul-2024 06:03                 672
gearmantask.returncode.atom                        16-Jul-2024 06:03                 643
gearmantask.senddata.atom                          16-Jul-2024 06:03                 647
gearmantask.sendworkload.atom                      16-Jul-2024 06:03                 637
gearmantask.taskdenominator.atom                   16-Jul-2024 06:03                 683
gearmantask.tasknumerator.atom                     16-Jul-2024 06:03                 675
gearmantask.unique.atom                            16-Jul-2024 06:03                 643
gearmantask.uuid.atom                              16-Jul-2024 06:03                 662
gearmanworker.addfunction.atom                     16-Jul-2024 06:03                 629
gearmanworker.addoptions.atom                      16-Jul-2024 06:03                 626
gearmanworker.addserver.atom                       16-Jul-2024 06:03                 608
gearmanworker.addservers.atom                      16-Jul-2024 06:03                 619
gearmanworker.clone.atom                           16-Jul-2024 06:03                 609
gearmanworker.construct.atom                       16-Jul-2024 06:03                 622
gearmanworker.echo.atom                            16-Jul-2024 06:03                 620
gearmanworker.error.atom                           16-Jul-2024 06:03                 637
gearmanworker.geterrno.atom                        16-Jul-2024 06:03                 616
gearmanworker.options.atom                         16-Jul-2024 06:03                 632
gearmanworker.register.atom                        16-Jul-2024 06:03                 626
gearmanworker.removeoptions.atom                   16-Jul-2024 06:03                 628
gearmanworker.returncode.atom                      16-Jul-2024 06:03                 657
gearmanworker.setid.atom                           16-Jul-2024 06:03                 611
gearmanworker.setoptions.atom                      16-Jul-2024 06:03                 629
gearmanworker.settimeout.atom                      16-Jul-2024 06:03                 685
gearmanworker.timeout.atom                         16-Jul-2024 06:03                 683
gearmanworker.unregister.atom                      16-Jul-2024 06:03                 628
gearmanworker.unregisterall.atom                   16-Jul-2024 06:03                 645
gearmanworker.wait.atom                            16-Jul-2024 06:03                 639
gearmanworker.work.atom                            16-Jul-2024 06:03                 604
gender-gender.connect.atom                         16-Jul-2024 06:03                 620
gender-gender.construct.atom                       16-Jul-2024 06:03                 605
gender-gender.country.atom                         16-Jul-2024 06:03                 658
gender-gender.get.atom                             16-Jul-2024 06:03                 628
gender-gender.isnick.atom                          16-Jul-2024 06:03                 620
gender-gender.similarnames.atom                    16-Jul-2024 06:03                 639
gender.example.admin.atom                          16-Jul-2024 06:03                 597
gender.examples.atom                               16-Jul-2024 06:03                 803
gender.installation.atom                           16-Jul-2024 06:03                 580
gender.setup.atom                                  16-Jul-2024 06:03                 801
generator.current.atom                             16-Jul-2024 06:03                 630
generator.getreturn.atom                           16-Jul-2024 06:03                 638
generator.key.atom                                 16-Jul-2024 06:03                 626
generator.next.atom                                16-Jul-2024 06:03                 624
generator.rewind.atom                              16-Jul-2024 06:03                 611
generator.send.atom                                16-Jul-2024 06:03                 605
generator.throw.atom                               16-Jul-2024 06:03                 616
generator.valid.atom                               16-Jul-2024 06:03                 650
generator.wakeup.atom                              16-Jul-2024 06:03                 605
geoip.configuration.atom                           16-Jul-2024 06:03                 622
geoip.constants.atom                               16-Jul-2024 06:03                 601
geoip.installation.atom                            16-Jul-2024 06:03                 577
geoip.requirements.atom                            16-Jul-2024 06:03                 586
geoip.resources.atom                               16-Jul-2024 06:03                 575
geoip.setup.atom                                   16-Jul-2024 06:03                1511
gettext.installation.atom                          16-Jul-2024 06:03                 583
gettext.requirements.atom                          16-Jul-2024 06:03                 592
gettext.resources.atom                             16-Jul-2024 06:03                 581
gettext.setup.atom                                 16-Jul-2024 06:03                1272
getting-started.atom                               16-Jul-2024 06:03                1015
globiterator.construct.atom                        16-Jul-2024 06:03                 623
globiterator.count.atom                            16-Jul-2024 06:03                 602
gmagick.addimage.atom                              16-Jul-2024 06:03                 641
gmagick.addnoiseimage.atom                         16-Jul-2024 06:03                 632
gmagick.annotateimage.atom                         16-Jul-2024 06:03                 604
gmagick.blurimage.atom                             16-Jul-2024 06:03                 609
gmagick.borderimage.atom                           16-Jul-2024 06:03                 612
gmagick.charcoalimage.atom                         16-Jul-2024 06:03                 600
gmagick.chopimage.atom                             16-Jul-2024 06:03                 608
gmagick.clear.atom                                 16-Jul-2024 06:03                 633
gmagick.commentimage.atom                          16-Jul-2024 06:03                 618
gmagick.compositeimage.atom                        16-Jul-2024 06:03                 594
gmagick.constants.atom                             16-Jul-2024 06:03                 607
gmagick.construct.atom                             16-Jul-2024 06:03                 585
gmagick.cropimage.atom                             16-Jul-2024 06:03                 598
gmagick.cropthumbnailimage.atom                    16-Jul-2024 06:03                 638
gmagick.current.atom                               16-Jul-2024 06:03                 576
gmagick.cyclecolormapimage.atom                    16-Jul-2024 06:03                 646
gmagick.deconstructimages.atom                     16-Jul-2024 06:03                 644
gmagick.despeckleimage.atom                        16-Jul-2024 06:03                 601
gmagick.destroy.atom                               16-Jul-2024 06:03                 595
gmagick.drawimage.atom                             16-Jul-2024 06:03                 629
gmagick.edgeimage.atom                             16-Jul-2024 06:03                 629
gmagick.embossimage.atom                           16-Jul-2024 06:03                 644
gmagick.enhanceimage.atom                          16-Jul-2024 06:03                 648
gmagick.equalizeimage.atom                         16-Jul-2024 06:03                 627
gmagick.examples.atom                              16-Jul-2024 06:03                 567
gmagick.flipimage.atom                             16-Jul-2024 06:03                 604
gmagick.flopimage.atom                             16-Jul-2024 06:03                 606
gmagick.frameimage.atom                            16-Jul-2024 06:03                 611
gmagick.gammaimage.atom                            16-Jul-2024 06:03                 598
gmagick.getcopyright.atom                          16-Jul-2024 06:03                 621
gmagick.getfilename.atom                           16-Jul-2024 06:03                 655
gmagick.getimagebackgroundcolor.atom               16-Jul-2024 06:03                 670
gmagick.getimageblueprimary.atom                   16-Jul-2024 06:03                 635
gmagick.getimagebordercolor.atom                   16-Jul-2024 06:03                 635
gmagick.getimagechanneldepth.atom                  16-Jul-2024 06:03                 683
gmagick.getimagecolors.atom                        16-Jul-2024 06:03                 670
gmagick.getimagecolorspace.atom                    16-Jul-2024 06:03                 675
gmagick.getimagecompose.atom                       16-Jul-2024 06:03                 668
gmagick.getimagedelay.atom                         16-Jul-2024 06:03                 640
gmagick.getimagedepth.atom                         16-Jul-2024 06:03                 634
gmagick.getimagedispose.atom                       16-Jul-2024 06:03                 663
gmagick.getimageextrema.atom                       16-Jul-2024 06:03                 663
gmagick.getimagefilename.atom                      16-Jul-2024 06:03                 704
gmagick.getimageformat.atom                        16-Jul-2024 06:03                 690
gmagick.getimagegamma.atom                         16-Jul-2024 06:03                 629
gmagick.getimagegreenprimary.atom                  16-Jul-2024 06:03                 660
gmagick.getimageheight.atom                        16-Jul-2024 06:03                 634
gmagick.getimagehistogram.atom                     16-Jul-2024 06:03                 651
gmagick.getimageindex.atom                         16-Jul-2024 06:03                 650
gmagick.getimageinterlacescheme.atom               16-Jul-2024 06:03                 692
gmagick.getimageiterations.atom                    16-Jul-2024 06:03                 661
gmagick.getimagematte.atom                         16-Jul-2024 06:03                 624
gmagick.getimagemattecolor.atom                    16-Jul-2024 06:03                 651
gmagick.getimageprofile.atom                       16-Jul-2024 06:03                 644
gmagick.getimageredprimary.atom                    16-Jul-2024 06:03                 655
gmagick.getimagerenderingintent.atom               16-Jul-2024 06:03                 656
gmagick.getimageresolution.atom                    16-Jul-2024 06:03                 660
gmagick.getimagescene.atom                         16-Jul-2024 06:03                 640
gmagick.getimagesignature.atom                     16-Jul-2024 06:03                 651
gmagick.getimagetype.atom                          16-Jul-2024 06:03                 636
gmagick.getimageunits.atom                         16-Jul-2024 06:03                 693
gmagick.getimagewhitepoint.atom                    16-Jul-2024 06:03                 646
gmagick.getimagewidth.atom                         16-Jul-2024 06:03                 631
gmagick.getpackagename.atom                        16-Jul-2024 06:03                 639
gmagick.getquantumdepth.atom                       16-Jul-2024 06:03                 643
gmagick.getreleasedate.atom                        16-Jul-2024 06:03                 666
gmagick.getsamplingfactors.atom                    16-Jul-2024 06:03                 687
gmagick.getsize.atom                               16-Jul-2024 06:03                 642
gmagick.getversion.atom                            16-Jul-2024 06:03                 635
gmagick.hasnextimage.atom                          16-Jul-2024 06:03                 639
gmagick.haspreviousimage.atom                      16-Jul-2024 06:03                 669
gmagick.implodeimage.atom                          16-Jul-2024 06:03                 633
gmagick.installation.atom                          16-Jul-2024 06:03                 583
gmagick.labelimage.atom                            16-Jul-2024 06:03                 616
gmagick.levelimage.atom                            16-Jul-2024 06:03                 600
gmagick.magnifyimage.atom                          16-Jul-2024 06:03                 625
gmagick.mapimage.atom                              16-Jul-2024 06:03                 684
gmagick.medianfilterimage.atom                     16-Jul-2024 06:03                 612
gmagick.minifyimage.atom                           16-Jul-2024 06:03                 643
gmagick.modulateimage.atom                         16-Jul-2024 06:03                 645
gmagick.motionblurimage.atom                       16-Jul-2024 06:03                 615
gmagick.newimage.atom                              16-Jul-2024 06:03                 593
gmagick.nextimage.atom                             16-Jul-2024 06:03                 609
gmagick.normalizeimage.atom                        16-Jul-2024 06:03                 639
gmagick.oilpaintimage.atom                         16-Jul-2024 06:03                 619
gmagick.previousimage.atom                         16-Jul-2024 06:03                 662
gmagick.profileimage.atom                          16-Jul-2024 06:03                 617
gmagick.quantizeimage.atom                         16-Jul-2024 06:03                 646
gmagick.quantizeimages.atom                        16-Jul-2024 06:03                 601
gmagick.queryfontmetrics.atom                      16-Jul-2024 06:03                 689
gmagick.queryfonts.atom                            16-Jul-2024 06:03                 633
gmagick.queryformats.atom                          16-Jul-2024 06:03                 624
gmagick.radialblurimage.atom                       16-Jul-2024 06:03                 615
gmagick.raiseimage.atom                            16-Jul-2024 06:03                 610
gmagick.read.atom                                  16-Jul-2024 06:03                 578
gmagick.readimage.atom                             16-Jul-2024 06:03                 593
gmagick.readimageblob.atom                         16-Jul-2024 06:03                 623
gmagick.readimagefile.atom                         16-Jul-2024 06:03                 597
gmagick.reducenoiseimage.atom                      16-Jul-2024 06:03                 617
gmagick.removeimage.atom                           16-Jul-2024 06:03                 613
gmagick.removeimageprofile.atom                    16-Jul-2024 06:03                 640
gmagick.requirements.atom                          16-Jul-2024 06:03                 592
gmagick.resampleimage.atom                         16-Jul-2024 06:03                 679
gmagick.resizeimage.atom                           16-Jul-2024 06:03                 591
gmagick.rollimage.atom                             16-Jul-2024 06:03                 584
gmagick.rotateimage.atom                           16-Jul-2024 06:03                 605
gmagick.scaleimage.atom                            16-Jul-2024 06:03                 617
gmagick.separateimagechannel.atom                  16-Jul-2024 06:03                 638
gmagick.setcompressionquality.atom                 16-Jul-2024 06:03                 691
gmagick.setfilename.atom                           16-Jul-2024 06:03                 668
gmagick.setimagebackgroundcolor.atom               16-Jul-2024 06:03                 680
gmagick.setimageblueprimary.atom                   16-Jul-2024 06:03                 661
gmagick.setimagebordercolor.atom                   16-Jul-2024 06:03                 651
gmagick.setimagechanneldepth.atom                  16-Jul-2024 06:03                 671
gmagick.setimagecolorspace.atom                    16-Jul-2024 06:03                 649
gmagick.setimagecompose.atom                       16-Jul-2024 06:03                 657
gmagick.setimagedelay.atom                         16-Jul-2024 06:03                 628
gmagick.setimagedepth.atom                         16-Jul-2024 06:03                 622
gmagick.setimagedispose.atom                       16-Jul-2024 06:03                 651
gmagick.setimagefilename.atom                      16-Jul-2024 06:03                 689
gmagick.setimageformat.atom                        16-Jul-2024 06:03                 622
gmagick.setimagegamma.atom                         16-Jul-2024 06:03                 617
gmagick.setimagegreenprimary.atom                  16-Jul-2024 06:03                 665
gmagick.setimageindex.atom                         16-Jul-2024 06:03                 740
gmagick.setimageinterlacescheme.atom               16-Jul-2024 06:03                 680
gmagick.setimageiterations.atom                    16-Jul-2024 06:03                 649
gmagick.setimageprofile.atom                       16-Jul-2024 06:03                 648
gmagick.setimageredprimary.atom                    16-Jul-2024 06:03                 660
gmagick.setimagerenderingintent.atom               16-Jul-2024 06:03                 644
gmagick.setimageresolution.atom                    16-Jul-2024 06:03                 648
gmagick.setimagescene.atom                         16-Jul-2024 06:03                 625
gmagick.setimagetype.atom                          16-Jul-2024 06:03                 613
gmagick.setimageunits.atom                         16-Jul-2024 06:03                 682
gmagick.setimagewhitepoint.atom                    16-Jul-2024 06:03                 660
gmagick.setsamplingfactors.atom                    16-Jul-2024 06:03                 670
gmagick.setsize.atom                               16-Jul-2024 06:03                 608
gmagick.setup.atom                                 16-Jul-2024 06:03                1041
gmagick.shearimage.atom                            16-Jul-2024 06:03                 610
gmagick.solarizeimage.atom                         16-Jul-2024 06:03                 633
gmagick.spreadimage.atom                           16-Jul-2024 06:03                 639
gmagick.stripimage.atom                            16-Jul-2024 06:03                 633
gmagick.swirlimage.atom                            16-Jul-2024 06:03                 608
gmagick.thumbnailimage.atom                        16-Jul-2024 06:03                 611
gmagick.trimimage.atom                             16-Jul-2024 06:03                 596
gmagick.write.atom                                 16-Jul-2024 06:03                 578
gmagick.writeimage.atom                            16-Jul-2024 06:03                 607
gmagickdraw.annotate.atom                          16-Jul-2024 06:03                 604
gmagickdraw.arc.atom                               16-Jul-2024 06:03                 570
gmagickdraw.bezier.atom                            16-Jul-2024 06:03                 604
gmagickdraw.ellipse.atom                           16-Jul-2024 06:03                 604
gmagickdraw.getfillcolor.atom                      16-Jul-2024 06:03                 617
gmagickdraw.getfillopacity.atom                    16-Jul-2024 06:03                 665
gmagickdraw.getfont.atom                           16-Jul-2024 06:03                 611
gmagickdraw.getfontsize.atom                       16-Jul-2024 06:03                 650
gmagickdraw.getfontstyle.atom                      16-Jul-2024 06:03                 638
gmagickdraw.getfontweight.atom                     16-Jul-2024 06:03                 641
gmagickdraw.getstrokecolor.atom                    16-Jul-2024 06:03                 669
gmagickdraw.getstrokeopacity.atom                  16-Jul-2024 06:03                 678
gmagickdraw.getstrokewidth.atom                    16-Jul-2024 06:03                 662
gmagickdraw.gettextdecoration.atom                 16-Jul-2024 06:03                 640
gmagickdraw.gettextencoding.atom                   16-Jul-2024 06:03                 683
gmagickdraw.line.atom                              16-Jul-2024 06:03                 574
gmagickdraw.point.atom                             16-Jul-2024 06:03                 578
gmagickdraw.polygon.atom                           16-Jul-2024 06:03                 587
gmagickdraw.polyline.atom                          16-Jul-2024 06:03                 592
gmagickdraw.rectangle.atom                         16-Jul-2024 06:03                 594
gmagickdraw.rotate.atom                            16-Jul-2024 06:03                 586
gmagickdraw.roundrectangle.atom                    16-Jul-2024 06:03                 617
gmagickdraw.scale.atom                             16-Jul-2024 06:03                 605
gmagickdraw.setfillcolor.atom                      16-Jul-2024 06:03                 681
gmagickdraw.setfillopacity.atom                    16-Jul-2024 06:03                 635
gmagickdraw.setfont.atom                           16-Jul-2024 06:03                 669
gmagickdraw.setfontsize.atom                       16-Jul-2024 06:03                 704
gmagickdraw.setfontstyle.atom                      16-Jul-2024 06:03                 694
gmagickdraw.setfontweight.atom                     16-Jul-2024 06:03                 651
gmagickdraw.setstrokecolor.atom                    16-Jul-2024 06:03                 681
gmagickdraw.setstrokeopacity.atom                  16-Jul-2024 06:03                 674
gmagickdraw.setstrokewidth.atom                    16-Jul-2024 06:03                 647
gmagickdraw.settextdecoration.atom                 16-Jul-2024 06:03                 643
gmagickdraw.settextencoding.atom                   16-Jul-2024 06:03                 673
gmagickpixel.construct.atom                        16-Jul-2024 06:03                 605
gmagickpixel.getcolor.atom                         16-Jul-2024 06:03                 593
gmagickpixel.getcolorcount.atom                    16-Jul-2024 06:03                 659
gmagickpixel.getcolorvalue.atom                    16-Jul-2024 06:03                 682
gmagickpixel.setcolor.atom                         16-Jul-2024 06:03                 603
gmagickpixel.setcolorvalue.atom                    16-Jul-2024 06:03                 660
gmp.constants.atom                                 16-Jul-2024 06:03                 595
gmp.construct.atom                                 16-Jul-2024 06:03                 579
gmp.examples.atom                                  16-Jul-2024 06:03                 555
gmp.installation.atom                              16-Jul-2024 06:03                 571
gmp.requirements.atom                              16-Jul-2024 06:03                 580
gmp.serialize.atom                                 16-Jul-2024 06:03                 587
gmp.setup.atom                                     16-Jul-2024 06:03                1013
gmp.unserialize.atom                               16-Jul-2024 06:03                 634
gnupg.constants.atom                               16-Jul-2024 06:03                 601
gnupg.examples-clearsign.atom                      16-Jul-2024 06:03                 606
gnupg.examples.atom                                16-Jul-2024 06:03                 810
gnupg.installation.atom                            16-Jul-2024 06:03                 577
gnupg.requirements.atom                            16-Jul-2024 06:03                 586
gnupg.resources.atom                               16-Jul-2024 06:03                 575
gnupg.setup.atom                                   16-Jul-2024 06:03                1254
hash.constants.atom                                16-Jul-2024 06:03                 598
hash.installation.atom                             16-Jul-2024 06:03                 574
hash.resources.atom                                16-Jul-2024 06:03                 572
hash.setup.atom                                    16-Jul-2024 06:03                1016
hashcontext.construct.atom                         16-Jul-2024 06:03                 647
hashcontext.serialize.atom                         16-Jul-2024 06:03                 619
hashcontext.unserialize.atom                       16-Jul-2024 06:03                 666
history.atom                                       16-Jul-2024 06:03                1514
history.php.atom                                   16-Jul-2024 06:03                 559
history.php.books.atom                             16-Jul-2024 06:03                 584
history.php.publications.atom                      16-Jul-2024 06:03                 622
history.php.related.atom                           16-Jul-2024 06:03                 617
hrtime-performancecounter.getfrequency.atom        16-Jul-2024 06:03                 675
hrtime-performancecounter.getticks.atom            16-Jul-2024 06:03                 656
hrtime-performancecounter.gettickssince.atom       16-Jul-2024 06:03                 688
hrtime-stopwatch.getelapsedticks.atom              16-Jul-2024 06:03                 705
hrtime-stopwatch.getelapsedtime.atom               16-Jul-2024 06:03                 698
hrtime-stopwatch.getlastelapsedticks.atom          16-Jul-2024 06:03                 728
hrtime-stopwatch.getlastelapsedtime.atom           16-Jul-2024 06:03                 723
hrtime-stopwatch.isrunning.atom                    16-Jul-2024 06:03                 642
hrtime-stopwatch.start.atom                        16-Jul-2024 06:03                 614
hrtime-stopwatch.stop.atom                         16-Jul-2024 06:03                 609
hrtime.example.basic.atom                          16-Jul-2024 06:03                 589
hrtime.examples.atom                               16-Jul-2024 06:03                 800
hrtime.installation.atom                           16-Jul-2024 06:03                 580
hrtime.setup.atom                                  16-Jul-2024 06:03                 801
ibase.configuration.atom                           16-Jul-2024 06:03                 622
ibase.constants.atom                               16-Jul-2024 06:03                 601
ibase.installation.atom                            16-Jul-2024 06:03                 577
ibase.resources.atom                               16-Jul-2024 06:03                 575
ibase.setup.atom                                   16-Jul-2024 06:03                1280
ibm-db2.configuration.atom                         16-Jul-2024 06:03                 628
ibm-db2.constants.atom                             16-Jul-2024 06:03                 607
ibm-db2.installation.atom                          16-Jul-2024 06:03                 583
ibm-db2.requirements.atom                          16-Jul-2024 06:03                 592
ibm-db2.resources.atom                             16-Jul-2024 06:03                 581
ibm-db2.setup.atom                                 16-Jul-2024 06:03                1533
iconv.configuration.atom                           16-Jul-2024 06:03                 622
iconv.constants.atom                               16-Jul-2024 06:03                 601
iconv.installation.atom                            16-Jul-2024 06:03                 577
iconv.requirements.atom                            16-Jul-2024 06:03                 586
iconv.resources.atom                               16-Jul-2024 06:03                 575
iconv.setup.atom                                   16-Jul-2024 06:03                1511
igbinary.configuration.atom                        16-Jul-2024 06:03                 631
igbinary.installation.atom                         16-Jul-2024 06:03                 586
igbinary.setup.atom                                16-Jul-2024 06:03                1074
image.configuration.atom                           16-Jul-2024 06:03                 622
image.constants.atom                               16-Jul-2024 06:03                 601
image.examples-png.atom                            16-Jul-2024 06:03                 614
image.examples-watermark.atom                      16-Jul-2024 06:03                 671
image.examples.atom                                16-Jul-2024 06:03                1448
image.examples.merged-watermark.atom               16-Jul-2024 06:03                 700
image.installation.atom                            16-Jul-2024 06:03                 577
image.requirements.atom                            16-Jul-2024 06:03                 586
image.resources.atom                               16-Jul-2024 06:03                 575
image.setup.atom                                   16-Jul-2024 06:03                1511
imagick.adaptiveblurimage.atom                     16-Jul-2024 06:03                 635
imagick.adaptiveresizeimage.atom                   16-Jul-2024 06:03                 648
imagick.adaptivesharpenimage.atom                  16-Jul-2024 06:03                 632
imagick.adaptivethresholdimage.atom                16-Jul-2024 06:03                 719
imagick.addimage.atom                              16-Jul-2024 06:03                 627
imagick.addnoiseimage.atom                         16-Jul-2024 06:03                 618
imagick.affinetransformimage.atom                  16-Jul-2024 06:03                 615
imagick.animateimages.atom                         16-Jul-2024 06:03                 603
imagick.annotateimage.atom                         16-Jul-2024 06:03                 604
imagick.appendimages.atom                          16-Jul-2024 06:03                 598
imagick.autolevelimage.atom                        16-Jul-2024 06:03                 625
imagick.averageimages.atom                         16-Jul-2024 06:03                 609
imagick.blackthresholdimage.atom                   16-Jul-2024 06:03                 666
imagick.blueshiftimage.atom                        16-Jul-2024 06:03                 606
imagick.blurimage.atom                             16-Jul-2024 06:03                 609
imagick.borderimage.atom                           16-Jul-2024 06:03                 598
imagick.brightnesscontrastimage.atom               16-Jul-2024 06:03                 653
imagick.charcoalimage.atom                         16-Jul-2024 06:03                 600
imagick.chopimage.atom                             16-Jul-2024 06:03                 621
imagick.clampimage.atom                            16-Jul-2024 06:03                 619
imagick.clear.atom                                 16-Jul-2024 06:03                 640
imagick.clipimage.atom                             16-Jul-2024 06:03                 619
imagick.clipimagepath.atom                         16-Jul-2024 06:03                 635
imagick.clippathimage.atom                         16-Jul-2024 06:03                 610
imagick.clone.atom                                 16-Jul-2024 06:03                 595
imagick.clutimage.atom                             16-Jul-2024 06:03                 600
imagick.coalesceimages.atom                        16-Jul-2024 06:03                 605
imagick.colorfloodfillimage.atom                   16-Jul-2024 06:03                 625
imagick.colorizeimage.atom                         16-Jul-2024 06:03                 636
imagick.colormatriximage.atom                      16-Jul-2024 06:03                 621
imagick.combineimages.atom                         16-Jul-2024 06:03                 611
imagick.commentimage.atom                          16-Jul-2024 06:03                 615
imagick.compareimagechannels.atom                  16-Jul-2024 06:03                 651
imagick.compareimagelayers.atom                    16-Jul-2024 06:03                 664
imagick.compareimages.atom                         16-Jul-2024 06:03                 630
imagick.compositeimage.atom                        16-Jul-2024 06:03                 609
imagick.configuration.atom                         16-Jul-2024 06:03                 628
imagick.constants.atom                             16-Jul-2024 06:03                 607
imagick.construct.atom                             16-Jul-2024 06:03                 585
imagick.contrastimage.atom                         16-Jul-2024 06:03                 609
imagick.contraststretchimage.atom                  16-Jul-2024 06:03                 644
imagick.convolveimage.atom                         16-Jul-2024 06:03                 629
imagick.count.atom                                 16-Jul-2024 06:03                 574
imagick.cropimage.atom                             16-Jul-2024 06:03                 608
imagick.cropthumbnailimage.atom                    16-Jul-2024 06:03                 633
imagick.current.atom                               16-Jul-2024 06:03                 633
imagick.cyclecolormapimage.atom                    16-Jul-2024 06:03                 646
imagick.decipherimage.atom                         16-Jul-2024 06:03                 604
imagick.deconstructimages.atom                     16-Jul-2024 06:03                 658
imagick.deleteimageartifact.atom                   16-Jul-2024 06:03                 633
imagick.deleteimageproperty.atom                   16-Jul-2024 06:03                 617
imagick.deskewimage.atom                           16-Jul-2024 06:03                 601
imagick.despeckleimage.atom                        16-Jul-2024 06:03                 628
imagick.destroy.atom                               16-Jul-2024 06:03                 591
imagick.displayimage.atom                          16-Jul-2024 06:03                 588
imagick.displayimages.atom                         16-Jul-2024 06:03                 618
imagick.distortimage.atom                          16-Jul-2024 06:03                 647
imagick.drawimage.atom                             16-Jul-2024 06:03                 617
imagick.edgeimage.atom                             16-Jul-2024 06:03                 598
imagick.embossimage.atom                           16-Jul-2024 06:03                 622
imagick.encipherimage.atom                         16-Jul-2024 06:03                 591
imagick.enhanceimage.atom                          16-Jul-2024 06:03                 648
imagick.equalizeimage.atom                         16-Jul-2024 06:03                 628
imagick.evaluateimage.atom                         16-Jul-2024 06:03                 620
imagick.examples-1.atom                            16-Jul-2024 06:03                 583
imagick.examples.atom                              16-Jul-2024 06:03                 799
imagick.exportimagepixels.atom                     16-Jul-2024 06:03                 626
imagick.extentimage.atom                           16-Jul-2024 06:03                 612
imagick.filter.atom                                16-Jul-2024 06:03                 601
imagick.flattenimages.atom                         16-Jul-2024 06:03                 620
imagick.flipimage.atom                             16-Jul-2024 06:03                 607
imagick.floodfillpaintimage.atom                   16-Jul-2024 06:03                 675
imagick.flopimage.atom                             16-Jul-2024 06:03                 609
imagick.forwardfouriertransformimage.atom          16-Jul-2024 06:03                 666
imagick.frameimage.atom                            16-Jul-2024 06:03                 582
imagick.functionimage.atom                         16-Jul-2024 06:03                 612
imagick.fximage.atom                               16-Jul-2024 06:03                 623
imagick.gammaimage.atom                            16-Jul-2024 06:03                 620
imagick.gaussianblurimage.atom                     16-Jul-2024 06:03                 619
imagick.getcolorspace.atom                         16-Jul-2024 06:03                 630
imagick.getcompression.atom                        16-Jul-2024 06:03                 603
imagick.getcompressionquality.atom                 16-Jul-2024 06:03                 641
imagick.getcopyright.atom                          16-Jul-2024 06:03                 622
imagick.getfilename.atom                           16-Jul-2024 06:03                 645
imagick.getfont.atom                               16-Jul-2024 06:03                 621
imagick.getformat.atom                             16-Jul-2024 06:03                 604
imagick.getgravity.atom                            16-Jul-2024 06:03                 617
imagick.gethomeurl.atom                            16-Jul-2024 06:03                 599
imagick.getimage.atom                              16-Jul-2024 06:03                 591
imagick.getimagealphachannel.atom                  16-Jul-2024 06:03                 646
imagick.getimageartifact.atom                      16-Jul-2024 06:03                 645
imagick.getimageattribute.atom                     16-Jul-2024 06:03                 611
imagick.getimagebackgroundcolor.atom               16-Jul-2024 06:03                 631
imagick.getimageblob.atom                          16-Jul-2024 06:03                 630
imagick.getimageblueprimary.atom                   16-Jul-2024 06:03                 645
imagick.getimagebordercolor.atom                   16-Jul-2024 06:03                 638
imagick.getimagechanneldepth.atom                  16-Jul-2024 06:03                 649
imagick.getimagechanneldistortion.atom             16-Jul-2024 06:03                 669
imagick.getimagechanneldistortions.atom            16-Jul-2024 06:03                 675
imagick.getimagechannelextrema.atom                16-Jul-2024 06:03                 659
imagick.getimagechannelkurtosis.atom               16-Jul-2024 06:03                 637
imagick.getimagechannelmean.atom                   16-Jul-2024 06:03                 642
imagick.getimagechannelrange.atom                  16-Jul-2024 06:03                 652
imagick.getimagechannelstatistics.atom             16-Jul-2024 06:03                 668
imagick.getimageclipmask.atom                      16-Jul-2024 06:03                 647
imagick.getimagecolormapcolor.atom                 16-Jul-2024 06:03                 667
imagick.getimagecolors.atom                        16-Jul-2024 06:03                 626
imagick.getimagecolorspace.atom                    16-Jul-2024 06:03                 634
imagick.getimagecompose.atom                       16-Jul-2024 06:03                 673
imagick.getimagecompression.atom                   16-Jul-2024 06:03                 634
imagick.getimagecompressionquality.atom            16-Jul-2024 06:03                 669
imagick.getimagedelay.atom                         16-Jul-2024 06:03                 613
imagick.getimagedepth.atom                         16-Jul-2024 06:03                 607
imagick.getimagedispose.atom                       16-Jul-2024 06:03                 643
imagick.getimagedistortion.atom                    16-Jul-2024 06:03                 653
imagick.getimageextrema.atom                       16-Jul-2024 06:03                 623
imagick.getimagefilename.atom                      16-Jul-2024 06:03                 660
imagick.getimageformat.atom                        16-Jul-2024 06:03                 641
imagick.getimagegamma.atom                         16-Jul-2024 06:03                 602
imagick.getimagegeometry.atom                      16-Jul-2024 06:03                 633
imagick.getimagegravity.atom                       16-Jul-2024 06:03                 648
imagick.getimagegreenprimary.atom                  16-Jul-2024 06:03                 648
imagick.getimageheight.atom                        16-Jul-2024 06:03                 612
imagick.getimagehistogram.atom                     16-Jul-2024 06:03                 629
imagick.getimageindex.atom                         16-Jul-2024 06:03                 615
imagick.getimageinterlacescheme.atom               16-Jul-2024 06:03                 665
imagick.getimageinterpolatemethod.atom             16-Jul-2024 06:03                 661
imagick.getimageiterations.atom                    16-Jul-2024 06:03                 634
imagick.getimagelength.atom                        16-Jul-2024 06:03                 621
imagick.getimagematte.atom                         16-Jul-2024 06:03                 612
imagick.getimagemattecolor.atom                    16-Jul-2024 06:03                 629
imagick.getimagemimetype.atom                      16-Jul-2024 06:03                 610
imagick.getimageorientation.atom                   16-Jul-2024 06:03                 630
imagick.getimagepage.atom                          16-Jul-2024 06:03                 625
imagick.getimagepixelcolor.atom                    16-Jul-2024 06:03                 624
imagick.getimageprofile.atom                       16-Jul-2024 06:03                 615
imagick.getimageprofiles.atom                      16-Jul-2024 06:03                 619
imagick.getimageproperties.atom                    16-Jul-2024 06:03                 655
imagick.getimageproperty.atom                      16-Jul-2024 06:03                 644
imagick.getimageredprimary.atom                    16-Jul-2024 06:03                 637
imagick.getimageregion.atom                        16-Jul-2024 06:03                 623
imagick.getimagerenderingintent.atom               16-Jul-2024 06:03                 654
imagick.getimageresolution.atom                    16-Jul-2024 06:03                 646
imagick.getimagesblob.atom                         16-Jul-2024 06:03                 637
imagick.getimagescene.atom                         16-Jul-2024 06:03                 618
imagick.getimagesignature.atom                     16-Jul-2024 06:03                 636
imagick.getimagesize.atom                          16-Jul-2024 06:03                 615
imagick.getimagetickspersecond.atom                16-Jul-2024 06:03                 642
imagick.getimagetotalinkdensity.atom               16-Jul-2024 06:03                 665
imagick.getimagetype.atom                          16-Jul-2024 06:03                 604
imagick.getimageunits.atom                         16-Jul-2024 06:03                 645
imagick.getimagevirtualpixelmethod.atom            16-Jul-2024 06:03                 660
imagick.getimagewhitepoint.atom                    16-Jul-2024 06:03                 637
imagick.getimagewidth.atom                         16-Jul-2024 06:03                 609
imagick.getinterlacescheme.atom                    16-Jul-2024 06:03                 650
imagick.getiteratorindex.atom                      16-Jul-2024 06:03                 631
imagick.getnumberimages.atom                       16-Jul-2024 06:03                 628
imagick.getoption.atom                             16-Jul-2024 06:03                 598
imagick.getpackagename.atom                        16-Jul-2024 06:03                 614
imagick.getpage.atom                               16-Jul-2024 06:03                 610
imagick.getpixeliterator.atom                      16-Jul-2024 06:03                 614
imagick.getpixelregioniterator.atom                16-Jul-2024 06:03                 664
imagick.getpointsize.atom                          16-Jul-2024 06:03                 620
imagick.getquantum.atom                            16-Jul-2024 06:03                 602
imagick.getquantumdepth.atom                       16-Jul-2024 06:03                 607
imagick.getquantumrange.atom                       16-Jul-2024 06:03                 627
imagick.getregistry.atom                           16-Jul-2024 06:03                 594
imagick.getreleasedate.atom                        16-Jul-2024 06:03                 623
imagick.getresource.atom                           16-Jul-2024 06:03                 630
imagick.getresourcelimit.atom                      16-Jul-2024 06:03                 617
imagick.getsamplingfactors.atom                    16-Jul-2024 06:03                 660
imagick.getsize.atom                               16-Jul-2024 06:03                 616
imagick.getsizeoffset.atom                         16-Jul-2024 06:03                 607
imagick.getversion.atom                            16-Jul-2024 06:03                 603
imagick.haldclutimage.atom                         16-Jul-2024 06:03                 611
imagick.hasnextimage.atom                          16-Jul-2024 06:03                 622
imagick.haspreviousimage.atom                      16-Jul-2024 06:03                 658
imagick.identifyformat.atom                        16-Jul-2024 06:03                 612
imagick.identifyimage.atom                         16-Jul-2024 06:03                 614
imagick.implodeimage.atom                          16-Jul-2024 06:03                 618
imagick.importimagepixels.atom                     16-Jul-2024 06:03                 619
imagick.installation.atom                          16-Jul-2024 06:03                 583
imagick.inversefouriertransformimage.atom          16-Jul-2024 06:03                 674
imagick.labelimage.atom                            16-Jul-2024 06:03                 605
imagick.levelimage.atom                            16-Jul-2024 06:03                 599
imagick.linearstretchimage.atom                    16-Jul-2024 06:03                 666
imagick.liquidrescaleimage.atom                    16-Jul-2024 06:03                 618
imagick.listregistry.atom                          16-Jul-2024 06:03                 601
imagick.magnifyimage.atom                          16-Jul-2024 06:03                 625
imagick.mapimage.atom                              16-Jul-2024 06:03                 657
imagick.mattefloodfillimage.atom                   16-Jul-2024 06:03                 633
imagick.medianfilterimage.atom                     16-Jul-2024 06:03                 625
imagick.mergeimagelayers.atom                      16-Jul-2024 06:03                 619
imagick.minifyimage.atom                           16-Jul-2024 06:03                 698
imagick.modulateimage.atom                         16-Jul-2024 06:03                 648
imagick.montageimage.atom                          16-Jul-2024 06:03                 606
imagick.morphimages.atom                           16-Jul-2024 06:03                 616
imagick.morphology.atom                            16-Jul-2024 06:03                 650
imagick.mosaicimages.atom                          16-Jul-2024 06:03                 612
imagick.motionblurimage.atom                       16-Jul-2024 06:03                 619
imagick.negateimage.atom                           16-Jul-2024 06:03                 664
imagick.newimage.atom                              16-Jul-2024 06:03                 593
imagick.newpseudoimage.atom                        16-Jul-2024 06:03                 611
imagick.nextimage.atom                             16-Jul-2024 06:03                 599
imagick.normalizeimage.atom                        16-Jul-2024 06:03                 625
imagick.oilpaintimage.atom                         16-Jul-2024 06:03                 619
imagick.opaquepaintimage.atom                      16-Jul-2024 06:03                 669
imagick.optimizeimagelayers.atom                   16-Jul-2024 06:03                 672
imagick.orderedposterizeimage.atom                 16-Jul-2024 06:03                 635
imagick.paintfloodfillimage.atom                   16-Jul-2024 06:03                 637
imagick.paintopaqueimage.atom                      16-Jul-2024 06:03                 628
imagick.painttransparentimage.atom                 16-Jul-2024 06:03                 633
imagick.pingimage.atom                             16-Jul-2024 06:03                 609
imagick.pingimageblob.atom                         16-Jul-2024 06:03                 602
imagick.pingimagefile.atom                         16-Jul-2024 06:03                 616
imagick.polaroidimage.atom                         16-Jul-2024 06:03                 599
imagick.posterizeimage.atom                        16-Jul-2024 06:03                 657
imagick.previewimages.atom                         16-Jul-2024 06:03                 667
imagick.previousimage.atom                         16-Jul-2024 06:03                 681
imagick.profileimage.atom                          16-Jul-2024 06:03                 614
imagick.quantizeimage.atom                         16-Jul-2024 06:03                 648
imagick.quantizeimages.atom                        16-Jul-2024 06:03                 642
imagick.queryfontmetrics.atom                      16-Jul-2024 06:03                 654
imagick.queryfonts.atom                            16-Jul-2024 06:03                 615
imagick.queryformats.atom                          16-Jul-2024 06:03                 624
imagick.radialblurimage.atom                       16-Jul-2024 06:03                 608
imagick.raiseimage.atom                            16-Jul-2024 06:03                 602
imagick.randomthresholdimage.atom                  16-Jul-2024 06:03                 666
imagick.readimage.atom                             16-Jul-2024 06:03                 593
imagick.readimageblob.atom                         16-Jul-2024 06:03                 623
imagick.readimagefile.atom                         16-Jul-2024 06:03                 636
imagick.readimages.atom                            16-Jul-2024 06:03                 603
imagick.recolorimage.atom                          16-Jul-2024 06:03                 592
imagick.reducenoiseimage.atom                      16-Jul-2024 06:03                 620
imagick.remapimage.atom                            16-Jul-2024 06:03                 605
imagick.removeimage.atom                           16-Jul-2024 06:03                 596
imagick.removeimageprofile.atom                    16-Jul-2024 06:03                 638
imagick.render.atom                                16-Jul-2024 06:03                 625
imagick.requirements.atom                          16-Jul-2024 06:03                 592
imagick.resampleimage.atom                         16-Jul-2024 06:03                 624
imagick.resetimagepage.atom                        16-Jul-2024 06:03                 624
imagick.resizeimage.atom                           16-Jul-2024 06:03                 591
imagick.resources.atom                             16-Jul-2024 06:03                 581
imagick.rollimage.atom                             16-Jul-2024 06:03                 589
imagick.rotateimage.atom                           16-Jul-2024 06:03                 584
imagick.rotationalblurimage.atom                   16-Jul-2024 06:03                 617
imagick.roundcorners.atom                          16-Jul-2024 06:03                 605
imagick.sampleimage.atom                           16-Jul-2024 06:03                 662
imagick.scaleimage.atom                            16-Jul-2024 06:03                 633
imagick.segmentimage.atom                          16-Jul-2024 06:03                 589
imagick.selectiveblurimage.atom                    16-Jul-2024 06:03                 642
imagick.separateimagechannel.atom                  16-Jul-2024 06:03                 638
imagick.sepiatoneimage.atom                        16-Jul-2024 06:03                 617
imagick.setbackgroundcolor.atom                    16-Jul-2024 06:03                 639
imagick.setcolorspace.atom                         16-Jul-2024 06:03                 618
imagick.setcompression.atom                        16-Jul-2024 06:03                 625
imagick.setcompressionquality.atom                 16-Jul-2024 06:03                 660
imagick.setfilename.atom                           16-Jul-2024 06:03                 642
imagick.setfirstiterator.atom                      16-Jul-2024 06:03                 660
imagick.setfont.atom                               16-Jul-2024 06:03                 575
imagick.setformat.atom                             16-Jul-2024 06:03                 605
imagick.setgravity.atom                            16-Jul-2024 06:03                 605
imagick.setimage.atom                              16-Jul-2024 06:03                 598
imagick.setimagealphachannel.atom                  16-Jul-2024 06:03                 644
imagick.setimageartifact.atom                      16-Jul-2024 06:03                 633
imagick.setimageattribute.atom                     16-Jul-2024 06:03                 609
imagick.setimagebackgroundcolor.atom               16-Jul-2024 06:03                 645
imagick.setimagebias.atom                          16-Jul-2024 06:03                 611
imagick.setimagebiasquantum.atom                   16-Jul-2024 06:03                 611
imagick.setimageblueprimary.atom                   16-Jul-2024 06:03                 640
imagick.setimagebordercolor.atom                   16-Jul-2024 06:03                 623
imagick.setimagechanneldepth.atom                  16-Jul-2024 06:03                 634
imagick.setimageclipmask.atom                      16-Jul-2024 06:03                 635
imagick.setimagecolormapcolor.atom                 16-Jul-2024 06:03                 631
imagick.setimagecolorspace.atom                    16-Jul-2024 06:03                 640
imagick.setimagecompose.atom                       16-Jul-2024 06:03                 648
imagick.setimagecompression.atom                   16-Jul-2024 06:03                 632
imagick.setimagecompressionquality.atom            16-Jul-2024 06:03                 685
imagick.setimagedelay.atom                         16-Jul-2024 06:03                 619
imagick.setimagedepth.atom                         16-Jul-2024 06:03                 613
imagick.setimagedispose.atom                       16-Jul-2024 06:03                 649
imagick.setimageextent.atom                        16-Jul-2024 06:03                 613
imagick.setimagefilename.atom                      16-Jul-2024 06:03                 656
imagick.setimageformat.atom                        16-Jul-2024 06:03                 642
imagick.setimagegamma.atom                         16-Jul-2024 06:03                 603
imagick.setimagegravity.atom                       16-Jul-2024 06:03                 636
imagick.setimagegreenprimary.atom                  16-Jul-2024 06:03                 643
imagick.setimageindex.atom                         16-Jul-2024 06:03                 624
imagick.setimageinterlacescheme.atom               16-Jul-2024 06:03                 672
imagick.setimageinterpolatemethod.atom             16-Jul-2024 06:03                 678
imagick.setimageiterations.atom                    16-Jul-2024 06:03                 640
imagick.setimagematte.atom                         16-Jul-2024 06:03                 613
imagick.setimagemattecolor.atom                    16-Jul-2024 06:03                 614
imagick.setimageopacity.atom                       16-Jul-2024 06:03                 641
imagick.setimageorientation.atom                   16-Jul-2024 06:03                 636
imagick.setimagepage.atom                          16-Jul-2024 06:03                 642
imagick.setimageprofile.atom                       16-Jul-2024 06:03                 626
imagick.setimageproperty.atom                      16-Jul-2024 06:03                 641
imagick.setimageredprimary.atom                    16-Jul-2024 06:03                 638
imagick.setimagerenderingintent.atom               16-Jul-2024 06:03                 646
imagick.setimageresolution.atom                    16-Jul-2024 06:03                 639
imagick.setimagescene.atom                         16-Jul-2024 06:03                 619
imagick.setimagetickspersecond.atom                16-Jul-2024 06:03                 655
imagick.setimagetype.atom                          16-Jul-2024 06:03                 601
imagick.setimageunits.atom                         16-Jul-2024 06:03                 647
imagick.setimagevirtualpixelmethod.atom            16-Jul-2024 06:03                 677
imagick.setimagewhitepoint.atom                    16-Jul-2024 06:03                 638
imagick.setinterlacescheme.atom                    16-Jul-2024 06:03                 629
imagick.setiteratorindex.atom                      16-Jul-2024 06:03                 629
imagick.setlastiterator.atom                       16-Jul-2024 06:03                 668
imagick.setoption.atom                             16-Jul-2024 06:03                 606
imagick.setpage.atom                               16-Jul-2024 06:03                 635
imagick.setpointsize.atom                          16-Jul-2024 06:03                 608
imagick.setprogressmonitor.atom                    16-Jul-2024 06:03                 634
imagick.setregistry.atom                           16-Jul-2024 06:03                 622
imagick.setresolution.atom                         16-Jul-2024 06:03                 624
imagick.setresourcelimit.atom                      16-Jul-2024 06:03                 654
imagick.setsamplingfactors.atom                    16-Jul-2024 06:03                 661
imagick.setsize.atom                               16-Jul-2024 06:03                 599
imagick.setsizeoffset.atom                         16-Jul-2024 06:03                 632
imagick.settype.atom                               16-Jul-2024 06:03                 597
imagick.setup.atom                                 16-Jul-2024 06:03                1533
imagick.shadeimage.atom                            16-Jul-2024 06:03                 592
imagick.shadowimage.atom                           16-Jul-2024 06:03                 601
imagick.sharpenimage.atom                          16-Jul-2024 06:03                 588
imagick.shaveimage.atom                            16-Jul-2024 06:03                 608
imagick.shearimage.atom                            16-Jul-2024 06:03                 610
imagick.sigmoidalcontrastimage.atom                16-Jul-2024 06:03                 636
imagick.sketchimage.atom                           16-Jul-2024 06:03                 619
imagick.smushimages.atom                           16-Jul-2024 06:03                 660
imagick.solarizeimage.atom                         16-Jul-2024 06:03                 633
imagick.sparsecolorimage.atom                      16-Jul-2024 06:03                 605
imagick.spliceimage.atom                           16-Jul-2024 06:03                 610
imagick.spreadimage.atom                           16-Jul-2024 06:03                 626
imagick.statisticimage.atom                        16-Jul-2024 06:03                 619
imagick.steganoimage.atom                          16-Jul-2024 06:03                 615
imagick.stereoimage.atom                           16-Jul-2024 06:03                 585
imagick.stripimage.atom                            16-Jul-2024 06:03                 628
imagick.subimagematch.atom                         16-Jul-2024 06:03                 649
imagick.swirlimage.atom                            16-Jul-2024 06:03                 614
imagick.textureimage.atom                          16-Jul-2024 06:03                 643
imagick.thresholdimage.atom                        16-Jul-2024 06:03                 648
imagick.thumbnailimage.atom                        16-Jul-2024 06:03                 611
imagick.tintimage.atom                             16-Jul-2024 06:03                 634
imagick.tostring.atom                              16-Jul-2024 06:03                 588
imagick.transformimage.atom                        16-Jul-2024 06:03                 708
imagick.transformimagecolorspace.atom              16-Jul-2024 06:03                 646
imagick.transparentpaintimage.atom                 16-Jul-2024 06:03                 630
imagick.transposeimage.atom                        16-Jul-2024 06:03                 619
imagick.transverseimage.atom                       16-Jul-2024 06:03                 632
imagick.trimimage.atom                             16-Jul-2024 06:03                 596
imagick.uniqueimagecolors.atom                     16-Jul-2024 06:03                 626
imagick.unsharpmaskimage.atom                      16-Jul-2024 06:03                 608
imagick.valid.atom                                 16-Jul-2024 06:03                 627
imagick.vignetteimage.atom                         16-Jul-2024 06:03                 624
imagick.waveimage.atom                             16-Jul-2024 06:03                 614
imagick.whitethresholdimage.atom                   16-Jul-2024 06:03                 642
imagick.writeimage.atom                            16-Jul-2024 06:03                 638
imagick.writeimagefile.atom                        16-Jul-2024 06:03                 634
imagick.writeimages.atom                           16-Jul-2024 06:03                 635
imagick.writeimagesfile.atom                       16-Jul-2024 06:03                 640
imagickdraw.affine.atom                            16-Jul-2024 06:03                 616
imagickdraw.annotation.atom                        16-Jul-2024 06:03                 607
imagickdraw.arc.atom                               16-Jul-2024 06:03                 570
imagickdraw.bezier.atom                            16-Jul-2024 06:03                 604
imagickdraw.circle.atom                            16-Jul-2024 06:03                 582
imagickdraw.clear.atom                             16-Jul-2024 06:03                 598
imagickdraw.clone.atom                             16-Jul-2024 06:03                 611
imagickdraw.color.atom                             16-Jul-2024 06:03                 595
imagickdraw.comment.atom                           16-Jul-2024 06:03                 589
imagickdraw.composite.atom                         16-Jul-2024 06:03                 606
imagickdraw.construct.atom                         16-Jul-2024 06:03                 601
imagickdraw.destroy.atom                           16-Jul-2024 06:03                 660
imagickdraw.ellipse.atom                           16-Jul-2024 06:03                 601
imagickdraw.getclippath.atom                       16-Jul-2024 06:03                 625
imagickdraw.getcliprule.atom                       16-Jul-2024 06:03                 651
imagickdraw.getclipunits.atom                      16-Jul-2024 06:03                 660
imagickdraw.getfillcolor.atom                      16-Jul-2024 06:03                 617
imagickdraw.getfillopacity.atom                    16-Jul-2024 06:03                 633
imagickdraw.getfillrule.atom                       16-Jul-2024 06:03                 623
imagickdraw.getfont.atom                           16-Jul-2024 06:03                 586
imagickdraw.getfontfamily.atom                     16-Jul-2024 06:03                 615
imagickdraw.getfontsize.atom                       16-Jul-2024 06:03                 611
imagickdraw.getfontstretch.atom                    16-Jul-2024 06:03                 643
imagickdraw.getfontstyle.atom                      16-Jul-2024 06:03                 613
imagickdraw.getfontweight.atom                     16-Jul-2024 06:03                 616
imagickdraw.getgravity.atom                        16-Jul-2024 06:03                 629
imagickdraw.getstrokeantialias.atom                16-Jul-2024 06:03                 656
imagickdraw.getstrokecolor.atom                    16-Jul-2024 06:03                 635
imagickdraw.getstrokedasharray.atom                16-Jul-2024 06:03                 678
imagickdraw.getstrokedashoffset.atom               16-Jul-2024 06:03                 664
imagickdraw.getstrokelinecap.atom                  16-Jul-2024 06:03                 674
imagickdraw.getstrokelinejoin.atom                 16-Jul-2024 06:03                 678
imagickdraw.getstrokemiterlimit.atom               16-Jul-2024 06:03                 638
imagickdraw.getstrokeopacity.atom                  16-Jul-2024 06:03                 658
imagickdraw.getstrokewidth.atom                    16-Jul-2024 06:03                 636
imagickdraw.gettextalignment.atom                  16-Jul-2024 06:03                 630
imagickdraw.gettextantialias.atom                  16-Jul-2024 06:03                 653
imagickdraw.gettextdecoration.atom                 16-Jul-2024 06:03                 640
imagickdraw.gettextencoding.atom                   16-Jul-2024 06:03                 681
imagickdraw.gettextinterlinespacing.atom           16-Jul-2024 06:03                 692
imagickdraw.gettextinterwordspacing.atom           16-Jul-2024 06:03                 692
imagickdraw.gettextkerning.atom                    16-Jul-2024 06:03                 658
imagickdraw.gettextundercolor.atom                 16-Jul-2024 06:03                 631
imagickdraw.getvectorgraphics.atom                 16-Jul-2024 06:03                 658
imagickdraw.line.atom                              16-Jul-2024 06:03                 576
imagickdraw.matte.atom                             16-Jul-2024 06:03                 624
imagickdraw.pathclose.atom                         16-Jul-2024 06:03                 641
imagickdraw.pathcurvetoabsolute.atom               16-Jul-2024 06:03                 687
imagickdraw.pathcurvetoquadraticbezierabsolute...> 16-Jul-2024 06:03                 736
imagickdraw.pathcurvetoquadraticbezierrelative...> 16-Jul-2024 06:03                 737
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 16-Jul-2024 06:03                 757
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 16-Jul-2024 06:03                 758
imagickdraw.pathcurvetorelative.atom               16-Jul-2024 06:03                 688
imagickdraw.pathcurvetosmoothabsolute.atom         16-Jul-2024 06:03                 697
imagickdraw.pathcurvetosmoothrelative.atom         16-Jul-2024 06:03                 698
imagickdraw.pathellipticarcabsolute.atom           16-Jul-2024 06:03                 681
imagickdraw.pathellipticarcrelative.atom           16-Jul-2024 06:03                 682
imagickdraw.pathfinish.atom                        16-Jul-2024 06:03                 602
imagickdraw.pathlinetoabsolute.atom                16-Jul-2024 06:03                 664
imagickdraw.pathlinetohorizontalabsolute.atom      16-Jul-2024 06:03                 706
imagickdraw.pathlinetohorizontalrelative.atom      16-Jul-2024 06:03                 707
imagickdraw.pathlinetorelative.atom                16-Jul-2024 06:03                 665
imagickdraw.pathlinetoverticalabsolute.atom        16-Jul-2024 06:03                 698
imagickdraw.pathlinetoverticalrelative.atom        16-Jul-2024 06:03                 699
imagickdraw.pathmovetoabsolute.atom                16-Jul-2024 06:03                 668
imagickdraw.pathmovetorelative.atom                16-Jul-2024 06:03                 669
imagickdraw.pathstart.atom                         16-Jul-2024 06:03                 640
imagickdraw.point.atom                             16-Jul-2024 06:03                 578
imagickdraw.polygon.atom                           16-Jul-2024 06:03                 587
imagickdraw.polyline.atom                          16-Jul-2024 06:03                 606
imagickdraw.pop.atom                               16-Jul-2024 06:03                 669
imagickdraw.popclippath.atom                       16-Jul-2024 06:03                 629
imagickdraw.popdefs.atom                           16-Jul-2024 06:03                 610
imagickdraw.poppattern.atom                        16-Jul-2024 06:03                 619
imagickdraw.push.atom                              16-Jul-2024 06:03                 623
imagickdraw.pushclippath.atom                      16-Jul-2024 06:03                 633
imagickdraw.pushdefs.atom                          16-Jul-2024 06:03                 715
imagickdraw.pushpattern.atom                       16-Jul-2024 06:03                 609
imagickdraw.rectangle.atom                         16-Jul-2024 06:03                 594
imagickdraw.render.atom                            16-Jul-2024 06:03                 628
imagickdraw.resetvectorgraphics.atom               16-Jul-2024 06:03                 630
imagickdraw.rotate.atom                            16-Jul-2024 06:03                 586
imagickdraw.roundrectangle.atom                    16-Jul-2024 06:03                 628
imagickdraw.scale.atom                             16-Jul-2024 06:03                 626
imagickdraw.setclippath.atom                       16-Jul-2024 06:03                 612
imagickdraw.setcliprule.atom                       16-Jul-2024 06:03                 675
imagickdraw.setclipunits.atom                      16-Jul-2024 06:03                 665
imagickdraw.setfillalpha.atom                      16-Jul-2024 06:03                 647
imagickdraw.setfillcolor.atom                      16-Jul-2024 06:03                 632
imagickdraw.setfillopacity.atom                    16-Jul-2024 06:03                 666
imagickdraw.setfillpatternurl.atom                 16-Jul-2024 06:03                 655
imagickdraw.setfillrule.atom                       16-Jul-2024 06:03                 638
imagickdraw.setfont.atom                           16-Jul-2024 06:03                 623
imagickdraw.setfontfamily.atom                     16-Jul-2024 06:03                 632
imagickdraw.setfontsize.atom                       16-Jul-2024 06:03                 624
imagickdraw.setfontstretch.atom                    16-Jul-2024 06:03                 635
imagickdraw.setfontstyle.atom                      16-Jul-2024 06:03                 611
imagickdraw.setfontweight.atom                     16-Jul-2024 06:03                 617
imagickdraw.setgravity.atom                        16-Jul-2024 06:03                 630
imagickdraw.setresolution.atom                     16-Jul-2024 06:03                 629
imagickdraw.setstrokealpha.atom                    16-Jul-2024 06:03                 661
imagickdraw.setstrokeantialias.atom                16-Jul-2024 06:03                 666
imagickdraw.setstrokecolor.atom                    16-Jul-2024 06:03                 654
imagickdraw.setstrokedasharray.atom                16-Jul-2024 06:03                 653
imagickdraw.setstrokedashoffset.atom               16-Jul-2024 06:03                 688
imagickdraw.setstrokelinecap.atom                  16-Jul-2024 06:03                 682
imagickdraw.setstrokelinejoin.atom                 16-Jul-2024 06:03                 681
imagickdraw.setstrokemiterlimit.atom               16-Jul-2024 06:03                 640
imagickdraw.setstrokeopacity.atom                  16-Jul-2024 06:03                 667
imagickdraw.setstrokepatternurl.atom               16-Jul-2024 06:03                 668
imagickdraw.setstrokewidth.atom                    16-Jul-2024 06:03                 645
imagickdraw.settextalignment.atom                  16-Jul-2024 06:03                 641
imagickdraw.settextantialias.atom                  16-Jul-2024 06:03                 644
imagickdraw.settextdecoration.atom                 16-Jul-2024 06:03                 640
imagickdraw.settextencoding.atom                   16-Jul-2024 06:03                 643
imagickdraw.settextinterlinespacing.atom           16-Jul-2024 06:03                 680
imagickdraw.settextinterwordspacing.atom           16-Jul-2024 06:03                 679
imagickdraw.settextkerning.atom                    16-Jul-2024 06:03                 645
imagickdraw.settextundercolor.atom                 16-Jul-2024 06:03                 657
imagickdraw.setvectorgraphics.atom                 16-Jul-2024 06:03                 628
imagickdraw.setviewbox.atom                        16-Jul-2024 06:03                 607
imagickdraw.skewx.atom                             16-Jul-2024 06:03                 625
imagickdraw.skewy.atom                             16-Jul-2024 06:03                 624
imagickdraw.translate.atom                         16-Jul-2024 06:03                 598
imagickkernel.addkernel.atom                       16-Jul-2024 06:03                 618
imagickkernel.addunitykernel.atom                  16-Jul-2024 06:03                 633
imagickkernel.frombuiltin.atom                     16-Jul-2024 06:03                 626
imagickkernel.frommatrix.atom                      16-Jul-2024 06:03                 625
imagickkernel.getmatrix.atom                       16-Jul-2024 06:03                 627
imagickkernel.scale.atom                           16-Jul-2024 06:03                 608
imagickkernel.separate.atom                        16-Jul-2024 06:03                 649
imagickpixel.clear.atom                            16-Jul-2024 06:03                 634
imagickpixel.construct.atom                        16-Jul-2024 06:03                 605
imagickpixel.destroy.atom                          16-Jul-2024 06:03                 642
imagickpixel.getcolor.atom                         16-Jul-2024 06:03                 593
imagickpixel.getcolorasstring.atom                 16-Jul-2024 06:03                 618
imagickpixel.getcolorcount.atom                    16-Jul-2024 06:03                 655
imagickpixel.getcolorquantum.atom                  16-Jul-2024 06:03                 655
imagickpixel.getcolorvalue.atom                    16-Jul-2024 06:03                 682
imagickpixel.getcolorvaluequantum.atom             16-Jul-2024 06:03                 663
imagickpixel.gethsl.atom                           16-Jul-2024 06:03                 642
imagickpixel.getindex.atom                         16-Jul-2024 06:03                 615
imagickpixel.ispixelsimilar.atom                   16-Jul-2024 06:03                 655
imagickpixel.ispixelsimilarquantum.atom            16-Jul-2024 06:03                 682
imagickpixel.issimilar.atom                        16-Jul-2024 06:03                 624
imagickpixel.setcolor.atom                         16-Jul-2024 06:03                 603
imagickpixel.setcolorcount.atom                    16-Jul-2024 06:03                 636
imagickpixel.setcolorvalue.atom                    16-Jul-2024 06:03                 660
imagickpixel.setcolorvaluequantum.atom             16-Jul-2024 06:03                 671
imagickpixel.sethsl.atom                           16-Jul-2024 06:03                 623
imagickpixel.setindex.atom                         16-Jul-2024 06:03                 615
imagickpixeliterator.clear.atom                    16-Jul-2024 06:03                 665
imagickpixeliterator.construct.atom                16-Jul-2024 06:03                 637
imagickpixeliterator.destroy.atom                  16-Jul-2024 06:03                 675
imagickpixeliterator.getcurrentiteratorrow.atom    16-Jul-2024 06:03                 687
imagickpixeliterator.getiteratorrow.atom           16-Jul-2024 06:03                 682
imagickpixeliterator.getnextiteratorrow.atom       16-Jul-2024 06:03                 695
imagickpixeliterator.getpreviousiteratorrow.atom   16-Jul-2024 06:03                 690
imagickpixeliterator.newpixeliterator.atom         16-Jul-2024 06:03                 678
imagickpixeliterator.newpixelregioniterator.atom   16-Jul-2024 06:03                 696
imagickpixeliterator.resetiterator.atom            16-Jul-2024 06:03                 673
imagickpixeliterator.setiteratorfirstrow.atom      16-Jul-2024 06:03                 729
imagickpixeliterator.setiteratorlastrow.atom       16-Jul-2024 06:03                 726
imagickpixeliterator.setiteratorrow.atom           16-Jul-2024 06:03                 683
imagickpixeliterator.synciterator.atom             16-Jul-2024 06:03                 658
imap.configuration.atom                            16-Jul-2024 06:03                 619
imap.constants.atom                                16-Jul-2024 06:03                 598
imap.installation.atom                             16-Jul-2024 06:03                 574
imap.requirements.atom                             16-Jul-2024 06:03                 583
imap.resources.atom                                16-Jul-2024 06:03                 572
imap.setup.atom                                    16-Jul-2024 06:03                1500
index.atom                                         16-Jul-2024 06:03                2707
indexes.atom                                       16-Jul-2024 06:03                1033
indexes.examples.atom                              16-Jul-2024 06:03                 580
indexes.functions.atom                             16-Jul-2024 06:03                 608
infiniteiterator.construct.atom                    16-Jul-2024 06:03                 618
infiniteiterator.next.atom                         16-Jul-2024 06:03                 642
info.configuration.atom                            16-Jul-2024 06:03                 619
info.constants.atom                                16-Jul-2024 06:03                 598
info.resources.atom                                16-Jul-2024 06:03                 572
info.setup.atom                                    16-Jul-2024 06:03                1047
ini.atom                                           16-Jul-2024 06:03                1245
ini.core.atom                                      16-Jul-2024 06:03                 581
ini.list.atom                                      16-Jul-2024 06:03                 566
ini.sections.atom                                  16-Jul-2024 06:03                 584
inotify.constants.atom                             16-Jul-2024 06:03                 607
inotify.install.atom                               16-Jul-2024 06:03                 582
inotify.requirements.atom                          16-Jul-2024 06:03                 592
inotify.resources.atom                             16-Jul-2024 06:03                 581
inotify.setup.atom                                 16-Jul-2024 06:03                1276
install.atom                                       16-Jul-2024 06:03                2766
install.cloud.atom                                 16-Jul-2024 06:03                1299
install.cloud.azure.atom                           16-Jul-2024 06:03                 586
install.cloud.digitalocean.atom                    16-Jul-2024 06:03                 601
install.cloud.ec2.atom                             16-Jul-2024 06:03                 572
install.fpm.atom                                   16-Jul-2024 06:03                1042
install.fpm.configuration.atom                     16-Jul-2024 06:03                 599
install.fpm.install.atom                           16-Jul-2024 06:03                 580
install.general.atom                               16-Jul-2024 06:03                 637
install.macosx.atom                                16-Jul-2024 06:03                1385
install.macosx.bundled.atom                        16-Jul-2024 06:03                 664
install.macosx.compile.atom                        16-Jul-2024 06:03                 599
install.macosx.packages.atom                       16-Jul-2024 06:03                 603
install.pecl.atom                                  16-Jul-2024 06:03                2410
install.pecl.downloads.atom                        16-Jul-2024 06:03                 630
install.pecl.intro.atom                            16-Jul-2024 06:03                 600
install.pecl.pear.atom                             16-Jul-2024 06:03                 639
install.pecl.php-config.atom                       16-Jul-2024 06:03                 590
install.pecl.phpize.atom                           16-Jul-2024 06:03                 627
install.pecl.static.atom                           16-Jul-2024 06:03                 621
install.pecl.windows.atom                          16-Jul-2024 06:03                 611
install.problems.atom                              16-Jul-2024 06:03                1301
install.problems.bugs.atom                         16-Jul-2024 06:03                 591
install.problems.faq.atom                          16-Jul-2024 06:03                 583
install.problems.support.atom                      16-Jul-2024 06:03                 610
install.unix.apache2.atom                          16-Jul-2024 06:03                 614
install.unix.atom                                  16-Jul-2024 06:03                2683
install.unix.commandline.atom                      16-Jul-2024 06:03                 624
install.unix.debian.atom                           16-Jul-2024 06:03                 615
install.unix.lighttpd-14.atom                      16-Jul-2024 06:03                 628
install.unix.litespeed.atom                        16-Jul-2024 06:03                 638
install.unix.nginx.atom                            16-Jul-2024 06:03                 609
install.unix.openbsd.atom                          16-Jul-2024 06:03                 619
install.unix.solaris.atom                          16-Jul-2024 06:03                 596
install.windows.apache2.atom                       16-Jul-2024 06:03                 611
install.windows.atom                               16-Jul-2024 06:03                2966
install.windows.building.atom                      16-Jul-2024 06:03                 603
install.windows.commandline.atom                   16-Jul-2024 06:03                 629
install.windows.manual.atom                        16-Jul-2024 06:03                 618
install.windows.pecl.atom                          16-Jul-2024 06:03                 575
install.windows.recommended.atom                   16-Jul-2024 06:03                 664
install.windows.requirements.atom                  16-Jul-2024 06:03                 641
install.windows.tools.atom                         16-Jul-2024 06:03                 620
install.windows.troubleshooting.atom               16-Jul-2024 06:03                 644
internaliterator.construct.atom                    16-Jul-2024 06:03                 671
internaliterator.current.atom                      16-Jul-2024 06:03                 636
internaliterator.key.atom                          16-Jul-2024 06:03                 645
internaliterator.next.atom                         16-Jul-2024 06:03                 637
internaliterator.rewind.atom                       16-Jul-2024 06:03                 660
internaliterator.valid.atom                        16-Jul-2024 06:03                 630
intl.configuration.atom                            16-Jul-2024 06:03                 619
intl.constants.atom                                16-Jul-2024 06:03                 598
intl.examples.atom                                 16-Jul-2024 06:03                 807
intl.examples.basic.atom                           16-Jul-2024 06:03                 606
intl.installation.atom                             16-Jul-2024 06:03                 574
intl.requirements.atom                             16-Jul-2024 06:03                 583
intl.resources.atom                                16-Jul-2024 06:03                 572
intl.setup.atom                                    16-Jul-2024 06:03                1500
intlbreakiterator.construct.atom                   16-Jul-2024 06:03                 669
intlbreakiterator.createcharacterinstance.atom     16-Jul-2024 06:03                 760
intlbreakiterator.createcodepointinstance.atom     16-Jul-2024 06:03                 708
intlbreakiterator.createlineinstance.atom          16-Jul-2024 06:03                 686
intlbreakiterator.createsentenceinstance.atom      16-Jul-2024 06:03                 698
intlbreakiterator.createtitleinstance.atom         16-Jul-2024 06:03                 661
intlbreakiterator.createwordinstance.atom          16-Jul-2024 06:03                 683
intlbreakiterator.current.atom                     16-Jul-2024 06:03                 653
intlbreakiterator.first.atom                       16-Jul-2024 06:03                 651
intlbreakiterator.following.atom                   16-Jul-2024 06:03                 721
intlbreakiterator.geterrorcode.atom                16-Jul-2024 06:03                 698
intlbreakiterator.geterrormessage.atom             16-Jul-2024 06:03                 710
intlbreakiterator.getlocale.atom                   16-Jul-2024 06:03                 670
intlbreakiterator.getpartsiterator.atom            16-Jul-2024 06:03                 703
intlbreakiterator.gettext.atom                     16-Jul-2024 06:03                 644
intlbreakiterator.isboundary.atom                  16-Jul-2024 06:03                 642
intlbreakiterator.last.atom                        16-Jul-2024 06:03                 713
intlbreakiterator.next.atom                        16-Jul-2024 06:03                 644
intlbreakiterator.preceding.atom                   16-Jul-2024 06:03                 714
intlbreakiterator.previous.atom                    16-Jul-2024 06:03                 712
intlbreakiterator.settext.atom                     16-Jul-2024 06:03                 635
intlcalendar.add.atom                              16-Jul-2024 06:03                 628
intlcalendar.after.atom                            16-Jul-2024 06:03                 692
intlcalendar.before.atom                           16-Jul-2024 06:03                 682
intlcalendar.clear.atom                            16-Jul-2024 06:03                 591
intlcalendar.construct.atom                        16-Jul-2024 06:03                 663
intlcalendar.createinstance.atom                   16-Jul-2024 06:03                 636
intlcalendar.equals.atom                           16-Jul-2024 06:03                 636
intlcalendar.fielddifference.atom                  16-Jul-2024 06:03                 687
intlcalendar.fromdatetime.atom                     16-Jul-2024 06:03                 641
intlcalendar.get.atom                              16-Jul-2024 06:03                 642
intlcalendar.getactualmaximum.atom                 16-Jul-2024 06:03                 667
intlcalendar.getactualminimum.atom                 16-Jul-2024 06:03                 667
intlcalendar.getavailablelocales.atom              16-Jul-2024 06:03                 651
intlcalendar.getdayofweektype.atom                 16-Jul-2024 06:03                 685
intlcalendar.geterrorcode.atom                     16-Jul-2024 06:03                 619
intlcalendar.geterrormessage.atom                  16-Jul-2024 06:03                 631
intlcalendar.getfirstdayofweek.atom                16-Jul-2024 06:03                 657
intlcalendar.getgreatestminimum.atom               16-Jul-2024 06:03                 651
intlcalendar.getkeywordvaluesforlocale.atom        16-Jul-2024 06:03                 657
intlcalendar.getleastmaximum.atom                  16-Jul-2024 06:03                 637
intlcalendar.getlocale.atom                        16-Jul-2024 06:03                 618
intlcalendar.getmaximum.atom                       16-Jul-2024 06:03                 620
intlcalendar.getminimaldaysinfirstweek.atom        16-Jul-2024 06:03                 694
intlcalendar.getminimum.atom                       16-Jul-2024 06:03                 620
intlcalendar.getnow.atom                           16-Jul-2024 06:03                 649
intlcalendar.getrepeatedwalltimeoption.atom        16-Jul-2024 06:03                 670
intlcalendar.getskippedwalltimeoption.atom         16-Jul-2024 06:03                 665
intlcalendar.gettime.atom                          16-Jul-2024 06:03                 615
intlcalendar.gettimezone.atom                      16-Jul-2024 06:03                 647
intlcalendar.gettype.atom                          16-Jul-2024 06:03                 623
intlcalendar.getweekendtransition.atom             16-Jul-2024 06:03                 661
intlcalendar.indaylighttime.atom                   16-Jul-2024 06:03                 646
intlcalendar.isequivalentto.atom                   16-Jul-2024 06:03                 650
intlcalendar.islenient.atom                        16-Jul-2024 06:03                 628
intlcalendar.isset.atom                            16-Jul-2024 06:03                 587
intlcalendar.isweekend.atom                        16-Jul-2024 06:03                 622
intlcalendar.roll.atom                             16-Jul-2024 06:03                 626
intlcalendar.set.atom                              16-Jul-2024 06:03                 608
intlcalendar.setdate.atom                          16-Jul-2024 06:03                 588
intlcalendar.setdatetime.atom                      16-Jul-2024 06:03                 609
intlcalendar.setfirstdayofweek.atom                16-Jul-2024 06:03                 660
intlcalendar.setlenient.atom                       16-Jul-2024 06:03                 633
intlcalendar.setminimaldaysinfirstweek.atom        16-Jul-2024 06:03                 694
intlcalendar.setrepeatedwalltimeoption.atom        16-Jul-2024 06:03                 711
intlcalendar.setskippedwalltimeoption.atom         16-Jul-2024 06:03                 706
intlcalendar.settime.atom                          16-Jul-2024 06:03                 659
intlcalendar.settimezone.atom                      16-Jul-2024 06:03                 655
intlcalendar.todatetime.atom                       16-Jul-2024 06:03                 631
intlchar.charage.atom                              16-Jul-2024 06:03                 608
intlchar.chardigitvalue.atom                       16-Jul-2024 06:03                 636
intlchar.chardirection.atom                        16-Jul-2024 06:03                 626
intlchar.charfromname.atom                         16-Jul-2024 06:03                 636
intlchar.charmirror.atom                           16-Jul-2024 06:03                 635
intlchar.charname.atom                             16-Jul-2024 06:03                 602
intlchar.chartype.atom                             16-Jul-2024 06:03                 609
intlchar.chr.atom                                  16-Jul-2024 06:03                 591
intlchar.digit.atom                                16-Jul-2024 06:03                 614
intlchar.enumcharnames.atom                        16-Jul-2024 06:03                 633
intlchar.enumchartypes.atom                        16-Jul-2024 06:03                 640
intlchar.foldcase.atom                             16-Jul-2024 06:03                 598
intlchar.fordigit.atom                             16-Jul-2024 06:03                 618
intlchar.getbidipairedbracket.atom                 16-Jul-2024 06:03                 647
intlchar.getblockcode.atom                         16-Jul-2024 06:03                 630
intlchar.getcombiningclass.atom                    16-Jul-2024 06:03                 628
intlchar.getfc-nfkc-closure.atom                   16-Jul-2024 06:03                 641
intlchar.getintpropertymaxvalue.atom               16-Jul-2024 06:03                 644
intlchar.getintpropertyminvalue.atom               16-Jul-2024 06:03                 644
intlchar.getintpropertyvalue.atom                  16-Jul-2024 06:03                 648
intlchar.getnumericvalue.atom                      16-Jul-2024 06:03                 629
intlchar.getpropertyenum.atom                      16-Jul-2024 06:03                 640
intlchar.getpropertyname.atom                      16-Jul-2024 06:03                 618
intlchar.getpropertyvalueenum.atom                 16-Jul-2024 06:03                 643
intlchar.getpropertyvaluename.atom                 16-Jul-2024 06:03                 639
intlchar.getunicodeversion.atom                    16-Jul-2024 06:03                 612
intlchar.hasbinaryproperty.atom                    16-Jul-2024 06:03                 637
intlchar.isalnum.atom                              16-Jul-2024 06:03                 607
intlchar.isalpha.atom                              16-Jul-2024 06:03                 600
intlchar.isbase.atom                               16-Jul-2024 06:03                 595
intlchar.isblank.atom                              16-Jul-2024 06:03                 659
intlchar.iscntrl.atom                              16-Jul-2024 06:03                 601
intlchar.isdefined.atom                            16-Jul-2024 06:03                 604
intlchar.isdigit.atom                              16-Jul-2024 06:03                 599
intlchar.isgraph.atom                              16-Jul-2024 06:03                 601
intlchar.isidignorable.atom                        16-Jul-2024 06:03                 622
intlchar.isidpart.atom                             16-Jul-2024 06:03                 613
intlchar.isidstart.atom                            16-Jul-2024 06:03                 639
intlchar.isisocontrol.atom                         16-Jul-2024 06:03                 616
intlchar.isjavaidpart.atom                         16-Jul-2024 06:03                 629
intlchar.isjavaidstart.atom                        16-Jul-2024 06:03                 655
intlchar.isjavaspacechar.atom                      16-Jul-2024 06:03                 641
intlchar.islower.atom                              16-Jul-2024 06:03                 600
intlchar.ismirrored.atom                           16-Jul-2024 06:03                 618
intlchar.isprint.atom                              16-Jul-2024 06:03                 603
intlchar.ispunct.atom                              16-Jul-2024 06:03                 603
intlchar.isspace.atom                              16-Jul-2024 06:03                 599
intlchar.istitle.atom                              16-Jul-2024 06:03                 600
intlchar.isualphabetic.atom                        16-Jul-2024 06:03                 632
intlchar.isulowercase.atom                         16-Jul-2024 06:03                 628
intlchar.isupper.atom                              16-Jul-2024 06:03                 645
intlchar.isuuppercase.atom                         16-Jul-2024 06:03                 628
intlchar.isuwhitespace.atom                        16-Jul-2024 06:03                 633
intlchar.iswhitespace.atom                         16-Jul-2024 06:03                 636
intlchar.isxdigit.atom                             16-Jul-2024 06:03                 604
intlchar.ord.atom                                  16-Jul-2024 06:03                 591
intlchar.tolower.atom                              16-Jul-2024 06:03                 591
intlchar.totitle.atom                              16-Jul-2024 06:03                 591
intlchar.toupper.atom                              16-Jul-2024 06:03                 591
intlcodepointbreakiterator.getlastcodepoint.atom   16-Jul-2024 06:03                 790
intldateformatter.create.atom                      16-Jul-2024 06:03                 619
intldateformatter.format.atom                      16-Jul-2024 06:03                 645
intldateformatter.formatobject.atom                16-Jul-2024 06:03                 617
intldateformatter.getcalendar.atom                 16-Jul-2024 06:03                 669
intldateformatter.getcalendarobject.atom           16-Jul-2024 06:03                 696
intldateformatter.getdatetype.atom                 16-Jul-2024 06:03                 658
intldateformatter.geterrorcode.atom                16-Jul-2024 06:03                 673
intldateformatter.geterrormessage.atom             16-Jul-2024 06:03                 646
intldateformatter.getlocale.atom                   16-Jul-2024 06:03                 642
intldateformatter.getpattern.atom                  16-Jul-2024 06:03                 660
intldateformatter.gettimetype.atom                 16-Jul-2024 06:03                 641
intldateformatter.gettimezone.atom                 16-Jul-2024 06:03                 672
intldateformatter.gettimezoneid.atom               16-Jul-2024 06:03                 646
intldateformatter.islenient.atom                   16-Jul-2024 06:03                 688
intldateformatter.localtime.atom                   16-Jul-2024 06:03                 645
intldateformatter.parse.atom                       16-Jul-2024 06:03                 626
intldateformatter.setcalendar.atom                 16-Jul-2024 06:03                 674
intldateformatter.setlenient.atom                  16-Jul-2024 06:03                 637
intldateformatter.setpattern.atom                  16-Jul-2024 06:03                 669
intldateformatter.settimezone.atom                 16-Jul-2024 06:03                 665
intldatepatterngenerator.create.atom               16-Jul-2024 06:03                 651
intldatepatterngenerator.getbestpattern.atom       16-Jul-2024 06:03                 673
intlgregoriancalendar.construct.atom               16-Jul-2024 06:03                 639
intlgregoriancalendar.createfromdate.atom          16-Jul-2024 06:03                 672
intlgregoriancalendar.createfromdatetime.atom      16-Jul-2024 06:03                 693
intlgregoriancalendar.getgregorianchange.atom      16-Jul-2024 06:03                 669
intlgregoriancalendar.isleapyear.atom              16-Jul-2024 06:03                 649
intlgregoriancalendar.setgregorianchange.atom      16-Jul-2024 06:03                 673
intliterator.current.atom                          16-Jul-2024 06:03                 646
intliterator.key.atom                              16-Jul-2024 06:03                 616
intliterator.next.atom                             16-Jul-2024 06:03                 632
intliterator.rewind.atom                           16-Jul-2024 06:03                 650
intliterator.valid.atom                            16-Jul-2024 06:03                 617
intlpartsiterator.getbreakiterator.atom            16-Jul-2024 06:03                 725
intlrulebasedbreakiterator.construct.atom          16-Jul-2024 06:03                 693
intlrulebasedbreakiterator.getbinaryrules.atom     16-Jul-2024 06:03                 724
intlrulebasedbreakiterator.getrules.atom           16-Jul-2024 06:03                 725
intlrulebasedbreakiterator.getrulestatus.atom      16-Jul-2024 06:03                 799
intlrulebasedbreakiterator.getrulestatusvec.atom   16-Jul-2024 06:03                 819
intltimezone.construct.atom                        16-Jul-2024 06:03                 629
intltimezone.countequivalentids.atom               16-Jul-2024 06:03                 728
intltimezone.createdefault.atom                    16-Jul-2024 06:03                 687
intltimezone.createenumeration.atom                16-Jul-2024 06:03                 738
intltimezone.createtimezone.atom                   16-Jul-2024 06:03                 656
intltimezone.createtimezoneidenumeration.atom      16-Jul-2024 06:03                 708
intltimezone.fromdatetimezone.atom                 16-Jul-2024 06:03                 657
intltimezone.getcanonicalid.atom                   16-Jul-2024 06:03                 803
intltimezone.getdisplayname.atom                   16-Jul-2024 06:03                 715
intltimezone.getdstsavings.atom                    16-Jul-2024 06:03                 757
intltimezone.getequivalentid.atom                  16-Jul-2024 06:03                 724
intltimezone.geterrorcode.atom                     16-Jul-2024 06:03                 683
intltimezone.geterrormessage.atom                  16-Jul-2024 06:03                 695
intltimezone.getgmt.atom                           16-Jul-2024 06:03                 611
intltimezone.getid.atom                            16-Jul-2024 06:03                 630
intltimezone.getidforwindowsid.atom                16-Jul-2024 06:03                 652
intltimezone.getoffset.atom                        16-Jul-2024 06:03                 700
intltimezone.getrawoffset.atom                     16-Jul-2024 06:03                 716
intltimezone.getregion.atom                        16-Jul-2024 06:03                 642
intltimezone.gettzdataversion.atom                 16-Jul-2024 06:03                 697
intltimezone.getunknown.atom                       16-Jul-2024 06:03                 625
intltimezone.getwindowsid.atom                     16-Jul-2024 06:03                 637
intltimezone.hassamerules.atom                     16-Jul-2024 06:03                 676
intltimezone.todatetimezone.atom                   16-Jul-2024 06:03                 623
intltimezone.usedaylighttime.atom                  16-Jul-2024 06:03                 689
intro-whatcando.atom                               16-Jul-2024 06:03                 576
intro-whatis.atom                                  16-Jul-2024 06:03                 570
intro.apache.atom                                  16-Jul-2024 06:03                 559
intro.apcu.atom                                    16-Jul-2024 06:03                 553
intro.array.atom                                   16-Jul-2024 06:03                 556
intro.bc.atom                                      16-Jul-2024 06:03                 547
intro.bzip2.atom                                   16-Jul-2024 06:03                 556
intro.calendar.atom                                16-Jul-2024 06:03                 565
intro.classobj.atom                                16-Jul-2024 06:03                 565
intro.cmark.atom                                   16-Jul-2024 06:03                 556
intro.com.atom                                     16-Jul-2024 06:03                 550
intro.componere.atom                               16-Jul-2024 06:03                 568
intro.ctype.atom                                   16-Jul-2024 06:03                 556
intro.cubrid.atom                                  16-Jul-2024 06:03                 559
intro.curl.atom                                    16-Jul-2024 06:03                 553
intro.datetime.atom                                16-Jul-2024 06:03                 565
intro.dba.atom                                     16-Jul-2024 06:03                 550
intro.dbase.atom                                   16-Jul-2024 06:03                 556
intro.dio.atom                                     16-Jul-2024 06:03                 550
intro.dom.atom                                     16-Jul-2024 06:03                 550
intro.ds.atom                                      16-Jul-2024 06:03                 547
intro.eio.atom                                     16-Jul-2024 06:03                 550
intro.enchant.atom                                 16-Jul-2024 06:03                 562
intro.errorfunc.atom                               16-Jul-2024 06:03                 568
intro.ev.atom                                      16-Jul-2024 06:03                 547
intro.event.atom                                   16-Jul-2024 06:03                 556
intro.exec.atom                                    16-Jul-2024 06:03                 553
intro.exif.atom                                    16-Jul-2024 06:03                 553
intro.expect.atom                                  16-Jul-2024 06:03                 559
intro.fann.atom                                    16-Jul-2024 06:03                 553
intro.fdf.atom                                     16-Jul-2024 06:03                 550
intro.ffi.atom                                     16-Jul-2024 06:03                 550
intro.fileinfo.atom                                16-Jul-2024 06:03                 565
intro.filesystem.atom                              16-Jul-2024 06:03                 571
intro.filter.atom                                  16-Jul-2024 06:03                 559
intro.fpm.atom                                     16-Jul-2024 06:03                 550
intro.ftp.atom                                     16-Jul-2024 06:03                 550
intro.funchand.atom                                16-Jul-2024 06:03                 565
intro.gearman.atom                                 16-Jul-2024 06:03                 562
intro.gender.atom                                  16-Jul-2024 06:03                 559
intro.geoip.atom                                   16-Jul-2024 06:03                 556
intro.gettext.atom                                 16-Jul-2024 06:03                 562
intro.gmagick.atom                                 16-Jul-2024 06:03                 562
intro.gmp.atom                                     16-Jul-2024 06:03                 550
intro.gnupg.atom                                   16-Jul-2024 06:03                 556
intro.hash.atom                                    16-Jul-2024 06:03                 553
intro.hrtime.atom                                  16-Jul-2024 06:03                 559
intro.ibase.atom                                   16-Jul-2024 06:03                 556
intro.ibm-db2.atom                                 16-Jul-2024 06:03                 562
intro.iconv.atom                                   16-Jul-2024 06:03                 556
intro.igbinary.atom                                16-Jul-2024 06:03                 565
intro.image.atom                                   16-Jul-2024 06:03                 556
intro.imagick.atom                                 16-Jul-2024 06:03                 562
intro.imap.atom                                    16-Jul-2024 06:03                 553
intro.info.atom                                    16-Jul-2024 06:03                 553
intro.inotify.atom                                 16-Jul-2024 06:03                 562
intro.intl.atom                                    16-Jul-2024 06:03                 553
intro.json.atom                                    16-Jul-2024 06:03                 553
intro.ldap.atom                                    16-Jul-2024 06:03                 553
intro.libxml.atom                                  16-Jul-2024 06:03                 559
intro.lua.atom                                     16-Jul-2024 06:03                 550
intro.luasandbox.atom                              16-Jul-2024 06:03                 571
intro.lzf.atom                                     16-Jul-2024 06:03                 550
intro.mail.atom                                    16-Jul-2024 06:03                 553
intro.mailparse.atom                               16-Jul-2024 06:03                 568
intro.math.atom                                    16-Jul-2024 06:03                 553
intro.mbstring.atom                                16-Jul-2024 06:03                 565
intro.mcrypt.atom                                  16-Jul-2024 06:03                 559
intro.memcache.atom                                16-Jul-2024 06:03                 565
intro.memcached.atom                               16-Jul-2024 06:03                 568
intro.mhash.atom                                   16-Jul-2024 06:03                 556
intro.misc.atom                                    16-Jul-2024 06:03                 553
intro.mqseries.atom                                16-Jul-2024 06:03                 565
intro.mysql-xdevapi.atom                           16-Jul-2024 06:03                 580
intro.mysql.atom                                   16-Jul-2024 06:03                 556
intro.mysqli.atom                                  16-Jul-2024 06:03                 559
intro.mysqlnd.atom                                 16-Jul-2024 06:03                 562
intro.network.atom                                 16-Jul-2024 06:03                 562
intro.oauth.atom                                   16-Jul-2024 06:03                 556
intro.oci8.atom                                    16-Jul-2024 06:03                 553
intro.opcache.atom                                 16-Jul-2024 06:03                 562
intro.openal.atom                                  16-Jul-2024 06:03                 559
intro.openssl.atom                                 16-Jul-2024 06:03                 562
intro.outcontrol.atom                              16-Jul-2024 06:03                 571
intro.parallel.atom                                16-Jul-2024 06:03                 565
intro.parle.atom                                   16-Jul-2024 06:03                 556
intro.password.atom                                16-Jul-2024 06:03                 565
intro.pcntl.atom                                   16-Jul-2024 06:03                 556
intro.pcre.atom                                    16-Jul-2024 06:03                 553
intro.pdo.atom                                     16-Jul-2024 06:03                 550
intro.pgsql.atom                                   16-Jul-2024 06:03                 556
intro.phar.atom                                    16-Jul-2024 06:03                 553
intro.phpdbg.atom                                  16-Jul-2024 06:03                 559
intro.posix.atom                                   16-Jul-2024 06:03                 556
intro.ps.atom                                      16-Jul-2024 06:03                 547
intro.pspell.atom                                  16-Jul-2024 06:03                 559
intro.pthreads.atom                                16-Jul-2024 06:03                 565
intro.quickhash.atom                               16-Jul-2024 06:03                 568
intro.radius.atom                                  16-Jul-2024 06:03                 559
intro.random.atom                                  16-Jul-2024 06:03                 559
intro.rar.atom                                     16-Jul-2024 06:03                 550
intro.readline.atom                                16-Jul-2024 06:03                 565
intro.recode.atom                                  16-Jul-2024 06:03                 559
intro.reflection.atom                              16-Jul-2024 06:03                 571
intro.rnp.atom                                     16-Jul-2024 06:03                 550
intro.rpminfo.atom                                 16-Jul-2024 06:03                 562
intro.rrd.atom                                     16-Jul-2024 06:03                 550
intro.runkit7.atom                                 16-Jul-2024 06:03                 562
intro.scoutapm.atom                                16-Jul-2024 06:03                 565
intro.seaslog.atom                                 16-Jul-2024 06:03                 562
intro.sem.atom                                     16-Jul-2024 06:03                 550
intro.session.atom                                 16-Jul-2024 06:03                 562
intro.shmop.atom                                   16-Jul-2024 06:03                 556
intro.simdjson.atom                                16-Jul-2024 06:03                 565
intro.simplexml.atom                               16-Jul-2024 06:03                 568
intro.snmp.atom                                    16-Jul-2024 06:03                 553
intro.soap.atom                                    16-Jul-2024 06:03                 553
intro.sockets.atom                                 16-Jul-2024 06:03                 562
intro.sodium.atom                                  16-Jul-2024 06:03                 559
intro.solr.atom                                    16-Jul-2024 06:03                 553
intro.spl.atom                                     16-Jul-2024 06:03                 550
intro.sqlite3.atom                                 16-Jul-2024 06:03                 562
intro.sqlsrv.atom                                  16-Jul-2024 06:03                 559
intro.ssdeep.atom                                  16-Jul-2024 06:03                 559
intro.ssh2.atom                                    16-Jul-2024 06:03                 553
intro.stats.atom                                   16-Jul-2024 06:03                 556
intro.stomp.atom                                   16-Jul-2024 06:03                 556
intro.stream.atom                                  16-Jul-2024 06:03                 559
intro.strings.atom                                 16-Jul-2024 06:03                 562
intro.svm.atom                                     16-Jul-2024 06:03                 550
intro.svn.atom                                     16-Jul-2024 06:03                 550
intro.swoole.atom                                  16-Jul-2024 06:03                 559
intro.sync.atom                                    16-Jul-2024 06:03                 553
intro.taint.atom                                   16-Jul-2024 06:03                 556
intro.tcpwrap.atom                                 16-Jul-2024 06:03                 562
intro.tidy.atom                                    16-Jul-2024 06:03                 553
intro.tokenizer.atom                               16-Jul-2024 06:03                 568
intro.trader.atom                                  16-Jul-2024 06:03                 559
intro.ui.atom                                      16-Jul-2024 06:03                 547
intro.uodbc.atom                                   16-Jul-2024 06:03                 556
intro.uopz.atom                                    16-Jul-2024 06:03                 553
intro.url.atom                                     16-Jul-2024 06:03                 550
intro.v8js.atom                                    16-Jul-2024 06:03                 553
intro.var.atom                                     16-Jul-2024 06:03                 550
intro.var_representation.atom                      16-Jul-2024 06:03                 595
intro.varnish.atom                                 16-Jul-2024 06:03                 562
intro.wddx.atom                                    16-Jul-2024 06:03                 553
intro.win32service.atom                            16-Jul-2024 06:03                 577
intro.wincache.atom                                16-Jul-2024 06:03                 565
intro.wkhtmltox.atom                               16-Jul-2024 06:03                 568
intro.xattr.atom                                   16-Jul-2024 06:03                 556
intro.xdiff.atom                                   16-Jul-2024 06:03                 556
intro.xhprof.atom                                  16-Jul-2024 06:03                 559
intro.xlswriter.atom                               16-Jul-2024 06:03                 568
intro.xml.atom                                     16-Jul-2024 06:03                 550
intro.xmldiff.atom                                 16-Jul-2024 06:03                 562
intro.xmlreader.atom                               16-Jul-2024 06:03                 568
intro.xmlrpc.atom                                  16-Jul-2024 06:03                 559
intro.xmlwriter.atom                               16-Jul-2024 06:03                 568
intro.xsl.atom                                     16-Jul-2024 06:03                 550
intro.yac.atom                                     16-Jul-2024 06:03                 550
intro.yaconf.atom                                  16-Jul-2024 06:03                 559
intro.yaf.atom                                     16-Jul-2024 06:03                 550
intro.yaml.atom                                    16-Jul-2024 06:03                 553
intro.yar.atom                                     16-Jul-2024 06:03                 550
intro.yaz.atom                                     16-Jul-2024 06:03                 550
intro.zip.atom                                     16-Jul-2024 06:03                 550
intro.zlib.atom                                    16-Jul-2024 06:03                 553
intro.zmq.atom                                     16-Jul-2024 06:03                 550
intro.zookeeper.atom                               16-Jul-2024 06:03                 568
introduction.atom                                  16-Jul-2024 06:03                1007
iterator.current.atom                              16-Jul-2024 06:03                 612
iterator.key.atom                                  16-Jul-2024 06:03                 621
iterator.next.atom                                 16-Jul-2024 06:03                 620
iterator.rewind.atom                               16-Jul-2024 06:03                 636
iterator.valid.atom                                16-Jul-2024 06:03                 606
iteratoraggregate.getiterator.atom                 16-Jul-2024 06:03                 638
iteratoriterator.construct.atom                    16-Jul-2024 06:03                 676
iteratoriterator.current.atom                      16-Jul-2024 06:03                 605
iteratoriterator.getinneriterator.atom             16-Jul-2024 06:03                 654
iteratoriterator.key.atom                          16-Jul-2024 06:03                 640
iteratoriterator.next.atom                         16-Jul-2024 06:03                 622
iteratoriterator.rewind.atom                       16-Jul-2024 06:03                 629
iteratoriterator.valid.atom                        16-Jul-2024 06:03                 653
json.constants.atom                                16-Jul-2024 06:03                 598
json.installation.atom                             16-Jul-2024 06:03                 574
json.resources.atom                                16-Jul-2024 06:03                 572
json.setup.atom                                    16-Jul-2024 06:03                1016
jsonserializable.jsonserialize.atom                16-Jul-2024 06:03                 712
langref.atom                                       16-Jul-2024 06:03                6007
language.attributes.atom                           16-Jul-2024 06:03                1647
language.attributes.classes.atom                   16-Jul-2024 06:03                 643
language.attributes.overview.atom                  16-Jul-2024 06:03                 626
language.attributes.reflection.atom                16-Jul-2024 06:03                 652
language.attributes.syntax.atom                    16-Jul-2024 06:03                 610
language.basic-syntax.atom                         16-Jul-2024 06:03                1658
language.basic-syntax.comments.atom                16-Jul-2024 06:03                 613
language.basic-syntax.instruction-separation.atom  16-Jul-2024 06:03                 681
language.basic-syntax.phpmode.atom                 16-Jul-2024 06:03                 635
language.basic-syntax.phptags.atom                 16-Jul-2024 06:03                 609
language.constants.atom                            16-Jul-2024 06:03                1330
language.constants.magic.atom                      16-Jul-2024 06:03                 602
language.constants.predefined.atom                 16-Jul-2024 06:03                 641
language.constants.syntax.atom                     16-Jul-2024 06:03                 593
language.control-structures.atom                   16-Jul-2024 06:03                5275
language.enumerations.atom                         16-Jul-2024 06:03                4218
language.enumerations.backed.atom                  16-Jul-2024 06:03                 639
language.enumerations.basics.atom                  16-Jul-2024 06:03                 637
language.enumerations.constants.atom               16-Jul-2024 06:03                 655
language.enumerations.examples.atom                16-Jul-2024 06:03                 609
language.enumerations.expressions.atom             16-Jul-2024 06:03                 690
language.enumerations.listing.atom                 16-Jul-2024 06:03                 614
language.enumerations.methods.atom                 16-Jul-2024 06:03                 658
language.enumerations.object-differences.atom      16-Jul-2024 06:03                 669
language.enumerations.object-differences.inheri..> 16-Jul-2024 06:03                 709
language.enumerations.overview.atom                16-Jul-2024 06:03                 657
language.enumerations.serialization.atom           16-Jul-2024 06:03                 640
language.enumerations.static-methods.atom          16-Jul-2024 06:03                 678
language.enumerations.traits.atom                  16-Jul-2024 06:03                 601
language.errors.atom                               16-Jul-2024 06:03                1028
language.errors.basics.atom                        16-Jul-2024 06:03                 582
language.errors.php7.atom                          16-Jul-2024 06:03                 591
language.exceptions.atom                           16-Jul-2024 06:03                 840
language.exceptions.extending.atom                 16-Jul-2024 06:03                 620
language.expressions.atom                          16-Jul-2024 06:03                 586
language.fibers.atom                               16-Jul-2024 06:03                 562
language.functions.atom                            16-Jul-2024 06:03                2590
language.generators.atom                           16-Jul-2024 06:03                1437
language.generators.comparison.atom                16-Jul-2024 06:03                 675
language.generators.overview.atom                  16-Jul-2024 06:03                 665
language.generators.syntax.atom                    16-Jul-2024 06:03                 639
language.namespaces.atom                           16-Jul-2024 06:03                4179
language.namespaces.basics.atom                    16-Jul-2024 06:03                 635
language.namespaces.definition.atom                16-Jul-2024 06:03                 642
language.namespaces.definitionmultiple.atom        16-Jul-2024 06:03                 706
language.namespaces.dynamic.atom                   16-Jul-2024 06:03                 628
language.namespaces.fallback.atom                  16-Jul-2024 06:03                 697
language.namespaces.faq.atom                       16-Jul-2024 06:03                 646
language.namespaces.global.atom                    16-Jul-2024 06:03                 610
language.namespaces.importing.atom                 16-Jul-2024 06:03                 652
language.namespaces.nested.atom                    16-Jul-2024 06:03                 641
language.namespaces.nsconstants.atom               16-Jul-2024 06:03                 655
language.namespaces.rationale.atom                 16-Jul-2024 06:03                 630
language.namespaces.rules.atom                     16-Jul-2024 06:03                 637
language.oop5.abstract.atom                        16-Jul-2024 06:03                 599
language.oop5.anonymous.atom                       16-Jul-2024 06:03                 596
language.oop5.atom                                 16-Jul-2024 06:03                6867
language.oop5.autoload.atom                        16-Jul-2024 06:03                 603
language.oop5.basic.atom                           16-Jul-2024 06:03                 583
language.oop5.changelog.atom                       16-Jul-2024 06:03                 642
language.oop5.cloning.atom                         16-Jul-2024 06:03                 595
language.oop5.constants.atom                       16-Jul-2024 06:03                 600
language.oop5.decon.atom                           16-Jul-2024 06:03                 597
language.oop5.final.atom                           16-Jul-2024 06:03                 612
language.oop5.inheritance.atom                     16-Jul-2024 06:03                 605
language.oop5.interfaces.atom                      16-Jul-2024 06:03                 593
language.oop5.iterations.atom                      16-Jul-2024 06:03                 605
language.oop5.late-static-bindings.atom            16-Jul-2024 06:03                 699
language.oop5.magic.atom                           16-Jul-2024 06:03                 596
language.oop5.object-comparison.atom               16-Jul-2024 06:03                 629
language.oop5.overloading.atom                     16-Jul-2024 06:03                 603
language.oop5.paamayim-nekudotayim.atom            16-Jul-2024 06:03                 691
language.oop5.properties.atom                      16-Jul-2024 06:03                 615
language.oop5.references.atom                      16-Jul-2024 06:03                 625
language.oop5.serialization.atom                   16-Jul-2024 06:03                 648
language.oop5.static.atom                          16-Jul-2024 06:03                 579
language.oop5.traits.atom                          16-Jul-2024 06:03                 577
language.oop5.variance.atom                        16-Jul-2024 06:03                 605
language.oop5.visibility.atom                      16-Jul-2024 06:03                 604
language.operators.arithmetic.atom                 16-Jul-2024 06:03                 648
language.operators.array.atom                      16-Jul-2024 06:03                 616
language.operators.assignment.atom                 16-Jul-2024 06:03                 642
language.operators.atom                            16-Jul-2024 06:03                4033
language.operators.bitwise.atom                    16-Jul-2024 06:03                 623
language.operators.comparison.atom                 16-Jul-2024 06:03                 634
language.operators.errorcontrol.atom               16-Jul-2024 06:03                 660
language.operators.execution.atom                  16-Jul-2024 06:03                 643
language.operators.increment.atom                  16-Jul-2024 06:03                 689
language.operators.logical.atom                    16-Jul-2024 06:03                 623
language.operators.precedence.atom                 16-Jul-2024 06:03                 646
language.operators.string.atom                     16-Jul-2024 06:03                 653
language.operators.type.atom                       16-Jul-2024 06:03                 610
language.references.arent.atom                     16-Jul-2024 06:03                 641
language.references.atom                           16-Jul-2024 06:03                2490
language.references.pass.atom                      16-Jul-2024 06:03                 626
language.references.return.atom                    16-Jul-2024 06:03                 635
language.references.spot.atom                      16-Jul-2024 06:03                 637
language.references.unset.atom                     16-Jul-2024 06:03                 641
language.references.whatare.atom                   16-Jul-2024 06:03                 652
language.references.whatdo.atom                    16-Jul-2024 06:03                 636
language.types.array.atom                          16-Jul-2024 06:03                 583
language.types.atom                                16-Jul-2024 06:03                5656
language.types.boolean.atom                        16-Jul-2024 06:03                 595
language.types.callable.atom                       16-Jul-2024 06:03                 616
language.types.declarations.atom                   16-Jul-2024 06:03                 623
language.types.enumerations.atom                   16-Jul-2024 06:03                 630
language.types.float.atom                          16-Jul-2024 06:03                 611
language.types.integer.atom                        16-Jul-2024 06:03                 588
language.types.intro.atom                          16-Jul-2024 06:03                 583
language.types.iterable.atom                       16-Jul-2024 06:03                 600
language.types.mixed.atom                          16-Jul-2024 06:03                 576
language.types.never.atom                          16-Jul-2024 06:03                 576
language.types.null.atom                           16-Jul-2024 06:03                 572
language.types.numeric-strings.atom                16-Jul-2024 06:03                 640
language.types.object.atom                         16-Jul-2024 06:03                 584
language.types.relative-class-types.atom           16-Jul-2024 06:03                 642
language.types.resource.atom                       16-Jul-2024 06:03                 594
language.types.string.atom                         16-Jul-2024 06:03                 620
language.types.type-juggling.atom                  16-Jul-2024 06:03                 611
language.types.type-system.atom                    16-Jul-2024 06:03                 615
language.types.value.atom                          16-Jul-2024 06:03                 586
language.types.void.atom                           16-Jul-2024 06:03                 572
language.variables.atom                            16-Jul-2024 06:03                1859
language.variables.basics.atom                     16-Jul-2024 06:03                 595
language.variables.external.atom                   16-Jul-2024 06:03                 627
language.variables.predefined.atom                 16-Jul-2024 06:03                 642
language.variables.scope.atom                      16-Jul-2024 06:03                 614
language.variables.superglobals.atom               16-Jul-2024 06:03                 683
language.variables.variable.atom                   16-Jul-2024 06:03                 616
ldap.configuration.atom                            16-Jul-2024 06:03                 619
ldap.constants.atom                                16-Jul-2024 06:03                 598
ldap.controls.atom                                 16-Jul-2024 06:03                 563
ldap.examples-basic.atom                           16-Jul-2024 06:03                 586
ldap.examples-controls.atom                        16-Jul-2024 06:03                 590
ldap.examples.atom                                 16-Jul-2024 06:03                1027
ldap.installation.atom                             16-Jul-2024 06:03                 574
ldap.requirements.atom                             16-Jul-2024 06:03                 583
ldap.resources.atom                                16-Jul-2024 06:03                 572
ldap.setup.atom                                    16-Jul-2024 06:03                1500
ldap.using.atom                                    16-Jul-2024 06:03                 575
libxml.constants.atom                              16-Jul-2024 06:03                 604
libxml.installation.atom                           16-Jul-2024 06:03                 619
libxml.installation_old.atom                       16-Jul-2024 06:03                 630
libxml.requirements.atom                           16-Jul-2024 06:03                 589
libxml.resources.atom                              16-Jul-2024 06:03                 578
libxml.setup.atom                                  16-Jul-2024 06:03                1568
limititerator.construct.atom                       16-Jul-2024 06:03                 619
limititerator.current.atom                         16-Jul-2024 06:03                 649
limititerator.getposition.atom                     16-Jul-2024 06:03                 615
limititerator.key.atom                             16-Jul-2024 06:03                 619
limititerator.next.atom                            16-Jul-2024 06:03                 645
limititerator.rewind.atom                          16-Jul-2024 06:03                 626
limititerator.seek.atom                            16-Jul-2024 06:03                 642
limititerator.valid.atom                           16-Jul-2024 06:03                 645
locale.acceptfromhttp.atom                         16-Jul-2024 06:03                 689
locale.canonicalize.atom                           16-Jul-2024 06:03                 630
locale.composelocale.atom                          16-Jul-2024 06:03                 612
locale.filtermatches.atom                          16-Jul-2024 06:03                 644
locale.getallvariants.atom                         16-Jul-2024 06:03                 618
locale.getdefault.atom                             16-Jul-2024 06:03                 667
locale.getdisplaylanguage.atom                     16-Jul-2024 06:03                 668
locale.getdisplayname.atom                         16-Jul-2024 06:03                 630
locale.getdisplayregion.atom                       16-Jul-2024 06:03                 634
locale.getdisplayscript.atom                       16-Jul-2024 06:03                 618
locale.getdisplayvariant.atom                      16-Jul-2024 06:03                 628
locale.getkeywords.atom                            16-Jul-2024 06:03                 605
locale.getprimarylanguage.atom                     16-Jul-2024 06:03                 623
locale.getregion.atom                              16-Jul-2024 06:03                 614
locale.getscript.atom                              16-Jul-2024 06:03                 603
locale.lookup.atom                                 16-Jul-2024 06:03                 593
locale.parselocale.atom                            16-Jul-2024 06:03                 626
locale.setdefault.atom                             16-Jul-2024 06:03                 603
lua.assign.atom                                    16-Jul-2024 06:03                 582
lua.call.atom                                      16-Jul-2024 06:03                 560
lua.construct.atom                                 16-Jul-2024 06:03                 566
lua.eval.atom                                      16-Jul-2024 06:03                 591
lua.getversion.atom                                16-Jul-2024 06:03                 573
lua.include.atom                                   16-Jul-2024 06:03                 576
lua.installation.atom                              16-Jul-2024 06:03                 571
lua.registercallback.atom                          16-Jul-2024 06:03                 605
lua.requirements.atom                              16-Jul-2024 06:03                 580
lua.resources.atom                                 16-Jul-2024 06:03                 569
lua.setup.atom                                     16-Jul-2024 06:03                1236
luaclosure.invoke.atom                             16-Jul-2024 06:03                 580
luasandbox.callfunction.atom                       16-Jul-2024 06:03                 620
luasandbox.disableprofiler.atom                    16-Jul-2024 06:03                 609
luasandbox.enableprofiler.atom                     16-Jul-2024 06:03                 606
luasandbox.examples-basic.atom                     16-Jul-2024 06:03                 612
luasandbox.examples.atom                           16-Jul-2024 06:03                 830
luasandbox.getcpuusage.atom                        16-Jul-2024 06:03                 632
luasandbox.getmemoryusage.atom                     16-Jul-2024 06:03                 639
luasandbox.getpeakmemoryusage.atom                 16-Jul-2024 06:03                 648
luasandbox.getprofilerfunctionreport.atom          16-Jul-2024 06:03                 638
luasandbox.getversioninfo.atom                     16-Jul-2024 06:03                 627
luasandbox.installation.atom                       16-Jul-2024 06:03                 592
luasandbox.loadbinary.atom                         16-Jul-2024 06:03                 630
luasandbox.loadstring.atom                         16-Jul-2024 06:03                 612
luasandbox.pauseusagetimer.atom                    16-Jul-2024 06:03                 614
luasandbox.registerlibrary.atom                    16-Jul-2024 06:03                 637
luasandbox.requirements.atom                       16-Jul-2024 06:03                 601
luasandbox.resources.atom                          16-Jul-2024 06:03                 590
luasandbox.setcpulimit.atom                        16-Jul-2024 06:03                 623
luasandbox.setmemorylimit.atom                     16-Jul-2024 06:03                 630
luasandbox.setup.atom                              16-Jul-2024 06:03                1299
luasandbox.unpauseusagetimer.atom                  16-Jul-2024 06:03                 650
luasandbox.wrapphpfunction.atom                    16-Jul-2024 06:03                 632
luasandboxfunction.call.atom                       16-Jul-2024 06:03                 599
luasandboxfunction.construct.atom                  16-Jul-2024 06:03                 601
luasandboxfunction.dump.atom                       16-Jul-2024 06:03                 614
lzf.installation.atom                              16-Jul-2024 06:03                 571
lzf.resources.atom                                 16-Jul-2024 06:03                 569
lzf.setup.atom                                     16-Jul-2024 06:03                1009
mail.configuration.atom                            16-Jul-2024 06:03                 619
mail.requirements.atom                             16-Jul-2024 06:03                 583
mail.resources.atom                                16-Jul-2024 06:03                 572
mail.setup.atom                                    16-Jul-2024 06:03                1276
mailparse.configuration.atom                       16-Jul-2024 06:03                 634
mailparse.constants.atom                           16-Jul-2024 06:03                 613
mailparse.installation.atom                        16-Jul-2024 06:03                 589
mailparse.resources.atom                           16-Jul-2024 06:03                 587
mailparse.setup.atom                               16-Jul-2024 06:03                1316
math.constants.atom                                16-Jul-2024 06:03                 598
math.resources.atom                                16-Jul-2024 06:03                 572
math.setup.atom                                    16-Jul-2024 06:03                 792
mbstring.configuration.atom                        16-Jul-2024 06:03                 631
mbstring.constants.atom                            16-Jul-2024 06:03                 610
mbstring.encodings.atom                            16-Jul-2024 06:03                 615
mbstring.http.atom                                 16-Jul-2024 06:03                 581
mbstring.installation.atom                         16-Jul-2024 06:03                 586
mbstring.ja-basic.atom                             16-Jul-2024 06:03                 600
mbstring.overload.atom                             16-Jul-2024 06:03                 615
mbstring.php4.req.atom                             16-Jul-2024 06:03                 608
mbstring.resources.atom                            16-Jul-2024 06:03                 584
mbstring.setup.atom                                16-Jul-2024 06:03                1307
mbstring.supported-encodings.atom                  16-Jul-2024 06:03                 645
mcrypt.ciphers.atom                                16-Jul-2024 06:03                 580
mcrypt.configuration.atom                          16-Jul-2024 06:03                 625
mcrypt.constants.atom                              16-Jul-2024 06:03                 604
mcrypt.installation.atom                           16-Jul-2024 06:03                 580
mcrypt.requirements.atom                           16-Jul-2024 06:03                 589
mcrypt.resources.atom                              16-Jul-2024 06:03                 578
mcrypt.setup.atom                                  16-Jul-2024 06:03                1522
memcache.add.atom                                  16-Jul-2024 06:03                 601
memcache.addserver.atom                            16-Jul-2024 06:03                 626
memcache.close.atom                                16-Jul-2024 06:03                 596
memcache.connect.atom                              16-Jul-2024 06:03                 603
memcache.constants.atom                            16-Jul-2024 06:03                 610
memcache.decrement.atom                            16-Jul-2024 06:03                 647
memcache.delete.atom                               16-Jul-2024 06:03                 615
memcache.examples-overview.atom                    16-Jul-2024 06:03                 608
memcache.examples.atom                             16-Jul-2024 06:03                 819
memcache.flush.atom                                16-Jul-2024 06:03                 632
memcache.get.atom                                  16-Jul-2024 06:03                 630
memcache.getextendedstats.atom                     16-Jul-2024 06:03                 668
memcache.getserverstatus.atom                      16-Jul-2024 06:03                 612
memcache.getstats.atom                             16-Jul-2024 06:03                 593
memcache.getversion.atom                           16-Jul-2024 06:03                 619
memcache.increment.atom                            16-Jul-2024 06:03                 635
memcache.ini.atom                                  16-Jul-2024 06:03                 601
memcache.installation.atom                         16-Jul-2024 06:03                 586
memcache.pconnect.atom                             16-Jul-2024 06:03                 625
memcache.replace.atom                              16-Jul-2024 06:03                 627
memcache.requirements.atom                         16-Jul-2024 06:03                 595
memcache.resources.atom                            16-Jul-2024 06:03                 584
memcache.set.atom                                  16-Jul-2024 06:03                 601
memcache.setcompressthreshold.atom                 16-Jul-2024 06:03                 650
memcache.setserverparams.atom                      16-Jul-2024 06:03                 678
memcache.setup.atom                                16-Jul-2024 06:03                1524
memcached.add.atom                                 16-Jul-2024 06:03                 629
memcached.addbykey.atom                            16-Jul-2024 06:03                 649
memcached.addserver.atom                           16-Jul-2024 06:03                 593
memcached.addservers.atom                          16-Jul-2024 06:03                 604
memcached.append.atom                              16-Jul-2024 06:03                 634
memcached.appendbykey.atom                         16-Jul-2024 06:03                 649
memcached.callbacks.atom                           16-Jul-2024 06:03                1140
memcached.callbacks.read-through.atom              16-Jul-2024 06:03                 653
memcached.callbacks.result.atom                    16-Jul-2024 06:03                 632
memcached.cas.atom                                 16-Jul-2024 06:03                 612
memcached.casbykey.atom                            16-Jul-2024 06:03                 642
memcached.configuration.atom                       16-Jul-2024 06:03                 634
memcached.constants.atom                           16-Jul-2024 06:03                 613
memcached.construct.atom                           16-Jul-2024 06:03                 602
memcached.decrement.atom                           16-Jul-2024 06:03                 632
memcached.decrementbykey.atom                      16-Jul-2024 06:03                 743
memcached.delete.atom                              16-Jul-2024 06:03                 598
memcached.deletebykey.atom                         16-Jul-2024 06:03                 655
memcached.deletemulti.atom                         16-Jul-2024 06:03                 623
memcached.deletemultibykey.atom                    16-Jul-2024 06:03                 678
memcached.expiration.atom                          16-Jul-2024 06:03                 605
memcached.fetch.atom                               16-Jul-2024 06:03                 591
memcached.fetchall.atom                            16-Jul-2024 06:03                 615
memcached.flush.atom                               16-Jul-2024 06:03                 613
memcached.get.atom                                 16-Jul-2024 06:03                 586
memcached.getallkeys.atom                          16-Jul-2024 06:03                 669
memcached.getbykey.atom                            16-Jul-2024 06:03                 638
memcached.getdelayed.atom                          16-Jul-2024 06:03                 615
memcached.getdelayedbykey.atom                     16-Jul-2024 06:03                 645
memcached.getmulti.atom                            16-Jul-2024 06:03                 609
memcached.getmultibykey.atom                       16-Jul-2024 06:03                 664
memcached.getoption.atom                           16-Jul-2024 06:03                 592
memcached.getresultcode.atom                       16-Jul-2024 06:03                 666
memcached.getresultmessage.atom                    16-Jul-2024 06:03                 699
memcached.getserverbykey.atom                      16-Jul-2024 06:03                 623
memcached.getserverlist.atom                       16-Jul-2024 06:03                 616
memcached.getstats.atom                            16-Jul-2024 06:03                 605
memcached.getversion.atom                          16-Jul-2024 06:03                 618
memcached.increment.atom                           16-Jul-2024 06:03                 647
memcached.incrementbykey.atom                      16-Jul-2024 06:03                 732
memcached.installation.atom                        16-Jul-2024 06:03                 589
memcached.ispersistent.atom                        16-Jul-2024 06:03                 670
memcached.ispristine.atom                          16-Jul-2024 06:03                 685
memcached.prepend.atom                             16-Jul-2024 06:03                 658
memcached.prependbykey.atom                        16-Jul-2024 06:03                 637
memcached.quit.atom                                16-Jul-2024 06:03                 589
memcached.replace.atom                             16-Jul-2024 06:03                 627
memcached.replacebykey.atom                        16-Jul-2024 06:03                 685
memcached.requirements.atom                        16-Jul-2024 06:03                 598
memcached.resetserverlist.atom                     16-Jul-2024 06:03                 641
memcached.resources.atom                           16-Jul-2024 06:03                 587
memcached.sessions.atom                            16-Jul-2024 06:03                 585
memcached.set.atom                                 16-Jul-2024 06:03                 589
memcached.setbykey.atom                            16-Jul-2024 06:03                 641
memcached.setmulti.atom                            16-Jul-2024 06:03                 612
memcached.setmultibykey.atom                       16-Jul-2024 06:03                 642
memcached.setoption.atom                           16-Jul-2024 06:03                 598
memcached.setoptions.atom                          16-Jul-2024 06:03                 610
memcached.setsaslauthdata.atom                     16-Jul-2024 06:03                 672
memcached.setup.atom                               16-Jul-2024 06:03                1555
memcached.touch.atom                               16-Jul-2024 06:03                 635
memcached.touchbykey.atom                          16-Jul-2024 06:03                 690
messageformatter.create.atom                       16-Jul-2024 06:03                 622
messageformatter.format.atom                       16-Jul-2024 06:03                 598
messageformatter.formatmessage.atom                16-Jul-2024 06:03                 630
messageformatter.geterrorcode.atom                 16-Jul-2024 06:03                 678
messageformatter.geterrormessage.atom              16-Jul-2024 06:03                 682
messageformatter.getlocale.atom                    16-Jul-2024 06:03                 685
messageformatter.getpattern.atom                   16-Jul-2024 06:03                 664
messageformatter.parse.atom                        16-Jul-2024 06:03                 638
messageformatter.parsemessage.atom                 16-Jul-2024 06:03                 637
messageformatter.setpattern.atom                   16-Jul-2024 06:03                 658
mhash.constants.atom                               16-Jul-2024 06:03                 601
mhash.examples.atom                                16-Jul-2024 06:03                 561
mhash.installation.atom                            16-Jul-2024 06:03                 577
mhash.requirements.atom                            16-Jul-2024 06:03                 586
mhash.resources.atom                               16-Jul-2024 06:03                 575
mhash.setup.atom                                   16-Jul-2024 06:03                1254
migration56.atom                                   16-Jul-2024 06:03                2692
migration56.changed-functions.atom                 16-Jul-2024 06:03                 628
migration56.constants.atom                         16-Jul-2024 06:03                 603
migration56.deprecated.atom                        16-Jul-2024 06:03                 646
migration56.extensions.atom                        16-Jul-2024 06:03                 617
migration56.incompatible.atom                      16-Jul-2024 06:03                 649
migration56.new-features.atom                      16-Jul-2024 06:03                 619
migration56.new-functions.atom                     16-Jul-2024 06:03                 605
migration56.openssl.atom                           16-Jul-2024 06:03                 606
migration70.atom                                   16-Jul-2024 06:03                3203
migration70.changed-functions.atom                 16-Jul-2024 06:03                 628
migration70.classes.atom                           16-Jul-2024 06:03                 599
migration70.constants.atom                         16-Jul-2024 06:03                 603
migration70.deprecated.atom                        16-Jul-2024 06:03                 666
migration70.incompatible.atom                      16-Jul-2024 06:03                 649
migration70.new-features.atom                      16-Jul-2024 06:03                 619
migration70.new-functions.atom                     16-Jul-2024 06:03                 605
migration70.other-changes.atom                     16-Jul-2024 06:03                 604
migration70.removed-exts-sapis.atom                16-Jul-2024 06:03                 641
migration70.sapi-changes.atom                      16-Jul-2024 06:03                 613
migration71.atom                                   16-Jul-2024 06:03                2673
migration71.changed-functions.atom                 16-Jul-2024 06:03                 628
migration71.constants.atom                         16-Jul-2024 06:03                 603
migration71.deprecated.atom                        16-Jul-2024 06:03                 666
migration71.incompatible.atom                      16-Jul-2024 06:03                 649
migration71.new-features.atom                      16-Jul-2024 06:03                 619
migration71.new-functions.atom                     16-Jul-2024 06:03                 605
migration71.other-changes.atom                     16-Jul-2024 06:03                 604
migration71.windows-support.atom                   16-Jul-2024 06:03                 607
migration72.atom                                   16-Jul-2024 06:03                2165
migration72.constants.atom                         16-Jul-2024 06:03                 603
migration72.deprecated.atom                        16-Jul-2024 06:03                 646
migration72.incompatible.atom                      16-Jul-2024 06:03                 670
migration72.new-features.atom                      16-Jul-2024 06:03                 619
migration72.new-functions.atom                     16-Jul-2024 06:03                 605
migration72.other-changes.atom                     16-Jul-2024 06:03                 604
migration73.atom                                   16-Jul-2024 06:03                2389
migration73.constants.atom                         16-Jul-2024 06:03                 603
migration73.deprecated.atom                        16-Jul-2024 06:03                 633
migration73.incompatible.atom                      16-Jul-2024 06:03                 649
migration73.new-features.atom                      16-Jul-2024 06:03                 619
migration73.new-functions.atom                     16-Jul-2024 06:03                 605
migration73.other-changes.atom                     16-Jul-2024 06:03                 604
migration73.windows-support.atom                   16-Jul-2024 06:03                 610
migration74.atom                                   16-Jul-2024 06:03                2901
migration74.constants.atom                         16-Jul-2024 06:03                 603
migration74.deprecated.atom                        16-Jul-2024 06:03                 624
migration74.incompatible.atom                      16-Jul-2024 06:03                 649
migration74.new-classes.atom                       16-Jul-2024 06:03                 611
migration74.new-features.atom                      16-Jul-2024 06:03                 619
migration74.new-functions.atom                     16-Jul-2024 06:03                 605
migration74.other-changes.atom                     16-Jul-2024 06:03                 604
migration74.removed-extensions.atom                16-Jul-2024 06:03                 633
migration74.windows-support.atom                   16-Jul-2024 06:03                 610
migration80.atom                                   16-Jul-2024 06:03                1609
migration80.deprecated.atom                        16-Jul-2024 06:03                 624
migration80.incompatible.atom                      16-Jul-2024 06:03                 649
migration80.new-features.atom                      16-Jul-2024 06:03                 595
migration80.other-changes.atom                     16-Jul-2024 06:03                 599
migration81.atom                                   16-Jul-2024 06:03                2287
migration81.constants.atom                         16-Jul-2024 06:03                 594
migration81.deprecated.atom                        16-Jul-2024 06:03                 596
migration81.incompatible.atom                      16-Jul-2024 06:03                 612
migration81.new-classes.atom                       16-Jul-2024 06:03                 606
migration81.new-features.atom                      16-Jul-2024 06:03                 595
migration81.new-functions.atom                     16-Jul-2024 06:03                 599
migration81.other-changes.atom                     16-Jul-2024 06:03                 599
migration82.atom                                   16-Jul-2024 06:03                2377
migration82.constants.atom                         16-Jul-2024 06:03                 603
migration82.deprecated.atom                        16-Jul-2024 06:03                 624
migration82.incompatible.atom                      16-Jul-2024 06:03                 649
migration82.new-features.atom                      16-Jul-2024 06:03                 619
migration82.new-functions.atom                     16-Jul-2024 06:03                 605
migration82.other-changes.atom                     16-Jul-2024 06:03                 604
migration82.windows-support.atom                   16-Jul-2024 06:03                 607
migration83.atom                                   16-Jul-2024 06:03                2534
migration83.constants.atom                         16-Jul-2024 06:03                 594
migration83.deprecated.atom                        16-Jul-2024 06:03                 596
migration83.incompatible.atom                      16-Jul-2024 06:03                 612
migration83.new-classes.atom                       16-Jul-2024 06:03                 606
migration83.new-features.atom                      16-Jul-2024 06:03                 595
migration83.new-functions.atom                     16-Jul-2024 06:03                 599
migration83.other-changes.atom                     16-Jul-2024 06:03                 599
migration83.windows-support.atom                   16-Jul-2024 06:03                 607
misc.configuration.atom                            16-Jul-2024 06:03                 619
misc.constants.atom                                16-Jul-2024 06:03                 598
misc.resources.atom                                16-Jul-2024 06:03                 572
misc.setup.atom                                    16-Jul-2024 06:03                1047
mongodb-bson-binary.construct.atom                 16-Jul-2024 06:03                 626
mongodb-bson-binary.getdata.atom                   16-Jul-2024 06:03                 633
mongodb-bson-binary.gettype.atom                   16-Jul-2024 06:03                 618
mongodb-bson-binary.jsonserialize.atom             16-Jul-2024 06:03                 690
mongodb-bson-binary.serialize.atom                 16-Jul-2024 06:03                 628
mongodb-bson-binary.tostring.atom                  16-Jul-2024 06:03                 636
mongodb-bson-binary.unserialize.atom               16-Jul-2024 06:03                 647
mongodb-bson-binaryinterface.getdata.atom          16-Jul-2024 06:03                 669
mongodb-bson-binaryinterface.gettype.atom          16-Jul-2024 06:03                 654
mongodb-bson-binaryinterface.tostring.atom         16-Jul-2024 06:03                 672
mongodb-bson-dbpointer.construct.atom              16-Jul-2024 06:03                 660
mongodb-bson-dbpointer.jsonserialize.atom          16-Jul-2024 06:03                 699
mongodb-bson-dbpointer.serialize.atom              16-Jul-2024 06:03                 640
mongodb-bson-dbpointer.tostring.atom               16-Jul-2024 06:03                 638
mongodb-bson-dbpointer.unserialize.atom            16-Jul-2024 06:03                 670
mongodb-bson-decimal128.construct.atom             16-Jul-2024 06:03                 641
mongodb-bson-decimal128.jsonserialize.atom         16-Jul-2024 06:03                 702
mongodb-bson-decimal128.serialize.atom             16-Jul-2024 06:03                 644
mongodb-bson-decimal128.tostring.atom              16-Jul-2024 06:03                 713
mongodb-bson-decimal128.unserialize.atom           16-Jul-2024 06:03                 674
mongodb-bson-decimal128interface.tostring.atom     16-Jul-2024 06:03                 742
mongodb-bson-document.construct.atom               16-Jul-2024 06:03                 642
mongodb-bson-document.frombson.atom                16-Jul-2024 06:03                 653
mongodb-bson-document.fromjson.atom                16-Jul-2024 06:03                 653
mongodb-bson-document.fromphp.atom                 16-Jul-2024 06:03                 645
mongodb-bson-document.get.atom                     16-Jul-2024 06:03                 628
mongodb-bson-document.getiterator.atom             16-Jul-2024 06:03                 651
mongodb-bson-document.has.atom                     16-Jul-2024 06:03                 634
mongodb-bson-document.offsetexists.atom            16-Jul-2024 06:03                 661
mongodb-bson-document.offsetget.atom               16-Jul-2024 06:03                 646
mongodb-bson-document.offsetset.atom               16-Jul-2024 06:03                 633
mongodb-bson-document.offsetunset.atom             16-Jul-2024 06:03                 639
mongodb-bson-document.serialize.atom               16-Jul-2024 06:03                 624
mongodb-bson-document.tocanonicalextendedjson.atom 16-Jul-2024 06:03                 717
mongodb-bson-document.tophp.atom                   16-Jul-2024 06:03                 643
mongodb-bson-document.torelaxedextendedjson.atom   16-Jul-2024 06:03                 709
mongodb-bson-document.tostring.atom                16-Jul-2024 06:03                 656
mongodb-bson-document.unserialize.atom             16-Jul-2024 06:03                 637
mongodb-bson-int64.construct.atom                  16-Jul-2024 06:03                 621
mongodb-bson-int64.jsonserialize.atom              16-Jul-2024 06:03                 687
mongodb-bson-int64.serialize.atom                  16-Jul-2024 06:03                 624
mongodb-bson-int64.tostring.atom                   16-Jul-2024 06:03                 693
mongodb-bson-int64.unserialize.atom                16-Jul-2024 06:03                 654
mongodb-bson-iterator.construct.atom               16-Jul-2024 06:03                 642
mongodb-bson-iterator.current.atom                 16-Jul-2024 06:03                 625
mongodb-bson-iterator.key.atom                     16-Jul-2024 06:03                 624
mongodb-bson-iterator.next.atom                    16-Jul-2024 06:03                 626
mongodb-bson-iterator.rewind.atom                  16-Jul-2024 06:03                 636
mongodb-bson-iterator.valid.atom                   16-Jul-2024 06:03                 627
mongodb-bson-javascript.construct.atom             16-Jul-2024 06:03                 646
mongodb-bson-javascript.getcode.atom               16-Jul-2024 06:03                 631
mongodb-bson-javascript.getscope.atom              16-Jul-2024 06:03                 662
mongodb-bson-javascript.jsonserialize.atom         16-Jul-2024 06:03                 702
mongodb-bson-javascript.serialize.atom             16-Jul-2024 06:03                 644
mongodb-bson-javascript.tostring.atom              16-Jul-2024 06:03                 634
mongodb-bson-javascript.unserialize.atom           16-Jul-2024 06:03                 674
mongodb-bson-javascriptinterface.getcode.atom      16-Jul-2024 06:03                 670
mongodb-bson-javascriptinterface.getscope.atom     16-Jul-2024 06:03                 698
mongodb-bson-javascriptinterface.tostring.atom     16-Jul-2024 06:03                 673
mongodb-bson-maxkey.construct.atom                 16-Jul-2024 06:03                 625
mongodb-bson-maxkey.jsonserialize.atom             16-Jul-2024 06:03                 690
mongodb-bson-maxkey.serialize.atom                 16-Jul-2024 06:03                 628
mongodb-bson-maxkey.unserialize.atom               16-Jul-2024 06:03                 658
mongodb-bson-minkey.construct.atom                 16-Jul-2024 06:03                 625
mongodb-bson-minkey.jsonserialize.atom             16-Jul-2024 06:03                 690
mongodb-bson-minkey.serialize.atom                 16-Jul-2024 06:03                 628
mongodb-bson-minkey.unserialize.atom               16-Jul-2024 06:03                 658
mongodb-bson-objectid.construct.atom               16-Jul-2024 06:03                 632
mongodb-bson-objectid.gettimestamp.atom            16-Jul-2024 06:03                 664
mongodb-bson-objectid.jsonserialize.atom           16-Jul-2024 06:03                 696
mongodb-bson-objectid.serialize.atom               16-Jul-2024 06:03                 636
mongodb-bson-objectid.tostring.atom                16-Jul-2024 06:03                 678
mongodb-bson-objectid.unserialize.atom             16-Jul-2024 06:03                 666
mongodb-bson-objectidinterface.gettimestamp.atom   16-Jul-2024 06:03                 700
mongodb-bson-objectidinterface.tostring.atom       16-Jul-2024 06:03                 710
mongodb-bson-packedarray.construct.atom            16-Jul-2024 06:03                 648
mongodb-bson-packedarray.fromphp.atom              16-Jul-2024 06:03                 656
mongodb-bson-packedarray.get.atom                  16-Jul-2024 06:03                 637
mongodb-bson-packedarray.getiterator.atom          16-Jul-2024 06:03                 657
mongodb-bson-packedarray.has.atom                  16-Jul-2024 06:03                 642
mongodb-bson-packedarray.offsetexists.atom         16-Jul-2024 06:03                 669
mongodb-bson-packedarray.offsetget.atom            16-Jul-2024 06:03                 655
mongodb-bson-packedarray.offsetset.atom            16-Jul-2024 06:03                 642
mongodb-bson-packedarray.offsetunset.atom          16-Jul-2024 06:03                 648
mongodb-bson-packedarray.serialize.atom            16-Jul-2024 06:03                 635
mongodb-bson-packedarray.tophp.atom                16-Jul-2024 06:03                 649
mongodb-bson-packedarray.tostring.atom             16-Jul-2024 06:03                 662
mongodb-bson-packedarray.unserialize.atom          16-Jul-2024 06:03                 643
mongodb-bson-persistable.bsonserialize.atom        16-Jul-2024 06:03                 675
mongodb-bson-regex.construct.atom                  16-Jul-2024 06:03                 623
mongodb-bson-regex.getflags.atom                   16-Jul-2024 06:03                 624
mongodb-bson-regex.getpattern.atom                 16-Jul-2024 06:03                 625
mongodb-bson-regex.jsonserialize.atom              16-Jul-2024 06:03                 687
mongodb-bson-regex.serialize.atom                  16-Jul-2024 06:03                 624
mongodb-bson-regex.tostring.atom                   16-Jul-2024 06:03                 656
mongodb-bson-regex.unserialize.atom                16-Jul-2024 06:03                 654
mongodb-bson-regexinterface.getflags.atom          16-Jul-2024 06:03                 658
mongodb-bson-regexinterface.getpattern.atom        16-Jul-2024 06:03                 661
mongodb-bson-regexinterface.tostring.atom          16-Jul-2024 06:03                 735
mongodb-bson-serializable.bsonserialize.atom       16-Jul-2024 06:03                 713
mongodb-bson-symbol.construct.atom                 16-Jul-2024 06:03                 648
mongodb-bson-symbol.jsonserialize.atom             16-Jul-2024 06:03                 690
mongodb-bson-symbol.serialize.atom                 16-Jul-2024 06:03                 628
mongodb-bson-symbol.tostring.atom                  16-Jul-2024 06:03                 697
mongodb-bson-symbol.unserialize.atom               16-Jul-2024 06:03                 658
mongodb-bson-timestamp.construct.atom              16-Jul-2024 06:03                 636
mongodb-bson-timestamp.getincrement.atom           16-Jul-2024 06:03                 686
mongodb-bson-timestamp.gettimestamp.atom           16-Jul-2024 06:03                 668
mongodb-bson-timestamp.jsonserialize.atom          16-Jul-2024 06:03                 699
mongodb-bson-timestamp.serialize.atom              16-Jul-2024 06:03                 640
mongodb-bson-timestamp.tostring.atom               16-Jul-2024 06:03                 690
mongodb-bson-timestamp.unserialize.atom            16-Jul-2024 06:03                 670
mongodb-bson-timestampinterface.getincrement.atom  16-Jul-2024 06:03                 722
mongodb-bson-timestampinterface.gettimestamp.atom  16-Jul-2024 06:03                 704
mongodb-bson-timestampinterface.tostring.atom      16-Jul-2024 06:03                 745
mongodb-bson-undefined.construct.atom              16-Jul-2024 06:03                 660
mongodb-bson-undefined.jsonserialize.atom          16-Jul-2024 06:03                 699
mongodb-bson-undefined.serialize.atom              16-Jul-2024 06:03                 640
mongodb-bson-undefined.tostring.atom               16-Jul-2024 06:03                 638
mongodb-bson-undefined.unserialize.atom            16-Jul-2024 06:03                 670
mongodb-bson-unserializable.bsonunserialize.atom   16-Jul-2024 06:03                 727
mongodb-bson-utcdatetime.construct.atom            16-Jul-2024 06:03                 645
mongodb-bson-utcdatetime.jsonserialize.atom        16-Jul-2024 06:03                 705
mongodb-bson-utcdatetime.serialize.atom            16-Jul-2024 06:03                 648
mongodb-bson-utcdatetime.todatetime.atom           16-Jul-2024 06:03                 680
mongodb-bson-utcdatetime.tostring.atom             16-Jul-2024 06:03                 696
mongodb-bson-utcdatetime.unserialize.atom          16-Jul-2024 06:03                 678
mongodb-bson-utcdatetimeinterface.todatetime.atom  16-Jul-2024 06:03                 713
mongodb-bson-utcdatetimeinterface.tostring.atom    16-Jul-2024 06:03                 753
mongodb-driver-bulkwrite.construct.atom            16-Jul-2024 06:03                 635
mongodb-driver-bulkwrite.count.atom                16-Jul-2024 06:03                 645
mongodb-driver-bulkwrite.delete.atom               16-Jul-2024 06:03                 638
mongodb-driver-bulkwrite.insert.atom               16-Jul-2024 06:03                 639
mongodb-driver-bulkwrite.update.atom               16-Jul-2024 06:03                 639
mongodb-driver-clientencryption.addkeyaltname.atom 16-Jul-2024 06:03                 686
mongodb-driver-clientencryption.construct.atom     16-Jul-2024 06:03                 670
mongodb-driver-clientencryption.createdatakey.atom 16-Jul-2024 06:03                 668
mongodb-driver-clientencryption.decrypt.atom       16-Jul-2024 06:03                 643
mongodb-driver-clientencryption.deletekey.atom     16-Jul-2024 06:03                 656
mongodb-driver-clientencryption.encrypt.atom       16-Jul-2024 06:03                 643
mongodb-driver-clientencryption.encryptexpressi..> 16-Jul-2024 06:03                 698
mongodb-driver-clientencryption.getkey.atom        16-Jul-2024 06:03                 644
mongodb-driver-clientencryption.getkeybyaltname..> 16-Jul-2024 06:03                 692
mongodb-driver-clientencryption.getkeys.atom       16-Jul-2024 06:03                 650
mongodb-driver-clientencryption.removekeyaltnam..> 16-Jul-2024 06:03                 700
mongodb-driver-clientencryption.rewrapmanydatak..> 16-Jul-2024 06:03                 675
mongodb-driver-command.construct.atom              16-Jul-2024 06:03                 644
mongodb-driver-commandexception.getresultdocume..> 16-Jul-2024 06:03                 745
mongodb-driver-cursor.construct.atom               16-Jul-2024 06:03                 664
mongodb-driver-cursor.current.atom                 16-Jul-2024 06:03                 625
mongodb-driver-cursor.getid.atom                   16-Jul-2024 06:03                 624
mongodb-driver-cursor.getserver.atom               16-Jul-2024 06:03                 666
mongodb-driver-cursor.isdead.atom                  16-Jul-2024 06:03                 726
mongodb-driver-cursor.key.atom                     16-Jul-2024 06:03                 643
mongodb-driver-cursor.next.atom                    16-Jul-2024 06:03                 627
mongodb-driver-cursor.rewind.atom                  16-Jul-2024 06:03                 632
mongodb-driver-cursor.settypemap.atom              16-Jul-2024 06:03                 714
mongodb-driver-cursor.toarray.atom                 16-Jul-2024 06:03                 673
mongodb-driver-cursor.valid.atom                   16-Jul-2024 06:03                 645
mongodb-driver-cursorid.construct.atom             16-Jul-2024 06:03                 671
mongodb-driver-cursorid.serialize.atom             16-Jul-2024 06:03                 630
mongodb-driver-cursorid.tostring.atom              16-Jul-2024 06:03                 687
mongodb-driver-cursorid.unserialize.atom           16-Jul-2024 06:03                 638
mongodb-driver-cursorinterface.getid.atom          16-Jul-2024 06:03                 649
mongodb-driver-cursorinterface.getserver.atom      16-Jul-2024 06:03                 677
mongodb-driver-cursorinterface.isdead.atom         16-Jul-2024 06:03                 670
mongodb-driver-cursorinterface.settypemap.atom     16-Jul-2024 06:03                 681
mongodb-driver-cursorinterface.toarray.atom        16-Jul-2024 06:03                 680
mongodb-driver-manager.addsubscriber.atom          16-Jul-2024 06:03                 676
mongodb-driver-manager.construct.atom              16-Jul-2024 06:03                 633
mongodb-driver-manager.createclientencryption.atom 16-Jul-2024 06:03                 682
mongodb-driver-manager.executebulkwrite.atom       16-Jul-2024 06:03                 664
mongodb-driver-manager.executecommand.atom         16-Jul-2024 06:03                 648
mongodb-driver-manager.executequery.atom           16-Jul-2024 06:03                 640
mongodb-driver-manager.executereadcommand.atom     16-Jul-2024 06:03                 671
mongodb-driver-manager.executereadwritecommand...> 16-Jul-2024 06:03                 697
mongodb-driver-manager.executewritecommand.atom    16-Jul-2024 06:03                 675
mongodb-driver-manager.getencryptedfieldsmap.atom  16-Jul-2024 06:03                 711
mongodb-driver-manager.getreadconcern.atom         16-Jul-2024 06:03                 660
mongodb-driver-manager.getreadpreference.atom      16-Jul-2024 06:03                 672
mongodb-driver-manager.getservers.atom             16-Jul-2024 06:03                 681
mongodb-driver-manager.getwriteconcern.atom        16-Jul-2024 06:03                 664
mongodb-driver-manager.removesubscriber.atom       16-Jul-2024 06:03                 687
mongodb-driver-manager.selectserver.atom           16-Jul-2024 06:03                 658
mongodb-driver-manager.startsession.atom           16-Jul-2024 06:03                 667
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 712
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 745
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 748
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 726
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 727
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 704
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 719
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 725
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 757
mongodb-driver-monitoring-commandfailedevent.ge..> 16-Jul-2024 06:03                 734
mongodb-driver-monitoring-commandstartedevent.g..> 16-Jul-2024 06:03                 707
mongodb-driver-monitoring-commandstartedevent.g..> 16-Jul-2024 06:03                 715
mongodb-driver-monitoring-commandstartedevent.g..> 16-Jul-2024 06:03                 748
mongodb-driver-monitoring-commandstartedevent.g..> 16-Jul-2024 06:03                 730
mongodb-driver-monitoring-commandstartedevent.g..> 16-Jul-2024 06:03                 722
mongodb-driver-monitoring-commandstartedevent.g..> 16-Jul-2024 06:03                 728
mongodb-driver-monitoring-commandstartedevent.g..> 16-Jul-2024 06:03                 760
mongodb-driver-monitoring-commandstartedevent.g..> 16-Jul-2024 06:03                 737
mongodb-driver-monitoring-commandsubscriber.com..> 16-Jul-2024 06:03                 722
mongodb-driver-monitoring-commandsubscriber.com..> 16-Jul-2024 06:03                 726
mongodb-driver-monitoring-commandsubscriber.com..> 16-Jul-2024 06:03                 735
mongodb-driver-monitoring-commandsucceededevent..> 16-Jul-2024 06:03                 721
mongodb-driver-monitoring-commandsucceededevent..> 16-Jul-2024 06:03                 754
mongodb-driver-monitoring-commandsucceededevent..> 16-Jul-2024 06:03                 757
mongodb-driver-monitoring-commandsucceededevent..> 16-Jul-2024 06:03                 736
mongodb-driver-monitoring-commandsucceededevent..> 16-Jul-2024 06:03                 713
mongodb-driver-monitoring-commandsucceededevent..> 16-Jul-2024 06:03                 728
mongodb-driver-monitoring-commandsucceededevent..> 16-Jul-2024 06:03                 734
mongodb-driver-monitoring-commandsucceededevent..> 16-Jul-2024 06:03                 766
mongodb-driver-monitoring-commandsucceededevent..> 16-Jul-2024 06:03                 743
mongodb-driver-monitoring-logsubscriber.log.atom   16-Jul-2024 06:03                 677
mongodb-driver-monitoring-sdamsubscriber.server..> 16-Jul-2024 06:03                 724
mongodb-driver-monitoring-sdamsubscriber.server..> 16-Jul-2024 06:03                 710
mongodb-driver-monitoring-sdamsubscriber.server..> 16-Jul-2024 06:03                 746
mongodb-driver-monitoring-sdamsubscriber.server..> 16-Jul-2024 06:03                 750
mongodb-driver-monitoring-sdamsubscriber.server..> 16-Jul-2024 06:03                 759
mongodb-driver-monitoring-sdamsubscriber.server..> 16-Jul-2024 06:03                 713
mongodb-driver-monitoring-sdamsubscriber.topolo..> 16-Jul-2024 06:03                 732
mongodb-driver-monitoring-sdamsubscriber.topolo..> 16-Jul-2024 06:03                 720
mongodb-driver-monitoring-sdamsubscriber.topolo..> 16-Jul-2024 06:03                 723
mongodb-driver-monitoring-serverchangedevent.ge..> 16-Jul-2024 06:03                 701
mongodb-driver-monitoring-serverchangedevent.ge..> 16-Jul-2024 06:03                 739
mongodb-driver-monitoring-serverchangedevent.ge..> 16-Jul-2024 06:03                 717
mongodb-driver-monitoring-serverchangedevent.ge..> 16-Jul-2024 06:03                 759
mongodb-driver-monitoring-serverchangedevent.ge..> 16-Jul-2024 06:03                 736
mongodb-driver-monitoring-serverclosedevent.get..> 16-Jul-2024 06:03                 698
mongodb-driver-monitoring-serverclosedevent.get..> 16-Jul-2024 06:03                 714
mongodb-driver-monitoring-serverclosedevent.get..> 16-Jul-2024 06:03                 733
mongodb-driver-monitoring-serverheartbeatfailed..> 16-Jul-2024 06:03                 774
mongodb-driver-monitoring-serverheartbeatfailed..> 16-Jul-2024 06:03                 752
mongodb-driver-monitoring-serverheartbeatfailed..> 16-Jul-2024 06:03                 725
mongodb-driver-monitoring-serverheartbeatfailed..> 16-Jul-2024 06:03                 741
mongodb-driver-monitoring-serverheartbeatfailed..> 16-Jul-2024 06:03                 752
mongodb-driver-monitoring-serverheartbeatstarte..> 16-Jul-2024 06:03                 728
mongodb-driver-monitoring-serverheartbeatstarte..> 16-Jul-2024 06:03                 744
mongodb-driver-monitoring-serverheartbeatstarte..> 16-Jul-2024 06:03                 755
mongodb-driver-monitoring-serverheartbeatsuccee..> 16-Jul-2024 06:03                 783
mongodb-driver-monitoring-serverheartbeatsuccee..> 16-Jul-2024 06:03                 734
mongodb-driver-monitoring-serverheartbeatsuccee..> 16-Jul-2024 06:03                 750
mongodb-driver-monitoring-serverheartbeatsuccee..> 16-Jul-2024 06:03                 739
mongodb-driver-monitoring-serverheartbeatsuccee..> 16-Jul-2024 06:03                 761
mongodb-driver-monitoring-serveropeningevent.ge..> 16-Jul-2024 06:03                 701
mongodb-driver-monitoring-serveropeningevent.ge..> 16-Jul-2024 06:03                 717
mongodb-driver-monitoring-serveropeningevent.ge..> 16-Jul-2024 06:03                 736
mongodb-driver-monitoring-topologychangedevent...> 16-Jul-2024 06:03                 747
mongodb-driver-monitoring-topologychangedevent...> 16-Jul-2024 06:03                 767
mongodb-driver-monitoring-topologychangedevent...> 16-Jul-2024 06:03                 714
mongodb-driver-monitoring-topologyclosedevent.g..> 16-Jul-2024 06:03                 711
mongodb-driver-monitoring-topologyopeningevent...> 16-Jul-2024 06:03                 714
mongodb-driver-query.construct.atom                16-Jul-2024 06:03                 619
mongodb-driver-readconcern.bsonserialize.atom      16-Jul-2024 06:03                 671
mongodb-driver-readconcern.construct.atom          16-Jul-2024 06:03                 643
mongodb-driver-readconcern.getlevel.atom           16-Jul-2024 06:03                 679
mongodb-driver-readconcern.isdefault.atom          16-Jul-2024 06:03                 661
mongodb-driver-readconcern.serialize.atom          16-Jul-2024 06:03                 642
mongodb-driver-readconcern.unserialize.atom        16-Jul-2024 06:03                 650
mongodb-driver-readpreference.bsonserialize.atom   16-Jul-2024 06:03                 680
mongodb-driver-readpreference.construct.atom       16-Jul-2024 06:03                 670
mongodb-driver-readpreference.gethedge.atom        16-Jul-2024 06:03                 691
mongodb-driver-readpreference.getmaxstalenessse..> 16-Jul-2024 06:03                 747
mongodb-driver-readpreference.getmode.atom         16-Jul-2024 06:03                 687
mongodb-driver-readpreference.getmodestring.atom   16-Jul-2024 06:03                 717
mongodb-driver-readpreference.gettagsets.atom      16-Jul-2024 06:03                 699
mongodb-driver-readpreference.serialize.atom       16-Jul-2024 06:03                 654
mongodb-driver-readpreference.unserialize.atom     16-Jul-2024 06:03                 662
mongodb-driver-runtimeexception.haserrorlabel.atom 16-Jul-2024 06:03                 722
mongodb-driver-server.construct.atom               16-Jul-2024 06:03                 664
mongodb-driver-server.executebulkwrite.atom        16-Jul-2024 06:03                 724
mongodb-driver-server.executecommand.atom          16-Jul-2024 06:03                 695
mongodb-driver-server.executequery.atom            16-Jul-2024 06:03                 698
mongodb-driver-server.executereadcommand.atom      16-Jul-2024 06:03                 683
mongodb-driver-server.executereadwritecommand.atom 16-Jul-2024 06:03                 709
mongodb-driver-server.executewritecommand.atom     16-Jul-2024 06:03                 687
mongodb-driver-server.gethost.atom                 16-Jul-2024 06:03                 646
mongodb-driver-server.getinfo.atom                 16-Jul-2024 06:03                 669
mongodb-driver-server.getlatency.atom              16-Jul-2024 06:03                 657
mongodb-driver-server.getport.atom                 16-Jul-2024 06:03                 654
mongodb-driver-server.getserverdescription.atom    16-Jul-2024 06:03                 680
mongodb-driver-server.gettags.atom                 16-Jul-2024 06:03                 662
mongodb-driver-server.gettype.atom                 16-Jul-2024 06:03                 659
mongodb-driver-server.isarbiter.atom               16-Jul-2024 06:03                 663
mongodb-driver-server.ishidden.atom                16-Jul-2024 06:03                 658
mongodb-driver-server.ispassive.atom               16-Jul-2024 06:03                 690
mongodb-driver-server.isprimary.atom               16-Jul-2024 06:03                 662
mongodb-driver-server.issecondary.atom             16-Jul-2024 06:03                 670
mongodb-driver-serverapi.bsonserialize.atom        16-Jul-2024 06:03                 665
mongodb-driver-serverapi.construct.atom            16-Jul-2024 06:03                 644
mongodb-driver-serverapi.serialize.atom            16-Jul-2024 06:03                 634
mongodb-driver-serverapi.unserialize.atom          16-Jul-2024 06:03                 642
mongodb-driver-serverdescription.gethellorespon..> 16-Jul-2024 06:03                 730
mongodb-driver-serverdescription.gethost.atom      16-Jul-2024 06:03                 666
mongodb-driver-serverdescription.getlastupdatet..> 16-Jul-2024 06:03                 719
mongodb-driver-serverdescription.getport.atom      16-Jul-2024 06:03                 681
mongodb-driver-serverdescription.getroundtripti..> 16-Jul-2024 06:03                 715
mongodb-driver-serverdescription.gettype.atom      16-Jul-2024 06:03                 680
mongodb-driver-session.aborttransaction.atom       16-Jul-2024 06:03                 648
mongodb-driver-session.advanceclustertime.atom     16-Jul-2024 06:03                 676
mongodb-driver-session.advanceoperationtime.atom   16-Jul-2024 06:03                 684
mongodb-driver-session.committransaction.atom      16-Jul-2024 06:03                 652
mongodb-driver-session.construct.atom              16-Jul-2024 06:03                 638
mongodb-driver-session.endsession.atom             16-Jul-2024 06:03                 630
mongodb-driver-session.getclustertime.atom         16-Jul-2024 06:03                 663
mongodb-driver-session.getlogicalsessionid.atom    16-Jul-2024 06:03                 684
mongodb-driver-session.getoperationtime.atom       16-Jul-2024 06:03                 671
mongodb-driver-session.getserver.atom              16-Jul-2024 06:03                 657
mongodb-driver-session.gettransactionoptions.atom  16-Jul-2024 06:03                 696
mongodb-driver-session.gettransactionstate.atom    16-Jul-2024 06:03                 691
mongodb-driver-session.isdirty.atom                16-Jul-2024 06:03                 653
mongodb-driver-session.isintransaction.atom        16-Jul-2024 06:03                 684
mongodb-driver-session.starttransaction.atom       16-Jul-2024 06:03                 648
mongodb-driver-topologydescription.getservers.atom 16-Jul-2024 06:03                 681
mongodb-driver-topologydescription.gettype.atom    16-Jul-2024 06:03                 688
mongodb-driver-topologydescription.hasreadables..> 16-Jul-2024 06:03                 717
mongodb-driver-topologydescription.haswritables..> 16-Jul-2024 06:03                 717
mongodb-driver-writeconcern.bsonserialize.atom     16-Jul-2024 06:03                 674
mongodb-driver-writeconcern.construct.atom         16-Jul-2024 06:03                 647
mongodb-driver-writeconcern.getjournal.atom        16-Jul-2024 06:03                 691
mongodb-driver-writeconcern.getw.atom              16-Jul-2024 06:03                 667
mongodb-driver-writeconcern.getwtimeout.atom       16-Jul-2024 06:03                 695
mongodb-driver-writeconcern.isdefault.atom         16-Jul-2024 06:03                 665
mongodb-driver-writeconcern.serialize.atom         16-Jul-2024 06:03                 646
mongodb-driver-writeconcern.unserialize.atom       16-Jul-2024 06:03                 654
mongodb-driver-writeconcernerror.getcode.atom      16-Jul-2024 06:03                 682
mongodb-driver-writeconcernerror.getinfo.atom      16-Jul-2024 06:03                 711
mongodb-driver-writeconcernerror.getmessage.atom   16-Jul-2024 06:03                 693
mongodb-driver-writeerror.getcode.atom             16-Jul-2024 06:03                 654
mongodb-driver-writeerror.getindex.atom            16-Jul-2024 06:03                 733
mongodb-driver-writeerror.getinfo.atom             16-Jul-2024 06:03                 683
mongodb-driver-writeerror.getmessage.atom          16-Jul-2024 06:03                 665
mongodb-driver-writeexception.getwriteresult.atom  16-Jul-2024 06:03                 761
mongodb-driver-writeresult.getdeletedcount.atom    16-Jul-2024 06:03                 688
mongodb-driver-writeresult.getinsertedcount.atom   16-Jul-2024 06:03                 743
mongodb-driver-writeresult.getmatchedcount.atom    16-Jul-2024 06:03                 733
mongodb-driver-writeresult.getmodifiedcount.atom   16-Jul-2024 06:03                 702
mongodb-driver-writeresult.getserver.atom          16-Jul-2024 06:03                 720
mongodb-driver-writeresult.getupsertedcount.atom   16-Jul-2024 06:03                 714
mongodb-driver-writeresult.getupsertedids.atom     16-Jul-2024 06:03                 704
mongodb-driver-writeresult.getwriteconcernerror..> 16-Jul-2024 06:03                 713
mongodb-driver-writeresult.getwriteerrors.atom     16-Jul-2024 06:03                 710
mongodb-driver-writeresult.isacknowledged.atom     16-Jul-2024 06:03                 709
mongodb.architecture.atom                          16-Jul-2024 06:03                1452
mongodb.configuration.atom                         16-Jul-2024 06:03                 628
mongodb.connection-handling.atom                   16-Jul-2024 06:03                 627
mongodb.constants.atom                             16-Jul-2024 06:03                 607
mongodb.exceptions.atom                            16-Jul-2024 06:03                6544
mongodb.exceptions.tree.atom                       16-Jul-2024 06:03                 608
mongodb.installation.atom                          16-Jul-2024 06:03                1708
mongodb.installation.homebrew.atom                 16-Jul-2024 06:03                 657
mongodb.installation.manual.atom                   16-Jul-2024 06:03                 635
mongodb.installation.pecl.atom                     16-Jul-2024 06:03                 632
mongodb.installation.windows.atom                  16-Jul-2024 06:03                 642
mongodb.monitoring.atom                            16-Jul-2024 06:03                7011
mongodb.overview.atom                              16-Jul-2024 06:03                 580
mongodb.persistence.atom                           16-Jul-2024 06:03                1169
mongodb.persistence.deserialization.atom           16-Jul-2024 06:03                 641
mongodb.persistence.serialization.atom             16-Jul-2024 06:03                 631
mongodb.requirements.atom                          16-Jul-2024 06:03                 592
mongodb.security.atom                              16-Jul-2024 06:03                1106
mongodb.security.request_injection.atom            16-Jul-2024 06:03                 638
mongodb.security.script_injection.atom             16-Jul-2024 06:03                 634
mongodb.setup.atom                                 16-Jul-2024 06:03                1551
mongodb.tutorial.apm.atom                          16-Jul-2024 06:03                 611
mongodb.tutorial.atom                              16-Jul-2024 06:03                1094
mongodb.tutorial.library.atom                      16-Jul-2024 06:03                 625
mqseries.configure.atom                            16-Jul-2024 06:03                 577
mqseries.constants.atom                            16-Jul-2024 06:03                 610
mqseries.ini.atom                                  16-Jul-2024 06:03                 601
mqseries.requirements.atom                         16-Jul-2024 06:03                 595
mqseries.resources.atom                            16-Jul-2024 06:03                 584
mqseries.setup.atom                                16-Jul-2024 06:03                1518
multipleiterator.attachiterator.atom               16-Jul-2024 06:03                 635
multipleiterator.construct.atom                    16-Jul-2024 06:03                 631
multipleiterator.containsiterator.atom             16-Jul-2024 06:03                 678
multipleiterator.countiterators.atom               16-Jul-2024 06:03                 710
multipleiterator.current.atom                      16-Jul-2024 06:03                 673
multipleiterator.detachiterator.atom               16-Jul-2024 06:03                 646
multipleiterator.getflags.atom                     16-Jul-2024 06:03                 651
multipleiterator.key.atom                          16-Jul-2024 06:03                 664
multipleiterator.next.atom                         16-Jul-2024 06:03                 677
multipleiterator.rewind.atom                       16-Jul-2024 06:03                 673
multipleiterator.setflags.atom                     16-Jul-2024 06:03                 617
multipleiterator.valid.atom                        16-Jul-2024 06:03                 654
mysql-xdevapi-baseresult.getw