Index of /php/manual/fr/

feeds/                                             14-Jun-2024 08:03                   -
images/                                            14-Jun-2024 08:03                   -
styles/                                            14-Jun-2024 08:02                   -
toc/                                               14-Jun-2024 08:03                   -
666bf9384baf2.php                                  14-Jun-2024 08:03               13145
about.formats.php                                  14-Jun-2024 08:03                4218
about.generate.php                                 14-Jun-2024 08:03                2850
about.howtohelp.php                                14-Jun-2024 08:03                3905
about.more.php                                     14-Jun-2024 08:03                2086
about.notes.php                                    14-Jun-2024 08:03                2540
about.php                                          14-Jun-2024 08:03                2013
about.phpversions.php                              14-Jun-2024 08:03                3652
about.prototypes.php                               14-Jun-2024 08:03                7944
about.translations.php                             14-Jun-2024 08:03                3342
aliases.php                                        14-Jun-2024 08:03               29437
allowdynamicproperties.construct.php               14-Jun-2024 08:03                2302
apache.configuration.php                           14-Jun-2024 08:03                5377
apache.constants.php                               14-Jun-2024 08:03                1222
apache.installation.php                            14-Jun-2024 08:03                1333
apache.requirements.php                            14-Jun-2024 08:03                1257
apache.resources.php                               14-Jun-2024 08:03                1270
apache.setup.php                                   14-Jun-2024 08:03                1666
apcu.configuration.php                             14-Jun-2024 08:03               17620
apcu.constants.php                                 14-Jun-2024 08:03                7454
apcu.installation.php                              14-Jun-2024 08:03                3595
apcu.requirements.php                              14-Jun-2024 08:03                1243
apcu.resources.php                                 14-Jun-2024 08:03                1256
apcu.setup.php                                     14-Jun-2024 08:03                1620
apcuiterator.construct.php                         14-Jun-2024 08:03                7301
apcuiterator.current.php                           14-Jun-2024 08:03                3270
apcuiterator.gettotalcount.php                     14-Jun-2024 08:03                3338
apcuiterator.gettotalhits.php                      14-Jun-2024 08:03                3528
apcuiterator.gettotalsize.php                      14-Jun-2024 08:03                3169
apcuiterator.key.php                               14-Jun-2024 08:03                2927                              14-Jun-2024 08:03                3254
apcuiterator.rewind.php                            14-Jun-2024 08:03                2855
apcuiterator.valid.php                             14-Jun-2024 08:03                3058
appendices.php                                     14-Jun-2024 08:03               13456
appenditerator.append.php                          14-Jun-2024 08:03                5514
appenditerator.construct.php                       14-Jun-2024 08:03               10475
appenditerator.current.php                         14-Jun-2024 08:03                3580
appenditerator.getarrayiterator.php                14-Jun-2024 08:03                3180
appenditerator.getiteratorindex.php                14-Jun-2024 08:03                6890
appenditerator.key.php                             14-Jun-2024 08:03                8001                            14-Jun-2024 08:03                3517
appenditerator.rewind.php                          14-Jun-2024 08:03                3472
appenditerator.valid.php                           14-Jun-2024 08:03                3450
array.configuration.php                            14-Jun-2024 08:03                1277
array.constants.php                                14-Jun-2024 08:03               12039
array.installation.php                             14-Jun-2024 08:03                1305
array.requirements.php                             14-Jun-2024 08:03                1250
array.resources.php                                14-Jun-2024 08:03                1263
array.setup.php                                    14-Jun-2024 08:03                1634
array.sorting.php                                  14-Jun-2024 08:03                7086
arrayaccess.offsetexists.php                       14-Jun-2024 08:03                9309
arrayaccess.offsetget.php                          14-Jun-2024 08:03                4898
arrayaccess.offsetset.php                          14-Jun-2024 08:03                5060
arrayaccess.offsetunset.php                        14-Jun-2024 08:03                2915
arrayiterator.append.php                           14-Jun-2024 08:03                3598
arrayiterator.asort.php                            14-Jun-2024 08:03                7479
arrayiterator.construct.php                        14-Jun-2024 08:03                3885
arrayiterator.count.php                            14-Jun-2024 08:03                3308
arrayiterator.current.php                          14-Jun-2024 08:03                5109
arrayiterator.getarraycopy.php                     14-Jun-2024 08:03                3154
arrayiterator.getflags.php                         14-Jun-2024 08:03                3199
arrayiterator.key.php                              14-Jun-2024 08:03                3969
arrayiterator.ksort.php                            14-Jun-2024 08:03                7459
arrayiterator.natcasesort.php                      14-Jun-2024 08:03                4960
arrayiterator.natsort.php                          14-Jun-2024 08:03                4867                             14-Jun-2024 08:03                4705
arrayiterator.offsetexists.php                     14-Jun-2024 08:03                3404
arrayiterator.offsetget.php                        14-Jun-2024 08:03                3464
arrayiterator.offsetset.php                        14-Jun-2024 08:03                3761
arrayiterator.offsetunset.php                      14-Jun-2024 08:03                3969
arrayiterator.rewind.php                           14-Jun-2024 08:03                4646                             14-Jun-2024 08:03                2685
arrayiterator.serialize.php                        14-Jun-2024 08:03                2963
arrayiterator.setflags.php                         14-Jun-2024 08:03                4312
arrayiterator.uasort.php                           14-Jun-2024 08:03                6676
arrayiterator.uksort.php                           14-Jun-2024 08:03                6585
arrayiterator.unserialize.php                      14-Jun-2024 08:03                3189
arrayiterator.valid.php                            14-Jun-2024 08:03                4678
arrayobject.append.php                             14-Jun-2024 08:03                5638
arrayobject.asort.php                              14-Jun-2024 08:03               10181
arrayobject.construct.php                          14-Jun-2024 08:03                6208
arrayobject.count.php                              14-Jun-2024 08:03                5682
arrayobject.exchangearray.php                      14-Jun-2024 08:03                6414
arrayobject.getarraycopy.php                       14-Jun-2024 08:03                5491
arrayobject.getflags.php                           14-Jun-2024 08:03                6333
arrayobject.getiterator.php                        14-Jun-2024 08:03                5435
arrayobject.getiteratorclass.php                   14-Jun-2024 08:03                6752
arrayobject.ksort.php                              14-Jun-2024 08:03                9910
arrayobject.natcasesort.php                        14-Jun-2024 08:03                8444
arrayobject.natsort.php                            14-Jun-2024 08:03                8213
arrayobject.offsetexists.php                       14-Jun-2024 08:03                4977
arrayobject.offsetget.php                          14-Jun-2024 08:03                5204
arrayobject.offsetset.php                          14-Jun-2024 08:03                6938
arrayobject.offsetunset.php                        14-Jun-2024 08:03                4318
arrayobject.serialize.php                          14-Jun-2024 08:03                5214
arrayobject.setflags.php                           14-Jun-2024 08:03                7142
arrayobject.setiteratorclass.php                   14-Jun-2024 08:03                6200
arrayobject.uasort.php                             14-Jun-2024 08:03               11194
arrayobject.uksort.php                             14-Jun-2024 08:03               10426
arrayobject.unserialize.php                        14-Jun-2024 08:03                3690
attribute.construct.php                            14-Jun-2024 08:03                2385
backedenum.from.php                                14-Jun-2024 08:03                6345
backedenum.tryfrom.php                             14-Jun-2024 08:03                6755
bc.configuration.php                               14-Jun-2024 08:03                2619
bc.constants.php                                   14-Jun-2024 08:03                1196
bc.installation.php                                14-Jun-2024 08:03                1550
bc.requirements.php                                14-Jun-2024 08:03                1229
bc.resources.php                                   14-Jun-2024 08:03                1242
bc.setup.php                                       14-Jun-2024 08:03                1626
book.apache.php                                    14-Jun-2024 08:03                3517
book.apcu.php                                      14-Jun-2024 08:03                5027
book.array.php                                     14-Jun-2024 08:03               12942
book.bc.php                                        14-Jun-2024 08:03                3105
book.bson.php                                      14-Jun-2024 08:03               26983
book.bzip2.php                                     14-Jun-2024 08:03                3037
book.calendar.php                                  14-Jun-2024 08:03                4503
book.classobj.php                                  14-Jun-2024 08:03                4724
book.cmark.php                                     14-Jun-2024 08:03                8816                                       14-Jun-2024 08:03                8460
book.componere.php                                 14-Jun-2024 08:03                6187
book.ctype.php                                     14-Jun-2024 08:03                3419
book.cubrid.php                                    14-Jun-2024 08:03               16078
book.curl.php                                      14-Jun-2024 08:03                7402
book.datetime.php                                  14-Jun-2024 08:03               17838
book.dba.php                                       14-Jun-2024 08:03                3822
book.dbase.php                                     14-Jun-2024 08:03                3504
book.dio.php                                       14-Jun-2024 08:03                3044
book.dir.php                                       14-Jun-2024 08:03                3295
book.dom.php                                       14-Jun-2024 08:03               22859
book.ds.php                                        14-Jun-2024 08:03               25195
book.eio.php                                       14-Jun-2024 08:03                9118
book.enchant.php                                   14-Jun-2024 08:03                5665
book.errorfunc.php                                 14-Jun-2024 08:03                3682
book.ev.php                                        14-Jun-2024 08:03               15157
book.event.php                                     14-Jun-2024 08:03               27011
book.exec.php                                      14-Jun-2024 08:03                3520
book.exif.php                                      14-Jun-2024 08:03                2585
book.expect.php                                    14-Jun-2024 08:03                2630
book.fann.php                                      14-Jun-2024 08:03               26149
book.fdf.php                                       14-Jun-2024 08:03                6127
book.ffi.php                                       14-Jun-2024 08:03                6194
book.fileinfo.php                                  14-Jun-2024 08:03                3236
book.filesystem.php                                14-Jun-2024 08:03               10677
book.filter.php                                    14-Jun-2024 08:03                3558
book.fpm.php                                       14-Jun-2024 08:03                2063
book.ftp.php                                       14-Jun-2024 08:03                6166
book.funchand.php                                  14-Jun-2024 08:03                3883
book.gearman.php                                   14-Jun-2024 08:03               17731
book.gender.php                                    14-Jun-2024 08:03                2720
book.geoip.php                                     14-Jun-2024 08:03                4969
book.gettext.php                                   14-Jun-2024 08:03                3079
book.gmagick.php                                   14-Jun-2024 08:03               25564
book.gmp.php                                       14-Jun-2024 08:03                7096
book.gnupg.php                                     14-Jun-2024 08:03                5293
book.hash.php                                      14-Jun-2024 08:03                4529
book.hrtime.php                                    14-Jun-2024 08:03                3836
book.ibase.php                                     14-Jun-2024 08:03               13278                                   14-Jun-2024 08:03                9973
book.iconv.php                                     14-Jun-2024 08:03                3525
book.igbinary.php                                  14-Jun-2024 08:03                2232
book.image.php                                     14-Jun-2024 08:03               17082
book.imagick.php                                   14-Jun-2024 08:03               68520
book.imap.php                                      14-Jun-2024 08:03               11146                                      14-Jun-2024 08:03                8890
book.inotify.php                                   14-Jun-2024 08:03                2680
book.intl.php                                      14-Jun-2024 08:03               48565
book.json.php                                      14-Jun-2024 08:03                3089
book.ldap.php                                      14-Jun-2024 08:03                9882
book.libxml.php                                    14-Jun-2024 08:03                3362
book.lua.php                                       14-Jun-2024 08:03                2741
book.luasandbox.php                                14-Jun-2024 08:03                5604
book.lzf.php                                       14-Jun-2024 08:03                2274
book.mail.php                                      14-Jun-2024 08:03                2146
book.mailparse.php                                 14-Jun-2024 08:03                4174
book.math.php                                      14-Jun-2024 08:03                5640
book.mbstring.php                                  14-Jun-2024 08:03               11266
book.mcrypt.php                                    14-Jun-2024 08:03                6440
book.memcache.php                                  14-Jun-2024 08:03                4719
book.memcached.php                                 14-Jun-2024 08:03                9269
book.mhash.php                                     14-Jun-2024 08:03                2562
book.misc.php                                      14-Jun-2024 08:03                5706
book.mongodb.php                                   14-Jun-2024 08:03               27510
book.mqseries.php                                  14-Jun-2024 08:03                3242
book.mysql-xdevapi.php                             14-Jun-2024 08:03               29166
book.mysql.php                                     14-Jun-2024 08:03                8788
book.mysqli.php                                    14-Jun-2024 08:03               20311
book.mysqlnd.php                                   14-Jun-2024 08:03                2553                                   14-Jun-2024 08:03                6172
book.oauth.php                                     14-Jun-2024 08:03                7904
book.oci8.php                                      14-Jun-2024 08:03               17770
book.opcache.php                                   14-Jun-2024 08:03                2793
book.openal.php                                    14-Jun-2024 08:03                4866
book.openssl.php                                   14-Jun-2024 08:03               11898
book.outcontrol.php                                14-Jun-2024 08:03                5517
book.parallel.php                                  14-Jun-2024 08:03                5752
book.parle.php                                     14-Jun-2024 08:03                8840
book.password.php                                  14-Jun-2024 08:03                2865
book.pcntl.php                                     14-Jun-2024 08:03                5450
book.pcre.php                                      14-Jun-2024 08:03                4166
book.pdo.php                                       14-Jun-2024 08:03                9021
book.pgsql.php                                     14-Jun-2024 08:03               13948
book.phar.php                                      14-Jun-2024 08:03               17578
book.phpdbg.php                                    14-Jun-2024 08:03                3144
book.posix.php                                     14-Jun-2024 08:03                7212                                        14-Jun-2024 08:03               10309
book.pspell.php                                    14-Jun-2024 08:03                4797
book.pthreads.php                                  14-Jun-2024 08:03                5772
book.quickhash.php                                 14-Jun-2024 08:03                8959
book.radius.php                                    14-Jun-2024 08:03                6013
book.random.php                                    14-Jun-2024 08:03                9527
book.rar.php                                       14-Jun-2024 08:03                6069
book.readline.php                                  14-Jun-2024 08:03                3819
book.recode.php                                    14-Jun-2024 08:03                2376
book.reflection.php                                14-Jun-2024 08:03               42359
book.rnp.php                                       14-Jun-2024 08:03                6105
book.rpminfo.php                                   14-Jun-2024 08:03                2567
book.rrd.php                                       14-Jun-2024 08:03                5869
book.runkit7.php                                   14-Jun-2024 08:03                4274
book.scoutapm.php                                  14-Jun-2024 08:03                2239
book.seaslog.php                                   14-Jun-2024 08:03                5240
book.sem.php                                       14-Jun-2024 08:03                4507
book.session.php                                   14-Jun-2024 08:03                8423
book.shmop.php                                     14-Jun-2024 08:03                3065
book.simdjson.php                                  14-Jun-2024 08:03                2686
book.simplexml.php                                 14-Jun-2024 08:03                5956
book.snmp.php                                      14-Jun-2024 08:03                6467
book.soap.php                                      14-Jun-2024 08:03                6499
book.sockets.php                                   14-Jun-2024 08:03                7140
book.sodium.php                                    14-Jun-2024 08:03               17369
book.solr.php                                      14-Jun-2024 08:03               57594
book.spl.php                                       14-Jun-2024 08:03               10355
book.sqlite3.php                                   14-Jun-2024 08:03                7734
book.sqlsrv.php                                    14-Jun-2024 08:03                6093
book.ssdeep.php                                    14-Jun-2024 08:03                2437
book.ssh2.php                                      14-Jun-2024 08:03                5924
book.stats.php                                     14-Jun-2024 08:03               11874
book.stomp.php                                     14-Jun-2024 08:03                4411                                    14-Jun-2024 08:03               12216
book.strings.php                                   14-Jun-2024 08:03               14839
book.svm.php                                       14-Jun-2024 08:03                4203
book.svn.php                                       14-Jun-2024 08:03                8666
book.swoole.php                                    14-Jun-2024 08:03               37363
book.sync.php                                      14-Jun-2024 08:03                5034
book.taint.php                                     14-Jun-2024 08:03                2645
book.tcpwrap.php                                   14-Jun-2024 08:03                2099
book.tidy.php                                      14-Jun-2024 08:03                7131
book.tokenizer.php                                 14-Jun-2024 08:03                3192
book.trader.php                                    14-Jun-2024 08:03               18747
book.ui.php                                        14-Jun-2024 08:03               27985
book.uodbc.php                                     14-Jun-2024 08:03                7499
book.uopz.php                                      14-Jun-2024 08:03                5323
book.url.php                                       14-Jun-2024 08:03                3125
book.v8js.php                                      14-Jun-2024 08:03                3199
book.var.php                                       14-Jun-2024 08:03                6294
book.var_representation.php                        14-Jun-2024 08:03                2165
book.varnish.php                                   14-Jun-2024 08:03                5863
book.wddx.php                                      14-Jun-2024 08:03                2846
book.win32service.php                              14-Jun-2024 08:03                4331
book.wincache.php                                  14-Jun-2024 08:03                6176
book.wkhtmltox.php                                 14-Jun-2024 08:03                3438
book.xattr.php                                     14-Jun-2024 08:03                2613
book.xdiff.php                                     14-Jun-2024 08:03                4437
book.xhprof.php                                    14-Jun-2024 08:03                2559
book.xlswriter.php                                 14-Jun-2024 08:03                4606
book.xml.php                                       14-Jun-2024 08:03                5773
book.xmldiff.php                                   14-Jun-2024 08:03                3287
book.xmlreader.php                                 14-Jun-2024 08:03                5277
book.xmlrpc.php                                    14-Jun-2024 08:03                3986
book.xmlwriter.php                                 14-Jun-2024 08:03                7116
book.xsl.php                                       14-Jun-2024 08:03                4014
book.yac.php                                       14-Jun-2024 08:03                2879
book.yaconf.php                                    14-Jun-2024 08:03                2233
book.yaf.php                                       14-Jun-2024 08:03               37270
book.yaml.php                                      14-Jun-2024 08:03                2897
book.yar.php                                       14-Jun-2024 08:03                3839
book.yaz.php                                       14-Jun-2024 08:03                4718                                       14-Jun-2024 08:03               11366
book.zlib.php                                      14-Jun-2024 08:03                5589
book.zmq.php                                       14-Jun-2024 08:03                6121
book.zookeeper.php                                 14-Jun-2024 08:03                6700
bzip2.configuration.php                            14-Jun-2024 08:03                1277
bzip2.constants.php                                14-Jun-2024 08:03                1211
bzip2.examples.php                                 14-Jun-2024 08:03                4085
bzip2.installation.php                             14-Jun-2024 08:03                1447
bzip2.requirements.php                             14-Jun-2024 08:03                1413
bzip2.resources.php                                14-Jun-2024 08:03                1326
bzip2.setup.php                                    14-Jun-2024 08:03                1652
cachingiterator.construct.php                      14-Jun-2024 08:03                2890
cachingiterator.count.php                          14-Jun-2024 08:03                2606
cachingiterator.current.php                        14-Jun-2024 08:03                2934
cachingiterator.getcache.php                       14-Jun-2024 08:03                5840
cachingiterator.getflags.php                       14-Jun-2024 08:03                2566
cachingiterator.hasnext.php                        14-Jun-2024 08:03                2707
cachingiterator.key.php                            14-Jun-2024 08:03                2281                           14-Jun-2024 08:03                2540
cachingiterator.offsetexists.php                   14-Jun-2024 08:03                3040
cachingiterator.offsetget.php                      14-Jun-2024 08:03                2812
cachingiterator.offsetset.php                      14-Jun-2024 08:03                3180
cachingiterator.offsetunset.php                    14-Jun-2024 08:03                2852
cachingiterator.rewind.php                         14-Jun-2024 08:03                2538
cachingiterator.setflags.php                       14-Jun-2024 08:03                2882
cachingiterator.tostring.php                       14-Jun-2024 08:03                2652
cachingiterator.valid.php                          14-Jun-2024 08:03                2758
calendar.configuration.php                         14-Jun-2024 08:03                1298
calendar.constants.php                             14-Jun-2024 08:03               13133
calendar.installation.php                          14-Jun-2024 08:03                1576
calendar.requirements.php                          14-Jun-2024 08:03                1271
calendar.resources.php                             14-Jun-2024 08:03                1284
calendar.setup.php                                 14-Jun-2024 08:03                1690
callbackfilteriterator.accept.php                  14-Jun-2024 08:03                3705
callbackfilteriterator.construct.php               14-Jun-2024 08:03                4102
cc.license.php                                     14-Jun-2024 08:03               20763
changelog.misc.php                                 14-Jun-2024 08:03                1372
changelog.mysql.php                                14-Jun-2024 08:03                2752
changelog.mysql_xdevapi.php                        14-Jun-2024 08:03                2411
changelog.mysqli.php                               14-Jun-2024 08:03                1414
changelog.strings.php                              14-Jun-2024 08:03                1467
class.addressinfo.php                              14-Jun-2024 08:03                1801
class.allowdynamicproperties.php                   14-Jun-2024 08:03                5075
class.apcuiterator.php                             14-Jun-2024 08:03                7681
class.appenditerator.php                           14-Jun-2024 08:03                8166
class.argumentcounterror.php                       14-Jun-2024 08:03                8700
class.arithmeticerror.php                          14-Jun-2024 08:03                8833
class.arrayaccess.php                              14-Jun-2024 08:03               11900
class.arrayiterator.php                            14-Jun-2024 08:03               17893
class.arrayobject.php                              14-Jun-2024 08:03               17308
class.assertionerror.php                           14-Jun-2024 08:03                8537
class.attribute.php                                14-Jun-2024 08:03                8778
class.backedenum.php                               14-Jun-2024 08:03                4469
class.badfunctioncallexception.php                 14-Jun-2024 08:03                8617
class.badmethodcallexception.php                   14-Jun-2024 08:03                8637
class.cachingiterator.php                          14-Jun-2024 08:03               17821
class.callbackfilteriterator.php                   14-Jun-2024 08:03               11800
class.closedgeneratorexception.php                 14-Jun-2024 08:03                8767
class.closure.php                                  14-Jun-2024 08:03                7026
class.collator.php                                 14-Jun-2024 08:03               37719
class.collectable.php                              14-Jun-2024 08:03                2617                            14-Jun-2024 08:03                8438                      14-Jun-2024 08:03                1952                                      14-Jun-2024 08:03               13034
class.commonmark-cql.php                           14-Jun-2024 08:03                7361
class.commonmark-interfaces-ivisitable.php         14-Jun-2024 08:03                3007
class.commonmark-interfaces-ivisitor.php           14-Jun-2024 08:03                4603
class.commonmark-node-blockquote.php               14-Jun-2024 08:03                8471
class.commonmark-node-bulletlist.php               14-Jun-2024 08:03               10639
class.commonmark-node-code.php                     14-Jun-2024 08:03                9465
class.commonmark-node-codeblock.php                14-Jun-2024 08:03               10843
class.commonmark-node-customblock.php              14-Jun-2024 08:03                9221
class.commonmark-node-custominline.php             14-Jun-2024 08:03                9201
class.commonmark-node-document.php                 14-Jun-2024 08:03                8445
class.commonmark-node-heading.php                  14-Jun-2024 08:03                9820
class.commonmark-node-htmlblock.php                14-Jun-2024 08:03                9523
class.commonmark-node-htmlinline.php               14-Jun-2024 08:03                9499
class.commonmark-node-image.php                    14-Jun-2024 08:03               10728
class.commonmark-node-item.php                     14-Jun-2024 08:03                8438
class.commonmark-node-linebreak.php                14-Jun-2024 08:03                8452
class.commonmark-node-link.php                     14-Jun-2024 08:03               10721
class.commonmark-node-orderedlist.php              14-Jun-2024 08:03               11605
class.commonmark-node-paragraph.php                14-Jun-2024 08:03                8477
class.commonmark-node-softbreak.php                14-Jun-2024 08:03                8470
class.commonmark-node-text-emphasis.php            14-Jun-2024 08:03                8499
class.commonmark-node-text-strong.php              14-Jun-2024 08:03                8488
class.commonmark-node-text.php                     14-Jun-2024 08:03                9858
class.commonmark-node-thematicbreak.php            14-Jun-2024 08:03                8499
class.commonmark-node.php                          14-Jun-2024 08:03                9380
class.commonmark-parser.php                        14-Jun-2024 08:03                3861
class.compersisthelper.php                         14-Jun-2024 08:03                7494
class.compileerror.php                             14-Jun-2024 08:03                8476
class.componere-abstract-definition.php            14-Jun-2024 08:03                4761
class.componere-definition.php                     14-Jun-2024 08:03               10274
class.componere-method.php                         14-Jun-2024 08:03                4353
class.componere-patch.php                          14-Jun-2024 08:03                8369
class.componere-value.php                          14-Jun-2024 08:03                5456
class.countable.php                                14-Jun-2024 08:03                2657
class.curlfile.php                                 14-Jun-2024 08:03                8532
class.curlhandle.php                               14-Jun-2024 08:03                1805
class.curlmultihandle.php                          14-Jun-2024 08:03                1844
class.curlsharehandle.php                          14-Jun-2024 08:03                1840
class.curlstringfile.php                           14-Jun-2024 08:03                5714
class.dateerror.php                                14-Jun-2024 08:03                9125
class.dateexception.php                            14-Jun-2024 08:03                9753
class.dateinterval.php                             14-Jun-2024 08:03               14402
class.dateinvalidoperationexception.php            14-Jun-2024 08:03                9219
class.dateinvalidtimezoneexception.php             14-Jun-2024 08:03                8762
class.datemalformedintervalstringexception.php     14-Jun-2024 08:03                8858
class.datemalformedperiodstringexception.php       14-Jun-2024 08:03                8839
class.datemalformedstringexception.php             14-Jun-2024 08:03                9161
class.dateobjecterror.php                          14-Jun-2024 08:03                8950
class.dateperiod.php                               14-Jun-2024 08:03               22514
class.daterangeerror.php                           14-Jun-2024 08:03                9091
class.datetime.php                                 14-Jun-2024 08:03               23630
class.datetimeimmutable.php                        14-Jun-2024 08:03               23684
class.datetimeinterface.php                        14-Jun-2024 08:03               20277
class.datetimezone.php                             14-Jun-2024 08:03               15757
class.deflatecontext.php                           14-Jun-2024 08:03                1841                                14-Jun-2024 08:03                5696
class.directoryiterator.php                        14-Jun-2024 08:03               20342
class.divisionbyzeroerror.php                      14-Jun-2024 08:03                8511
class.domainexception.php                          14-Jun-2024 08:03                8562
class.domattr.php                                  14-Jun-2024 08:03               28440
class.domcdatasection.php                          14-Jun-2024 08:03               32165
class.domcharacterdata.php                         14-Jun-2024 08:03               33547
class.domchildnode.php                             14-Jun-2024 08:03                4323
class.domcomment.php                               14-Jun-2024 08:03               30895
class.domdocument.php                              14-Jun-2024 08:03               69336
class.domdocumentfragment.php                      14-Jun-2024 08:03               29215
class.domdocumenttype.php                          14-Jun-2024 08:03               27426
class.domelement.php                               14-Jun-2024 08:03               53598
class.domentity.php                                14-Jun-2024 08:03               28033
class.domentityreference.php                       14-Jun-2024 08:03               23487
class.domexception.php                             14-Jun-2024 08:03                9483
class.domimplementation.php                        14-Jun-2024 08:03                6208
class.domnamednodemap.php                          14-Jun-2024 08:03                7657
class.domnamespacenode.php                         14-Jun-2024 08:03                9432
class.domnode.php                                  14-Jun-2024 08:03               33168
class.domnodelist.php                              14-Jun-2024 08:03                6156
class.domnotation.php                              14-Jun-2024 08:03               23754
class.domparentnode.php                            14-Jun-2024 08:03                3965
class.domprocessinginstruction.php                 14-Jun-2024 08:03               25028
class.domtext.php                                  14-Jun-2024 08:03               33861
class.domxpath.php                                 14-Jun-2024 08:03                8830
class.dotnet.php                                   14-Jun-2024 08:03                7296
class.ds-collection.php                            14-Jun-2024 08:03                6045
class.ds-deque.php                                 14-Jun-2024 08:03               22100
class.ds-hashable.php                              14-Jun-2024 08:03                4136
class.ds-map.php                                   14-Jun-2024 08:03               23010
class.ds-pair.php                                  14-Jun-2024 08:03                4607
class.ds-priorityqueue.php                         14-Jun-2024 08:03                8383
class.ds-queue.php                                 14-Jun-2024 08:03                7873
class.ds-sequence.php                              14-Jun-2024 08:03               23635
class.ds-set.php                                   14-Jun-2024 08:03               18601
class.ds-stack.php                                 14-Jun-2024 08:03                7199
class.ds-vector.php                                14-Jun-2024 08:03               21636
class.emptyiterator.php                            14-Jun-2024 08:03                4349
class.enchantbroker.php                            14-Jun-2024 08:03                1871
class.enchantdictionary.php                        14-Jun-2024 08:03                1861
class.error.php                                    14-Jun-2024 08:03               11180
class.errorexception.php                           14-Jun-2024 08:03               14950
class.ev.php                                       14-Jun-2024 08:03               44468
class.evcheck.php                                  14-Jun-2024 08:03               11296
class.evchild.php                                  14-Jun-2024 08:03               12771
class.evembed.php                                  14-Jun-2024 08:03               10097
class.event.php                                    14-Jun-2024 08:03               19489
class.eventbase.php                                14-Jun-2024 08:03               15935
class.eventbuffer.php                              14-Jun-2024 08:03               24010
class.eventbufferevent.php                         14-Jun-2024 08:03               39564
class.eventconfig.php                              14-Jun-2024 08:03                8087
class.eventdnsbase.php                             14-Jun-2024 08:03               14665
class.eventexception.php                           14-Jun-2024 08:03                8561
class.eventhttp.php                                14-Jun-2024 08:03               10118
class.eventhttpconnection.php                      14-Jun-2024 08:03               10834
class.eventhttprequest.php                         14-Jun-2024 08:03               23344
class.eventlistener.php                            14-Jun-2024 08:03               13309
class.eventsslcontext.php                          14-Jun-2024 08:03               19773
class.eventutil.php                                14-Jun-2024 08:03               25956
class.evfork.php                                   14-Jun-2024 08:03                9123
class.evidle.php                                   14-Jun-2024 08:03               10159
class.evio.php                                     14-Jun-2024 08:03               13121
class.evloop.php                                   14-Jun-2024 08:03               32967
class.evperiodic.php                               14-Jun-2024 08:03               15512
class.evprepare.php                                14-Jun-2024 08:03               11431
class.evsignal.php                                 14-Jun-2024 08:03               12140
class.evstat.php                                   14-Jun-2024 08:03               14845
class.evtimer.php                                  14-Jun-2024 08:03               15042
class.evwatcher.php                                14-Jun-2024 08:03               10199
class.exception.php                                14-Jun-2024 08:03               11388
class.fannconnection.php                           14-Jun-2024 08:03                6605
class.ffi-cdata.php                                14-Jun-2024 08:03                6729
class.ffi-ctype.php                                14-Jun-2024 08:03               31315
class.ffi-exception.php                            14-Jun-2024 08:03                8277
class.ffi-parserexception.php                      14-Jun-2024 08:03                8305
class.ffi.php                                      14-Jun-2024 08:03               19163
class.fiber.php                                    14-Jun-2024 08:03                7994
class.fibererror.php                               14-Jun-2024 08:03                8230
class.filesystemiterator.php                       14-Jun-2024 08:03               32361
class.filteriterator.php                           14-Jun-2024 08:03                7663
class.finfo.php                                    14-Jun-2024 08:03                6254
class.ftp-connection.php                           14-Jun-2024 08:03                1892
class.gdfont.php                                   14-Jun-2024 08:03                1818
class.gdimage.php                                  14-Jun-2024 08:03                1754
class.gearmanclient.php                            14-Jun-2024 08:03               39556
class.gearmanexception.php                         14-Jun-2024 08:03                7244
class.gearmanjob.php                               14-Jun-2024 08:03                9753
class.gearmantask.php                              14-Jun-2024 08:03                9448
class.gearmanworker.php                            14-Jun-2024 08:03               13807
class.gender.php                                   14-Jun-2024 08:03               42363
class.generator.php                                14-Jun-2024 08:03                6813
class.globiterator.php                             14-Jun-2024 08:03               26651
class.gmagick.php                                  14-Jun-2024 08:03               89641
class.gmagickdraw.php                              14-Jun-2024 08:03               25081
class.gmagickpixel.php                             14-Jun-2024 08:03                6022
class.gmp.php                                      14-Jun-2024 08:03                4318
class.hashcontext.php                              14-Jun-2024 08:03                3418
class.hrtime-performancecounter.php                14-Jun-2024 08:03                3906
class.hrtime-stopwatch.php                         14-Jun-2024 08:03                7313
class.hrtime-unit.php                              14-Jun-2024 08:03                4477
class.imagick.php                                  14-Jun-2024 08:03              290393
class.imagickdraw.php                              14-Jun-2024 08:03               84568
class.imagickkernel.php                            14-Jun-2024 08:03                6567
class.imagickpixel.php                             14-Jun-2024 08:03               14016
class.imagickpixeliterator.php                     14-Jun-2024 08:03                9958
class.imap-connection.php                          14-Jun-2024 08:03                1895
class.infiniteiterator.php                         14-Jun-2024 08:03                5451
class.inflatecontext.php                           14-Jun-2024 08:03                1834
class.internaliterator.php                         14-Jun-2024 08:03                4928
class.intlbreakiterator.php                        14-Jun-2024 08:03               31021
class.intlcalendar.php                             14-Jun-2024 08:03               72585
class.intlchar.php                                 14-Jun-2024 08:03              473458
class.intlcodepointbreakiterator.php               14-Jun-2024 08:03               21606
class.intldateformatter.php                        14-Jun-2024 08:03               33503
class.intldatepatterngenerator.php                 14-Jun-2024 08:03                4771
class.intlexception.php                            14-Jun-2024 08:03                8658
class.intlgregoriancalendar.php                    14-Jun-2024 08:03               53275
class.intliterator.php                             14-Jun-2024 08:03                5198
class.intlpartsiterator.php                        14-Jun-2024 08:03                7213
class.intlrulebasedbreakiterator.php               14-Jun-2024 08:03               24704
class.intltimezone.php                             14-Jun-2024 08:03               28978
class.invalidargumentexception.php                 14-Jun-2024 08:03                8567
class.iterator.php                                 14-Jun-2024 08:03               11573
class.iteratoraggregate.php                        14-Jun-2024 08:03                6392
class.iteratoriterator.php                         14-Jun-2024 08:03                6766
class.jsonexception.php                            14-Jun-2024 08:03                8983
class.jsonserializable.php                         14-Jun-2024 08:03                2913
class.ldap-connection.php                          14-Jun-2024 08:03                1915
class.ldap-result-entry.php                        14-Jun-2024 08:03                1930
class.ldap-result.php                              14-Jun-2024 08:03                1907
class.lengthexception.php                          14-Jun-2024 08:03                8491
class.libxmlerror.php                              14-Jun-2024 08:03                5844
class.limititerator.php                            14-Jun-2024 08:03               11599
class.locale.php                                   14-Jun-2024 08:03               29118
class.logicexception.php                           14-Jun-2024 08:03                8601
class.lua.php                                      14-Jun-2024 08:03                7907
class.luaclosure.php                               14-Jun-2024 08:03                2648
class.luasandbox.php                               14-Jun-2024 08:03               14184
class.luasandboxerror.php                          14-Jun-2024 08:03               10128
class.luasandboxerrorerror.php                     14-Jun-2024 08:03                7660
class.luasandboxfatalerror.php                     14-Jun-2024 08:03                7782
class.luasandboxfunction.php                       14-Jun-2024 08:03                3964
class.luasandboxmemoryerror.php                    14-Jun-2024 08:03                7971
class.luasandboxruntimeerror.php                   14-Jun-2024 08:03                7802
class.luasandboxsyntaxerror.php                    14-Jun-2024 08:03                7664
class.luasandboxtimeouterror.php                   14-Jun-2024 08:03                7955
class.memcache.php                                 14-Jun-2024 08:03               19653
class.memcached.php                                14-Jun-2024 08:03               48743
class.memcachedexception.php                       14-Jun-2024 08:03                7635
class.messageformatter.php                         14-Jun-2024 08:03               12894
class.mongodb-bson-binary.php                      14-Jun-2024 08:03               17616
class.mongodb-bson-binaryinterface.php             14-Jun-2024 08:03                4788
class.mongodb-bson-dbpointer.php                   14-Jun-2024 08:03                6145
class.mongodb-bson-decimal128.php                  14-Jun-2024 08:03                7958
class.mongodb-bson-decimal128interface.php         14-Jun-2024 08:03                3923
class.mongodb-bson-document.php                    14-Jun-2024 08:03               14115
class.mongodb-bson-int64.php                       14-Jun-2024 08:03                7639
class.mongodb-bson-iterator.php                    14-Jun-2024 08:03                5029
class.mongodb-bson-javascript.php                  14-Jun-2024 08:03                8966
class.mongodb-bson-javascriptinterface.php         14-Jun-2024 08:03                5007
class.mongodb-bson-maxkey.php                      14-Jun-2024 08:03                6042
class.mongodb-bson-maxkeyinterface.php             14-Jun-2024 08:03                2250
class.mongodb-bson-minkey.php                      14-Jun-2024 08:03                6034
class.mongodb-bson-minkeyinterface.php             14-Jun-2024 08:03                2231
class.mongodb-bson-objectid.php                    14-Jun-2024 08:03                9533
class.mongodb-bson-objectidinterface.php           14-Jun-2024 08:03                4387
class.mongodb-bson-packedarray.php                 14-Jun-2024 08:03               11936
class.mongodb-bson-persistable.php                 14-Jun-2024 08:03                6310
class.mongodb-bson-regex.php                       14-Jun-2024 08:03                8383
class.mongodb-bson-regexinterface.php              14-Jun-2024 08:03                4835
class.mongodb-bson-serializable.php                14-Jun-2024 08:03                4347
class.mongodb-bson-symbol.php                      14-Jun-2024 08:03                6086
class.mongodb-bson-timestamp.php                   14-Jun-2024 08:03                8592
class.mongodb-bson-timestampinterface.php          14-Jun-2024 08:03                4992
class.mongodb-bson-type.php                        14-Jun-2024 08:03                2132
class.mongodb-bson-undefined.php                   14-Jun-2024 08:03                6121
class.mongodb-bson-unserializable.php              14-Jun-2024 08:03                4102
class.mongodb-bson-utcdatetime.php                 14-Jun-2024 08:03                8240
class.mongodb-bson-utcdatetimeinterface.php        14-Jun-2024 08:03                4496
class.mongodb-driver-bulkwrite.php                 14-Jun-2024 08:03               24170
class.mongodb-driver-clientencryption.php          14-Jun-2024 08:03               23496
class.mongodb-driver-command.php                   14-Jun-2024 08:03               14291
class.mongodb-driver-cursor.php                    14-Jun-2024 08:03               26924
class.mongodb-driver-cursorid.php                  14-Jun-2024 08:03                5679
class.mongodb-driver-cursorinterface.php           14-Jun-2024 08:03                6238
class.mongodb-driver-exception-authenticationex..> 14-Jun-2024 08:03                9287
class.mongodb-driver-exception-bulkwriteexcepti..> 14-Jun-2024 08:03               10186
class.mongodb-driver-exception-commandexception..> 14-Jun-2024 08:03               10993
class.mongodb-driver-exception-connectionexcept..> 14-Jun-2024 08:03                9368
class.mongodb-driver-exception-connectiontimeou..> 14-Jun-2024 08:03                9671
class.mongodb-driver-exception-encryptionexcept..> 14-Jun-2024 08:03                9217
class.mongodb-driver-exception-exception.php       14-Jun-2024 08:03                2444
class.mongodb-driver-exception-executiontimeout..> 14-Jun-2024 08:03               10322
class.mongodb-driver-exception-invalidargumente..> 14-Jun-2024 08:03                8340
class.mongodb-driver-exception-logicexception.php  14-Jun-2024 08:03                8127
class.mongodb-driver-exception-runtimeexception..> 14-Jun-2024 08:03               11895
class.mongodb-driver-exception-serverexception.php 14-Jun-2024 08:03                9294
class.mongodb-driver-exception-sslconnectionexc..> 14-Jun-2024 08:03                9662
class.mongodb-driver-exception-unexpectedvaluee..> 14-Jun-2024 08:03                8260
class.mongodb-driver-exception-writeexception.php  14-Jun-2024 08:03               12349
class.mongodb-driver-manager.php                   14-Jun-2024 08:03               21875
class.mongodb-driver-monitoring-commandfailedev..> 14-Jun-2024 08:03                8693
class.mongodb-driver-monitoring-commandstartede..> 14-Jun-2024 08:03                7616
class.mongodb-driver-monitoring-commandsubscrib..> 14-Jun-2024 08:03                6330
class.mongodb-driver-monitoring-commandsucceede..> 14-Jun-2024 08:03                8274
class.mongodb-driver-monitoring-logsubscriber.php  14-Jun-2024 08:03               10189
class.mongodb-driver-monitoring-sdamsubscriber.php 14-Jun-2024 08:03               11680
class.mongodb-driver-monitoring-serverchangedev..> 14-Jun-2024 08:03                5796
class.mongodb-driver-monitoring-serverclosedeve..> 14-Jun-2024 08:03                4443
class.mongodb-driver-monitoring-serverheartbeat..> 14-Jun-2024 08:03                5794
class.mongodb-driver-monitoring-serverheartbeat..> 14-Jun-2024 08:03                4621
class.mongodb-driver-monitoring-serverheartbeat..> 14-Jun-2024 08:03                5866
class.mongodb-driver-monitoring-serveropeningev..> 14-Jun-2024 08:03                4463
class.mongodb-driver-monitoring-subscriber.php     14-Jun-2024 08:03                2698
class.mongodb-driver-monitoring-topologychanged..> 14-Jun-2024 08:03                4791
class.mongodb-driver-monitoring-topologyclosede..> 14-Jun-2024 08:03                3402
class.mongodb-driver-monitoring-topologyopening..> 14-Jun-2024 08:03                3416
class.mongodb-driver-query.php                     14-Jun-2024 08:03                3486
class.mongodb-driver-readconcern.php               14-Jun-2024 08:03               17750
class.mongodb-driver-readpreference.php            14-Jun-2024 08:03               22577
class.mongodb-driver-server.php                    14-Jun-2024 08:03               27805
class.mongodb-driver-serverapi.php                 14-Jun-2024 08:03               14148
class.mongodb-driver-serverdescription.php         14-Jun-2024 08:03               16933
class.mongodb-driver-session.php                   14-Jun-2024 08:03               15592
class.mongodb-driver-topologydescription.php       14-Jun-2024 08:03               11697
class.mongodb-driver-writeconcern.php              14-Jun-2024 08:03               10490
class.mongodb-driver-writeconcernerror.php         14-Jun-2024 08:03                4498
class.mongodb-driver-writeerror.php                14-Jun-2024 08:03                4868
class.mongodb-driver-writeresult.php               14-Jun-2024 08:03                8947
class.multipleiterator.php                         14-Jun-2024 08:03               12132
class.mysql-xdevapi-baseresult.php                 14-Jun-2024 08:03                3099
class.mysql-xdevapi-client.php                     14-Jun-2024 08:03                3181
class.mysql-xdevapi-collection.php                 14-Jun-2024 08:03               10862
class.mysql-xdevapi-collectionadd.php              14-Jun-2024 08:03                3001
class.mysql-xdevapi-collectionfind.php             14-Jun-2024 08:03                8881
class.mysql-xdevapi-collectionmodify.php           14-Jun-2024 08:03               10338
class.mysql-xdevapi-collectionremove.php           14-Jun-2024 08:03                5275
class.mysql-xdevapi-columnresult.php               14-Jun-2024 08:03                6825
class.mysql-xdevapi-crudoperationbindable.php      14-Jun-2024 08:03                3036
class.mysql-xdevapi-crudoperationlimitable.php     14-Jun-2024 08:03                3042
class.mysql-xdevapi-crudoperationskippable.php     14-Jun-2024 08:03                3053
class.mysql-xdevapi-crudoperationsortable.php      14-Jun-2024 08:03                3029
class.mysql-xdevapi-databaseobject.php             14-Jun-2024 08:03                3600
class.mysql-xdevapi-docresult.php                  14-Jun-2024 08:03                4103
class.mysql-xdevapi-exception.php                  14-Jun-2024 08:03                2262
class.mysql-xdevapi-executable.php                 14-Jun-2024 08:03                2678
class.mysql-xdevapi-executionstatus.php            14-Jun-2024 08:03                4920
class.mysql-xdevapi-expression.php                 14-Jun-2024 08:03                3313
class.mysql-xdevapi-result.php                     14-Jun-2024 08:03                4487
class.mysql-xdevapi-rowresult.php                  14-Jun-2024 08:03                5200
class.mysql-xdevapi-schema.php                     14-Jun-2024 08:03                7916
class.mysql-xdevapi-schemaobject.php               14-Jun-2024 08:03                2863
class.mysql-xdevapi-session.php                    14-Jun-2024 08:03                9764
class.mysql-xdevapi-sqlstatement.php               14-Jun-2024 08:03                6738
class.mysql-xdevapi-sqlstatementresult.php         14-Jun-2024 08:03                7382
class.mysql-xdevapi-statement.php                  14-Jun-2024 08:03                5094
class.mysql-xdevapi-table.php                      14-Jun-2024 08:03                7496
class.mysql-xdevapi-tabledelete.php                14-Jun-2024 08:03                5264
class.mysql-xdevapi-tableinsert.php                14-Jun-2024 08:03                3587
class.mysql-xdevapi-tableselect.php                14-Jun-2024 08:03                8416
class.mysql-xdevapi-tableupdate.php                14-Jun-2024 08:03                6193
class.mysql-xdevapi-warning.php                    14-Jun-2024 08:03                3811
class.mysqli-driver.php                            14-Jun-2024 08:03                6858
class.mysqli-result.php                            14-Jun-2024 08:03               16604
class.mysqli-sql-exception.php                     14-Jun-2024 08:03               10103
class.mysqli-stmt.php                              14-Jun-2024 08:03               19442
class.mysqli-warning.php                           14-Jun-2024 08:03                4490
class.mysqli.php                                   14-Jun-2024 08:03               46251
class.norewinditerator.php                         14-Jun-2024 08:03                7047
class.normalizer.php                               14-Jun-2024 08:03               13685
class.numberformatter.php                          14-Jun-2024 08:03               75921
class.oauth.php                                    14-Jun-2024 08:03               20624
class.oauthexception.php                           14-Jun-2024 08:03                8766
class.oauthprovider.php                            14-Jun-2024 08:03               13220
class.ocicollection.php                            14-Jun-2024 08:03                7347
class.ocilob.php                                   14-Jun-2024 08:03               15401
class.opensslasymmetrickey.php                     14-Jun-2024 08:03                1932
class.opensslcertificate.php                       14-Jun-2024 08:03                1920
class.opensslcertificatesigningrequest.php         14-Jun-2024 08:03                2007
class.outeriterator.php                            14-Jun-2024 08:03                4433
class.outofboundsexception.php                     14-Jun-2024 08:03                8649
class.outofrangeexception.php                      14-Jun-2024 08:03                8635
class.overflowexception.php                        14-Jun-2024 08:03                8537
class.override.php                                 14-Jun-2024 08:03                4083
class.parallel-channel.php                         14-Jun-2024 08:03                8253
class.parallel-events-event-type.php               14-Jun-2024 08:03                3421
class.parallel-events-event.php                    14-Jun-2024 08:03                3574
class.parallel-events-input.php                    14-Jun-2024 08:03                4799
class.parallel-events.php                          14-Jun-2024 08:03                7173
class.parallel-future.php                          14-Jun-2024 08:03                7850
class.parallel-runtime.php                         14-Jun-2024 08:03                6455
class.parallel-sync.php                            14-Jun-2024 08:03                5274
class.parentiterator.php                           14-Jun-2024 08:03                9909
class.parle-errorinfo.php                          14-Jun-2024 08:03                3974
class.parle-lexer.php                              14-Jun-2024 08:03               13242
class.parle-lexerexception.php                     14-Jun-2024 08:03                7798
class.parle-parser.php                             14-Jun-2024 08:03               18170
class.parle-parserexception.php                    14-Jun-2024 08:03                7780
class.parle-rlexer.php                             14-Jun-2024 08:03               15477
class.parle-rparser.php                            14-Jun-2024 08:03               18343
class.parle-stack.php                              14-Jun-2024 08:03                4871
class.parle-token.php                              14-Jun-2024 08:03                4981
class.parseerror.php                               14-Jun-2024 08:03                8997
class.pdo.php                                      14-Jun-2024 08:03               43145
class.pdoexception.php                             14-Jun-2024 08:03               10583
class.pdorow.php                                   14-Jun-2024 08:03                4297
class.pdostatement.php                             14-Jun-2024 08:03               23768
class.pgsql-connection.php                         14-Jun-2024 08:03                1938
class.pgsql-lob.php                                14-Jun-2024 08:03                1880
class.pgsql-result.php                             14-Jun-2024 08:03                1912
class.phar.php                                     14-Jun-2024 08:03               75263
class.phardata.php                                 14-Jun-2024 08:03               50146
class.pharexception.php                            14-Jun-2024 08:03                8515
class.pharfileinfo.php                             14-Jun-2024 08:03               22017
class.php-user-filter.php                          14-Jun-2024 08:03                6629
class.phptoken.php                                 14-Jun-2024 08:03                8792
class.pool.php                                     14-Jun-2024 08:03                7924
class.pspell-config.php                            14-Jun-2024 08:03                1914
class.pspell-dictionary.php                        14-Jun-2024 08:03                1951
class.quickhashinthash.php                         14-Jun-2024 08:03               15149
class.quickhashintset.php                          14-Jun-2024 08:03               12927
class.quickhashintstringhash.php                   14-Jun-2024 08:03               16045
class.quickhashstringinthash.php                   14-Jun-2024 08:03               13714
class.random-brokenrandomengineerror.php           14-Jun-2024 08:03                8599
class.random-cryptosafeengine.php                  14-Jun-2024 08:03                2561
class.random-engine-mt19937.php                    14-Jun-2024 08:03                5421
class.random-engine-pcgoneseq128xslrr64.php        14-Jun-2024 08:03                6238
class.random-engine-secure.php                     14-Jun-2024 08:03                3539
class.random-engine-xoshiro256starstar.php         14-Jun-2024 08:03                6414
class.random-engine.php                            14-Jun-2024 08:03                4052
class.random-randomerror.php                       14-Jun-2024 08:03                8549
class.random-randomexception.php                   14-Jun-2024 08:03                8663
class.random-randomizer.php                        14-Jun-2024 08:03               10628
class.rangeexception.php                           14-Jun-2024 08:03                8813
class.rararchive.php                               14-Jun-2024 08:03                8083
class.rarentry.php                                 14-Jun-2024 08:03               53962
class.rarexception.php                             14-Jun-2024 08:03                8640
class.recursivearrayiterator.php                   14-Jun-2024 08:03               16127
class.recursivecachingiterator.php                 14-Jun-2024 08:03               14309
class.recursivecallbackfilteriterator.php          14-Jun-2024 08:03               13553
class.recursivedirectoryiterator.php               14-Jun-2024 08:03               30183
class.recursivefilteriterator.php                  14-Jun-2024 08:03                8549
class.recursiveiterator.php                        14-Jun-2024 08:03                5125
class.recursiveiteratoriterator.php                14-Jun-2024 08:03               15162
class.recursiveregexiterator.php                   14-Jun-2024 08:03               14976
class.recursivetreeiterator.php                    14-Jun-2024 08:03               26205
class.reflection.php                               14-Jun-2024 08:03                3525
class.reflectionattribute.php                      14-Jun-2024 08:03                6611
class.reflectionclass.php                          14-Jun-2024 08:03               39109
class.reflectionclassconstant.php                  14-Jun-2024 08:03               16716
class.reflectionenum.php                           14-Jun-2024 08:03               31597
class.reflectionenumbackedcase.php                 14-Jun-2024 08:03               13026
class.reflectionenumunitcase.php                   14-Jun-2024 08:03               12663
class.reflectionexception.php                      14-Jun-2024 08:03                8466
class.reflectionextension.php                      14-Jun-2024 08:03               10958
class.reflectionfiber.php                          14-Jun-2024 08:03                5226
class.reflectionfunction.php                       14-Jun-2024 08:03               21404
class.reflectionfunctionabstract.php               14-Jun-2024 08:03               20689
class.reflectiongenerator.php                      14-Jun-2024 08:03                6636
class.reflectionintersectiontype.php               14-Jun-2024 08:03                3490
class.reflectionmethod.php                         14-Jun-2024 08:03               33410
class.reflectionnamedtype.php                      14-Jun-2024 08:03                3852
class.reflectionobject.php                         14-Jun-2024 08:03               29377
class.reflectionparameter.php                      14-Jun-2024 08:03               17300
class.reflectionproperty.php                       14-Jun-2024 08:03               23193
class.reflectionreference.php                      14-Jun-2024 08:03                4201
class.reflectiontype.php                           14-Jun-2024 08:03                4540
class.reflectionuniontype.php                      14-Jun-2024 08:03                3368
class.reflectionzendextension.php                  14-Jun-2024 08:03                8114
class.reflector.php                                14-Jun-2024 08:03                3963
class.regexiterator.php                            14-Jun-2024 08:03               18143
class.resourcebundle.php                           14-Jun-2024 08:03               10960
class.returntypewillchange.php                     14-Jun-2024 08:03                3317
class.rnpffi.php                                   14-Jun-2024 08:03                1694
class.rrdcreator.php                               14-Jun-2024 08:03                4716
class.rrdgraph.php                                 14-Jun-2024 08:03                4159
class.rrdupdater.php                               14-Jun-2024 08:03                3454
class.runtimeexception.php                         14-Jun-2024 08:03                8598
class.seaslog.php                                  14-Jun-2024 08:03               21990
class.seekableiterator.php                         14-Jun-2024 08:03               11587
class.sensitiveparameter.php                       14-Jun-2024 08:03                6410
class.sensitiveparametervalue.php                  14-Jun-2024 08:03                5040
class.serializable.php                             14-Jun-2024 08:03                8308
class.sessionhandler.php                           14-Jun-2024 08:03               26434
class.sessionhandlerinterface.php                  14-Jun-2024 08:03               15880
class.sessionidinterface.php                       14-Jun-2024 08:03                3266
class.sessionupdatetimestamphandlerinterface.php   14-Jun-2024 08:03                4514
class.shmop.php                                    14-Jun-2024 08:03                1752
class.simdjsonexception.php                        14-Jun-2024 08:03                5071
class.simdjsonvalueerror.php                       14-Jun-2024 08:03                8376
class.simplexmlelement.php                         14-Jun-2024 08:03               19109
class.simplexmliterator.php                        14-Jun-2024 08:03               16890
class.snmp.php                                     14-Jun-2024 08:03               29719
class.snmpexception.php                            14-Jun-2024 08:03                9178
class.soapclient.php                               14-Jun-2024 08:03               34584
class.soapfault.php                                14-Jun-2024 08:03               14393
class.soapheader.php                               14-Jun-2024 08:03                6092
class.soapparam.php                                14-Jun-2024 08:03                3776
class.soapserver.php                               14-Jun-2024 08:03               10185
class.soapvar.php                                  14-Jun-2024 08:03                7912
class.socket.php                                   14-Jun-2024 08:03                1824
class.sodiumexception.php                          14-Jun-2024 08:03                8455
class.solrclient.php                               14-Jun-2024 08:03               25581
class.solrclientexception.php                      14-Jun-2024 08:03                9813
class.solrcollapsefunction.php                     14-Jun-2024 08:03               11819
class.solrdismaxquery.php                          14-Jun-2024 08:03              111923
class.solrdocument.php                             14-Jun-2024 08:03               23869
class.solrdocumentfield.php                        14-Jun-2024 08:03                4701
class.solrexception.php                            14-Jun-2024 08:03               10294
class.solrgenericresponse.php                      14-Jun-2024 08:03               12736
class.solrillegalargumentexception.php             14-Jun-2024 08:03                9912
class.solrillegaloperationexception.php            14-Jun-2024 08:03                9966
class.solrinputdocument.php                        14-Jun-2024 08:03               19707
class.solrmissingmandatoryparameterexception.php   14-Jun-2024 08:03                9041
class.solrmodifiableparams.php                     14-Jun-2024 08:03                9025
class.solrobject.php                               14-Jun-2024 08:03                6049
class.solrparams.php                               14-Jun-2024 08:03                9347
class.solrpingresponse.php                         14-Jun-2024 08:03               11328
class.solrquery.php                                14-Jun-2024 08:03              122188
class.solrqueryresponse.php                        14-Jun-2024 08:03               12657
class.solrresponse.php                             14-Jun-2024 08:03               14846
class.solrserverexception.php                      14-Jun-2024 08:03                9787
class.solrupdateresponse.php                       14-Jun-2024 08:03               12718
class.solrutils.php                                14-Jun-2024 08:03                5114
class.spldoublylinkedlist.php                      14-Jun-2024 08:03               17773
class.splfileinfo.php                              14-Jun-2024 08:03               18548
class.splfileobject.php                            14-Jun-2024 08:03               38211
class.splfixedarray.php                            14-Jun-2024 08:03               20795
class.splheap.php                                  14-Jun-2024 08:03                7899
class.splmaxheap.php                               14-Jun-2024 08:03                7278
class.splminheap.php                               14-Jun-2024 08:03                7287
class.splobjectstorage.php                         14-Jun-2024 08:03               21576
class.splobserver.php                              14-Jun-2024 08:03                2958
class.splpriorityqueue.php                         14-Jun-2024 08:03               12166
class.splqueue.php                                 14-Jun-2024 08:03               17432
class.splstack.php                                 14-Jun-2024 08:03               14548
class.splsubject.php                               14-Jun-2024 08:03                3821
class.spltempfileobject.php                        14-Jun-2024 08:03               31884
class.spoofchecker.php                             14-Jun-2024 08:03               17899
class.sqlite3.php                                  14-Jun-2024 08:03               40163
class.sqlite3exception.php                         14-Jun-2024 08:03                8428
class.sqlite3result.php                            14-Jun-2024 08:03                6013
class.sqlite3stmt.php                              14-Jun-2024 08:03                8620
class.stdclass.php                                 14-Jun-2024 08:03                6834
class.stomp.php                                    14-Jun-2024 08:03               21883
class.stompexception.php                           14-Jun-2024 08:03                6022
class.stompframe.php                               14-Jun-2024 08:03                4418
class.streamwrapper.php                            14-Jun-2024 08:03               20626
class.stringable.php                               14-Jun-2024 08:03                8381
class.svm.php                                      14-Jun-2024 08:03               19690
class.svmmodel.php                                 14-Jun-2024 08:03                7364
class.swoole-async.php                             14-Jun-2024 08:03                8044
class.swoole-atomic.php                            14-Jun-2024 08:03                5073
class.swoole-buffer.php                            14-Jun-2024 08:03                7528
class.swoole-channel.php                           14-Jun-2024 08:03                3971
class.swoole-client.php                            14-Jun-2024 08:03               16545
class.swoole-connection-iterator.php               14-Jun-2024 08:03                7524
class.swoole-coroutine.php                         14-Jun-2024 08:03               18660
class.swoole-event.php                             14-Jun-2024 08:03                7467
class.swoole-exception.php                         14-Jun-2024 08:03                4586
class.swoole-http-client.php                       14-Jun-2024 08:03               14790
class.swoole-http-request.php                      14-Jun-2024 08:03                3036
class.swoole-http-response.php                     14-Jun-2024 08:03               10912
class.swoole-http-server.php                       14-Jun-2024 08:03               26442
class.swoole-lock.php                              14-Jun-2024 08:03                4681
class.swoole-mmap.php                              14-Jun-2024 08:03                3082
class.swoole-mysql-exception.php                   14-Jun-2024 08:03                4627
class.swoole-mysql.php                             14-Jun-2024 08:03                5420
class.swoole-process.php                           14-Jun-2024 08:03               13675
class.swoole-redis-server.php                      14-Jun-2024 08:03               32080
class.swoole-serialize.php                         14-Jun-2024 08:03                3614
class.swoole-server.php                            14-Jun-2024 08:03               29579
class.swoole-table.php                             14-Jun-2024 08:03               12725
class.swoole-timer.php                             14-Jun-2024 08:03                5002
class.swoole-websocket-frame.php                   14-Jun-2024 08:03                1960
class.swoole-websocket-server.php                  14-Jun-2024 08:03                7835
class.syncevent.php                                14-Jun-2024 08:03                5117
class.syncmutex.php                                14-Jun-2024 08:03                4345
class.syncreaderwriter.php                         14-Jun-2024 08:03                5356
class.syncsemaphore.php                            14-Jun-2024 08:03                4794
class.syncsharedmemory.php                         14-Jun-2024 08:03                5507
class.sysvmessagequeue.php                         14-Jun-2024 08:03                1922
class.sysvsemaphore.php                            14-Jun-2024 08:03                1907
class.sysvsharedmemory.php                         14-Jun-2024 08:03                1927
class.thread.php                                   14-Jun-2024 08:03               11579
class.threaded.php                                 14-Jun-2024 08:03                9036
class.throwable.php                                14-Jun-2024 08:03                7568
class.tidy.php                                     14-Jun-2024 08:03               19129
class.tidynode.php                                 14-Jun-2024 08:03               11838
class.transliterator.php                           14-Jun-2024 08:03               10438
class.traversable.php                              14-Jun-2024 08:03                4604
class.typeerror.php                                14-Jun-2024 08:03                9580
class.uconverter.php                               14-Jun-2024 08:03               41525
class.ui-area.php                                  14-Jun-2024 08:03               12261
class.ui-control.php                               14-Jun-2024 08:03                5479
class.ui-controls-box.php                          14-Jun-2024 08:03               10130
class.ui-controls-button.php                       14-Jun-2024 08:03                6683
class.ui-controls-check.php                        14-Jun-2024 08:03                7527
class.ui-controls-colorbutton.php                  14-Jun-2024 08:03                6562
class.ui-controls-combo.php                        14-Jun-2024 08:03                6651
class.ui-controls-editablecombo.php                14-Jun-2024 08:03                6763
class.ui-controls-entry.php                        14-Jun-2024 08:03                9651
class.ui-controls-form.php                         14-Jun-2024 08:03                8053
class.ui-controls-grid.php                         14-Jun-2024 08:03               13161
class.ui-controls-group.php                        14-Jun-2024 08:03                8361
class.ui-controls-label.php                        14-Jun-2024 08:03                6434
class.ui-controls-multilineentry.php               14-Jun-2024 08:03                9894
class.ui-controls-picker.php                       14-Jun-2024 08:03                7580
class.ui-controls-progress.php                     14-Jun-2024 08:03                5935
class.ui-controls-radio.php                        14-Jun-2024 08:03                6630
class.ui-controls-separator.php                    14-Jun-2024 08:03                7084
class.ui-controls-slider.php                       14-Jun-2024 08:03                7018
class.ui-controls-spin.php                         14-Jun-2024 08:03                6888
class.ui-controls-tab.php                          14-Jun-2024 08:03                9159
class.ui-draw-brush-gradient.php                   14-Jun-2024 08:03                7343
class.ui-draw-brush-lineargradient.php             14-Jun-2024 08:03                6594
class.ui-draw-brush-radialgradient.php             14-Jun-2024 08:03                6780
class.ui-draw-brush.php                            14-Jun-2024 08:03                4439
class.ui-draw-color.php                            14-Jun-2024 08:03                8595
class.ui-draw-line-cap.php                         14-Jun-2024 08:03                3755
class.ui-draw-line-join.php                        14-Jun-2024 08:03                3739
class.ui-draw-matrix.php                           14-Jun-2024 08:03                5629
class.ui-draw-path.php                             14-Jun-2024 08:03               10771
class.ui-draw-pen.php                              14-Jun-2024 08:03                8136
class.ui-draw-stroke.php                           14-Jun-2024 08:03                6887
class.ui-draw-text-font-descriptor.php             14-Jun-2024 08:03                6049
class.ui-draw-text-font-italic.php                 14-Jun-2024 08:03                4114
class.ui-draw-text-font-stretch.php                14-Jun-2024 08:03                8310
class.ui-draw-text-font-weight.php                 14-Jun-2024 08:03                8912
class.ui-draw-text-font.php                        14-Jun-2024 08:03                4878
class.ui-draw-text-layout.php                      14-Jun-2024 08:03                5288
class.ui-exception-invalidargumentexception.php    14-Jun-2024 08:03                7813
class.ui-exception-runtimeexception.php            14-Jun-2024 08:03                7736
class.ui-executor.php                              14-Jun-2024 08:03                5439
class.ui-key.php                                   14-Jun-2024 08:03               21354
class.ui-menu.php                                  14-Jun-2024 08:03                6297
class.ui-menuitem.php                              14-Jun-2024 08:03                3767
class.ui-point.php                                 14-Jun-2024 08:03                6314
class.ui-size.php                                  14-Jun-2024 08:03                6410
class.ui-window.php                                14-Jun-2024 08:03               13118
class.underflowexception.php                       14-Jun-2024 08:03                8711
class.unexpectedvalueexception.php                 14-Jun-2024 08:03                8837
class.unhandledmatcherror.php                      14-Jun-2024 08:03                8588
class.unitenum.php                                 14-Jun-2024 08:03                2953
class.v8js.php                                     14-Jun-2024 08:03                9274
class.v8jsexception.php                            14-Jun-2024 08:03               11367
class.valueerror.php                               14-Jun-2024 08:03                8639
class.variant.php                                  14-Jun-2024 08:03                5900
class.varnishadmin.php                             14-Jun-2024 08:03               11911
class.varnishlog.php                               14-Jun-2024 08:03               35139
class.varnishstat.php                              14-Jun-2024 08:03                3039
class.volatile.php                                 14-Jun-2024 08:03               11760
class.vtiful-kernel-excel.php                      14-Jun-2024 08:03               12292
class.vtiful-kernel-format.php                     14-Jun-2024 08:03               16089
class.weakmap.php                                  14-Jun-2024 08:03                9673
class.weakreference.php                            14-Jun-2024 08:03                5764
class.win32serviceexception.php                    14-Jun-2024 08:03                7909
class.wkhtmltox-image-converter.php                14-Jun-2024 08:03                4216
class.wkhtmltox-pdf-converter.php                  14-Jun-2024 08:03                4586
class.wkhtmltox-pdf-object.php                     14-Jun-2024 08:03                3025
class.worker.php                                   14-Jun-2024 08:03                9165
class.xmldiff-base.php                             14-Jun-2024 08:03                4239
class.xmldiff-dom.php                              14-Jun-2024 08:03                5174
class.xmldiff-file.php                             14-Jun-2024 08:03                5145
class.xmldiff-memory.php                           14-Jun-2024 08:03                5161
class.xmlparser.php                                14-Jun-2024 08:03                1848
class.xmlreader.php                                14-Jun-2024 08:03               41519
class.xmlwriter.php                                14-Jun-2024 08:03               32913
class.xsltprocessor.php                            14-Jun-2024 08:03               11757
class.yac.php                                      14-Jun-2024 08:03                9842
class.yaconf.php                                   14-Jun-2024 08:03                3585
class.yaf-action-abstract.php                      14-Jun-2024 08:03               12877
class.yaf-application.php                          14-Jun-2024 08:03               13133
class.yaf-bootstrap-abstract.php                   14-Jun-2024 08:03                5707
class.yaf-config-abstract.php                      14-Jun-2024 08:03                5344
class.yaf-config-ini.php                           14-Jun-2024 08:03               18368
class.yaf-config-simple.php                        14-Jun-2024 08:03               13252
class.yaf-controller-abstract.php                  14-Jun-2024 08:03               19755
class.yaf-dispatcher.php                           14-Jun-2024 08:03               20815
class.yaf-exception-dispatchfailed.php             14-Jun-2024 08:03                2674
class.yaf-exception-loadfailed-action.php          14-Jun-2024 08:03                2745
class.yaf-exception-loadfailed-controller.php      14-Jun-2024 08:03                2770
class.yaf-exception-loadfailed-module.php          14-Jun-2024 08:03                2734
class.yaf-exception-loadfailed-view.php            14-Jun-2024 08:03                2674
class.yaf-exception-loadfailed.php                 14-Jun-2024 08:03                2648
class.yaf-exception-routerfailed.php               14-Jun-2024 08:03                2659
class.yaf-exception-startuperror.php               14-Jun-2024 08:03                2657
class.yaf-exception-typeerror.php                  14-Jun-2024 08:03                2628
class.yaf-exception.php                            14-Jun-2024 08:03                8507
class.yaf-loader.php                               14-Jun-2024 08:03               19912
class.yaf-plugin-abstract.php                      14-Jun-2024 08:03               16197
class.yaf-registry.php                             14-Jun-2024 08:03                6228
class.yaf-request-abstract.php                     14-Jun-2024 08:03               24394
class.yaf-request-http.php                         14-Jun-2024 08:03               23622
class.yaf-request-simple.php                       14-Jun-2024 08:03               22854
class.yaf-response-abstract.php                    14-Jun-2024 08:03               12062
class.yaf-route-interface.php                      14-Jun-2024 08:03                3800
class.yaf-route-map.php                            14-Jun-2024 08:03                6768
class.yaf-route-regex.php                          14-Jun-2024 08:03                8431
class.yaf-route-rewrite.php                        14-Jun-2024 08:03                7601
class.yaf-route-simple.php                         14-Jun-2024 08:03                6730
class.yaf-route-static.php                         14-Jun-2024 08:03                5248
class.yaf-route-supervar.php                       14-Jun-2024 08:03                4763
class.yaf-router.php                               14-Jun-2024 08:03               12736
class.yaf-session.php                              14-Jun-2024 08:03               12667
class.yaf-view-interface.php                       14-Jun-2024 08:03                6185
class.yaf-view-simple.php                          14-Jun-2024 08:03               11492
class.yar-client-exception.php                     14-Jun-2024 08:03                6665
class.yar-client.php                               14-Jun-2024 08:03                5875
class.yar-concurrent-client.php                    14-Jun-2024 08:03                6678
class.yar-server-exception.php                     14-Jun-2024 08:03                7128
class.yar-server.php                               14-Jun-2024 08:03                3519
class.ziparchive.php                               14-Jun-2024 08:03               91343
class.zmq.php                                      14-Jun-2024 08:03               42161
class.zmqcontext.php                               14-Jun-2024 08:03                5701
class.zmqdevice.php                                14-Jun-2024 08:03                7368
class.zmqpoll.php                                  14-Jun-2024 08:03                5347
class.zmqsocket.php                                14-Jun-2024 08:03               11649
class.zookeeper.php                                14-Jun-2024 08:03               56126
class.zookeeperauthenticationexception.php         14-Jun-2024 08:03                7743
class.zookeeperconfig.php                          14-Jun-2024 08:03                6459
class.zookeeperconnectionexception.php             14-Jun-2024 08:03                7738
class.zookeeperexception.php                       14-Jun-2024 08:03                7604
class.zookeepermarshallingexception.php            14-Jun-2024 08:03                7759
class.zookeepernonodeexception.php                 14-Jun-2024 08:03                7726
class.zookeeperoperationtimeoutexception.php       14-Jun-2024 08:03                7769
class.zookeepersessionexception.php                14-Jun-2024 08:03                7716
classobj.configuration.php                         14-Jun-2024 08:03                1298
classobj.constants.php                             14-Jun-2024 08:03                1241
classobj.examples.php                              14-Jun-2024 08:03               13409
classobj.installation.php                          14-Jun-2024 08:03                1326
classobj.requirements.php                          14-Jun-2024 08:03                1271
classobj.resources.php                             14-Jun-2024 08:03                1284
classobj.setup.php                                 14-Jun-2024 08:03                1672
closure.bind.php                                   14-Jun-2024 08:03                7955
closure.bindto.php                                 14-Jun-2024 08:03                9569                                   14-Jun-2024 08:03                6378
closure.construct.php                              14-Jun-2024 08:03                2494
closure.fromcallable.php                           14-Jun-2024 08:03                3914
cmark.constants.php                                14-Jun-2024 08:03                4288
cmark.installation.php                             14-Jun-2024 08:03                2004
cmark.requirements.php                             14-Jun-2024 08:03                1335
cmark.setup.php                                    14-Jun-2024 08:03                1476
collator.asort.php                                 14-Jun-2024 08:03                9704                               14-Jun-2024 08:03               10636
collator.construct.php                             14-Jun-2024 08:03                5710
collator.create.php                                14-Jun-2024 08:03                5692
collator.getattribute.php                          14-Jun-2024 08:03                6147
collator.geterrorcode.php                          14-Jun-2024 08:03                5415
collator.geterrormessage.php                       14-Jun-2024 08:03                5496
collator.getlocale.php                             14-Jun-2024 08:03                7017
collator.getsortkey.php                            14-Jun-2024 08:03                7168
collator.getstrength.php                           14-Jun-2024 08:03                4917
collator.setattribute.php                          14-Jun-2024 08:03                6763
collator.setstrength.php                           14-Jun-2024 08:03               13709
collator.sort.php                                  14-Jun-2024 08:03                8569
collator.sortwithsortkeys.php                      14-Jun-2024 08:03                6724
collectable.isgarbage.php                          14-Jun-2024 08:03                3526
com.configuration.php                              14-Jun-2024 08:03                8629
com.constants.php                                  14-Jun-2024 08:03               27068
com.construct.php                                  14-Jun-2024 08:03               10592
com.error-handling.php                             14-Jun-2024 08:03                1640
com.examples.arrays.php                            14-Jun-2024 08:03                2410
com.examples.foreach.php                           14-Jun-2024 08:03                3027
com.examples.php                                   14-Jun-2024 08:03                1513
com.installation.php                               14-Jun-2024 08:03                1558
com.requirements.php                               14-Jun-2024 08:03                1317
com.resources.php                                  14-Jun-2024 08:03                1249
com.setup.php                                      14-Jun-2024 08:03                1625
commonmark-cql.construct.php                       14-Jun-2024 08:03                2246
commonmark-cql.invoke.php                          14-Jun-2024 08:03                3925
commonmark-interfaces-ivisitable.accept.php        14-Jun-2024 08:03                3162
commonmark-interfaces-ivisitor.enter.php           14-Jun-2024 08:03                4195
commonmark-interfaces-ivisitor.leave.php           14-Jun-2024 08:03                4197
commonmark-node-bulletlist.construct.php           14-Jun-2024 08:03                3254
commonmark-node-codeblock.construct.php            14-Jun-2024 08:03                2897
commonmark-node-heading.construct.php              14-Jun-2024 08:03                2695
commonmark-node-image.construct.php                14-Jun-2024 08:03                3340
commonmark-node-link.construct.php                 14-Jun-2024 08:03                3337
commonmark-node-orderedlist.construct.php          14-Jun-2024 08:03                4225
commonmark-node-text.construct.php                 14-Jun-2024 08:03                2725
commonmark-node.accept.php                         14-Jun-2024 08:03                2902
commonmark-node.appendchild.php                    14-Jun-2024 08:03                2769
commonmark-node.insertafter.php                    14-Jun-2024 08:03                2794
commonmark-node.insertbefore.php                   14-Jun-2024 08:03                2792
commonmark-node.prependchild.php                   14-Jun-2024 08:03                2796
commonmark-node.replace.php                        14-Jun-2024 08:03                2740
commonmark-node.unlink.php                         14-Jun-2024 08:03                2449
commonmark-parser.construct.php                    14-Jun-2024 08:03                3870
commonmark-parser.finish.php                       14-Jun-2024 08:03                2479
commonmark-parser.parse.php                        14-Jun-2024 08:03                2699
compersisthelper.construct.php                     14-Jun-2024 08:03                3653
compersisthelper.getcurfilename.php                14-Jun-2024 08:03                3186
compersisthelper.getmaxstreamsize.php              14-Jun-2024 08:03                3192
compersisthelper.initnew.php                       14-Jun-2024 08:03                3163
compersisthelper.loadfromfile.php                  14-Jun-2024 08:03                4368
compersisthelper.loadfromstream.php                14-Jun-2024 08:03                3586
compersisthelper.savetofile.php                    14-Jun-2024 08:03                6370
compersisthelper.savetostream.php                  14-Jun-2024 08:03                3613
componere-abstract-definition.addinterface.php     14-Jun-2024 08:03                3305
componere-abstract-definition.addmethod.php        14-Jun-2024 08:03                4038
componere-abstract-definition.addtrait.php         14-Jun-2024 08:03                3257
componere-abstract-definition.getreflector.php     14-Jun-2024 08:03                2422
componere-definition.addconstant.php               14-Jun-2024 08:03                4375
componere-definition.addproperty.php               14-Jun-2024 08:03                3770
componere-definition.construct.php                 14-Jun-2024 08:03                6020
componere-definition.getclosure.php                14-Jun-2024 08:03                3476
componere-definition.getclosures.php               14-Jun-2024 08:03                2711
componere-definition.isregistered.php              14-Jun-2024 08:03                2304
componere-definition.register.php                  14-Jun-2024 08:03                2456
componere-method.construct.php                     14-Jun-2024 08:03                2242
componere-method.getreflector.php                  14-Jun-2024 08:03                2225
componere-method.setprivate.php                    14-Jun-2024 08:03                2460
componere-method.setprotected.php                  14-Jun-2024 08:03                2475
componere-method.setstatic.php                     14-Jun-2024 08:03                2050
componere-patch.apply.php                          14-Jun-2024 08:03                1907
componere-patch.construct.php                      14-Jun-2024 08:03                3668
componere-patch.derive.php                         14-Jun-2024 08:03                3162
componere-patch.getclosure.php                     14-Jun-2024 08:03                3099
componere-patch.getclosures.php                    14-Jun-2024 08:03                2225
componere-patch.isapplied.php                      14-Jun-2024 08:03                1861
componere-patch.revert.php                         14-Jun-2024 08:03                1904
componere-value.construct.php                      14-Jun-2024 08:03                2682
componere-value.hasdefault.php                     14-Jun-2024 08:03                1908
componere-value.isprivate.php                      14-Jun-2024 08:03                1926
componere-value.isprotected.php                    14-Jun-2024 08:03                1936
componere-value.isstatic.php                       14-Jun-2024 08:03                1920
componere-value.setprivate.php                     14-Jun-2024 08:03                2483
componere-value.setprotected.php                   14-Jun-2024 08:03                2497
componere-value.setstatic.php                      14-Jun-2024 08:03                2067
componere.cast.php                                 14-Jun-2024 08:03                4960
componere.cast_by_ref.php                          14-Jun-2024 08:03                5137
componere.installation.php                         14-Jun-2024 08:03                1377
componere.requirements.php                         14-Jun-2024 08:03                1225
componere.setup.php                                14-Jun-2024 08:03                1515
configuration.changes.modes.php                    14-Jun-2024 08:03                4300
configuration.changes.php                          14-Jun-2024 08:03                9616
configuration.file.per-user.php                    14-Jun-2024 08:03                3387
configuration.file.php                             14-Jun-2024 08:03               10748
configuration.php                                  14-Jun-2024 08:03                1779
configure.about.php                                14-Jun-2024 08:03               13258
configure.php                                      14-Jun-2024 08:03                1487
context.ftp.php                                    14-Jun-2024 08:03                4327
context.http.php                                   14-Jun-2024 08:03               16389
context.params.php                                 14-Jun-2024 08:03                2565
context.phar.php                                   14-Jun-2024 08:03                2847
context.php                                        14-Jun-2024 08:03                3067
context.socket.php                                 14-Jun-2024 08:03                9859
context.ssl.php                                    14-Jun-2024 08:03               13030                                    14-Jun-2024 08:03                4343
context.zlib.php                                   14-Jun-2024 08:03                2531
control-structures.alternative-syntax.php          14-Jun-2024 08:03                6981
control-structures.break.php                       14-Jun-2024 08:03                4731
control-structures.continue.php                    14-Jun-2024 08:03                8259
control-structures.declare.php                     14-Jun-2024 08:03               10364                    14-Jun-2024 08:03                5241
control-structures.else.php                        14-Jun-2024 08:03                4977
control-structures.elseif.php                      14-Jun-2024 08:03                7724
control-structures.for.php                         14-Jun-2024 08:03               11970
control-structures.foreach.php                     14-Jun-2024 08:03               21093
control-structures.goto.php                        14-Jun-2024 08:03                7247
control-structures.if.php                          14-Jun-2024 08:03                5102
control-structures.intro.php                       14-Jun-2024 08:03                2684
control-structures.match.php                       14-Jun-2024 08:03               20638
control-structures.switch.php                      14-Jun-2024 08:03               19262
control-structures.while.php                       14-Jun-2024 08:03                4694
copyright.php                                      14-Jun-2024 08:03                2117
countable.count.php                                14-Jun-2024 08:03                5578
ctype.configuration.php                            14-Jun-2024 08:03                1277
ctype.constants.php                                14-Jun-2024 08:03                1213
ctype.installation.php                             14-Jun-2024 08:03                1574
ctype.requirements.php                             14-Jun-2024 08:03                1296
ctype.resources.php                                14-Jun-2024 08:03                1263
ctype.setup.php                                    14-Jun-2024 08:03                1633
cubrid.configuration.php                           14-Jun-2024 08:03                1308
cubrid.constants.php                               14-Jun-2024 08:03               15782
cubrid.examples.php                                14-Jun-2024 08:03               14357
cubrid.installation.php                            14-Jun-2024 08:03                2314
cubrid.requirements.php                            14-Jun-2024 08:03                1320
cubrid.resources.php                               14-Jun-2024 08:03                3382
cubrid.setup.php                                   14-Jun-2024 08:03                1653
cubridmysql.cubrid.php                             14-Jun-2024 08:03                5637
curl.configuration.php                             14-Jun-2024 08:03                2666
curl.constants.php                                 14-Jun-2024 08:03              205281
curl.examples-basic.php                            14-Jun-2024 08:03                4659
curl.examples.php                                  14-Jun-2024 08:03                1408
curl.installation.php                              14-Jun-2024 08:03                2617
curl.requirements.php                              14-Jun-2024 08:03                1533
curl.resources.php                                 14-Jun-2024 08:03                1472
curl.setup.php                                     14-Jun-2024 08:03                1646
curlfile.construct.php                             14-Jun-2024 08:03               21299
curlfile.getfilename.php                           14-Jun-2024 08:03                2207
curlfile.getmimetype.php                           14-Jun-2024 08:03                2203
curlfile.getpostfilename.php                       14-Jun-2024 08:03                2265
curlfile.setmimetype.php                           14-Jun-2024 08:03                2497
curlfile.setpostfilename.php                       14-Jun-2024 08:03                2550
curlstringfile.construct.php                       14-Jun-2024 08:03                7046
dateinterval.construct.php                         14-Jun-2024 08:03               13740
dateinterval.createfromdatestring.php              14-Jun-2024 08:03               15634
dateinterval.format.php                            14-Jun-2024 08:03               14844
dateperiod.construct.php                           14-Jun-2024 08:03               20437
dateperiod.createfromiso8601string.php             14-Jun-2024 08:03                7897
dateperiod.getdateinterval.php                     14-Jun-2024 08:03                4706
dateperiod.getenddate.php                          14-Jun-2024 08:03                7798
dateperiod.getrecurrences.php                      14-Jun-2024 08:03                8947
dateperiod.getstartdate.php                        14-Jun-2024 08:03                5308
datetime.add.php                                   14-Jun-2024 08:03                4963
datetime.configuration.php                         14-Jun-2024 08:03                6672
datetime.constants.php                             14-Jun-2024 08:03                3007
datetime.construct.php                             14-Jun-2024 08:03                6533
datetime.createfromformat.php                      14-Jun-2024 08:03                7401
datetime.createfromimmutable.php                   14-Jun-2024 08:03                4940
datetime.createfrominterface.php                   14-Jun-2024 08:03                4926
datetime.diff.php                                  14-Jun-2024 08:03               17400
datetime.error.tree.php                            14-Jun-2024 08:03                3340
datetime.examples-arithmetic.php                   14-Jun-2024 08:03               15369
datetime.examples.php                              14-Jun-2024 08:03                1493
datetime.format.php                                14-Jun-2024 08:03               27740
datetime.formats.php                               14-Jun-2024 08:03               57074
datetime.getlasterrors.php                         14-Jun-2024 08:03                1889
datetime.getoffset.php                             14-Jun-2024 08:03                7917
datetime.gettimestamp.php                          14-Jun-2024 08:03               10422
datetime.gettimezone.php                           14-Jun-2024 08:03                7845
datetime.installation.php                          14-Jun-2024 08:03                1747
datetime.modify.php                                14-Jun-2024 08:03               14460
datetime.requirements.php                          14-Jun-2024 08:03                1271
datetime.resources.php                             14-Jun-2024 08:03                1284
datetime.set-state.php                             14-Jun-2024 08:03                3068
datetime.setdate.php                               14-Jun-2024 08:03                5681
datetime.setisodate.php                            14-Jun-2024 08:03                5815
datetime.settime.php                               14-Jun-2024 08:03                7218
datetime.settimestamp.php                          14-Jun-2024 08:03                5135
datetime.settimezone.php                           14-Jun-2024 08:03                9538
datetime.setup.php                                 14-Jun-2024 08:03                1700
datetime.sub.php                                   14-Jun-2024 08:03                6381
datetime.wakeup.php                                14-Jun-2024 08:03                3074
datetimeimmutable.add.php                          14-Jun-2024 08:03               10617
datetimeimmutable.construct.php                    14-Jun-2024 08:03               18568
datetimeimmutable.createfromformat.php             14-Jun-2024 08:03               49144
datetimeimmutable.createfrominterface.php          14-Jun-2024 08:03                5188
datetimeimmutable.createfrommutable.php            14-Jun-2024 08:03                5094
datetimeimmutable.getlasterrors.php                14-Jun-2024 08:03                5763
datetimeimmutable.modify.php                       14-Jun-2024 08:03                9506
datetimeimmutable.set-state.php                    14-Jun-2024 08:03                2832
datetimeimmutable.setdate.php                      14-Jun-2024 08:03                9228
datetimeimmutable.setisodate.php                   14-Jun-2024 08:03               12842
datetimeimmutable.settime.php                      14-Jun-2024 08:03               12090
datetimeimmutable.settimestamp.php                 14-Jun-2024 08:03                5876
datetimeimmutable.settimezone.php                  14-Jun-2024 08:03                6066
datetimeimmutable.sub.php                          14-Jun-2024 08:03               12108
datetimezone.construct.php                         14-Jun-2024 08:03               10982
datetimezone.getlocation.php                       14-Jun-2024 08:03                6096
datetimezone.getname.php                           14-Jun-2024 08:03                3796
datetimezone.getoffset.php                         14-Jun-2024 08:03                7370
datetimezone.gettransitions.php                    14-Jun-2024 08:03               12313
datetimezone.listabbreviations.php                 14-Jun-2024 08:03                6260
datetimezone.listidentifiers.php                   14-Jun-2024 08:03               14825
dba.configuration.php                              14-Jun-2024 08:03                2386
dba.constants.php                                  14-Jun-2024 08:03                2292
dba.example.php                                    14-Jun-2024 08:03                6437
dba.examples.php                                   14-Jun-2024 08:03                1371
dba.installation.php                               14-Jun-2024 08:03               10749
dba.requirements.php                               14-Jun-2024 08:03                7809
dba.resources.php                                  14-Jun-2024 08:03                1565
dba.setup.php                                      14-Jun-2024 08:03                1630
dbase.configuration.php                            14-Jun-2024 08:03                1277
dbase.constants.php                                14-Jun-2024 08:03                3813
dbase.installation.php                             14-Jun-2024 08:03                1773
dbase.requirements.php                             14-Jun-2024 08:03                1250
dbase.resources.php                                14-Jun-2024 08:03                1552
dbase.setup.php                                    14-Jun-2024 08:03                1651
debugger-about.php                                 14-Jun-2024 08:03                1599
debugger.php                                       14-Jun-2024 08:03                1452
dio.configuration.php                              14-Jun-2024 08:03                1263
dio.constants.php                                  14-Jun-2024 08:03               11059
dio.installation.php                               14-Jun-2024 08:03                2243
dio.requirements.php                               14-Jun-2024 08:03                1236
dio.resources.php                                  14-Jun-2024 08:03                1416
dio.setup.php                                      14-Jun-2024 08:03                1632
dir.configuration.php                              14-Jun-2024 08:03                1263
dir.constants.php                                  14-Jun-2024 08:03                2837
dir.installation.php                               14-Jun-2024 08:03                1291
dir.requirements.php                               14-Jun-2024 08:03                1236
dir.resources.php                                  14-Jun-2024 08:03                1249
dir.setup.php                                      14-Jun-2024 08:03                1625
directory.close.php                                14-Jun-2024 08:03                2234                                 14-Jun-2024 08:03                2375
directory.rewind.php                               14-Jun-2024 08:03                2260
directoryiterator.construct.php                    14-Jun-2024 08:03                5871
directoryiterator.current.php                      14-Jun-2024 08:03                6243
directoryiterator.getbasename.php                  14-Jun-2024 08:03                6434
directoryiterator.getextension.php                 14-Jun-2024 08:03                6232
directoryiterator.getfilename.php                  14-Jun-2024 08:03                5200
directoryiterator.isdot.php                        14-Jun-2024 08:03                5330
directoryiterator.key.php                          14-Jun-2024 08:03                6642                         14-Jun-2024 08:03                5532
directoryiterator.rewind.php                       14-Jun-2024 08:03                5433                         14-Jun-2024 08:03                5496
directoryiterator.tostring.php                     14-Jun-2024 08:03                4668
directoryiterator.valid.php                        14-Jun-2024 08:03                5799
doc.changelog.php                                  14-Jun-2024 08:03                1367
dom.configuration.php                              14-Jun-2024 08:03                1263
dom.constants.php                                  14-Jun-2024 08:03               19947
dom.examples.php                                   14-Jun-2024 08:03                3050
dom.installation.php                               14-Jun-2024 08:03                1362
dom.requirements.php                               14-Jun-2024 08:03                1560
dom.resources.php                                  14-Jun-2024 08:03                1249
dom.setup.php                                      14-Jun-2024 08:03                1617
domattr.construct.php                              14-Jun-2024 08:03                5752
domattr.isid.php                                   14-Jun-2024 08:03                5162
domcdatasection.construct.php                      14-Jun-2024 08:03                5219
domcharacterdata.after.php                         14-Jun-2024 08:03                7927
domcharacterdata.appenddata.php                    14-Jun-2024 08:03                4487
domcharacterdata.before.php                        14-Jun-2024 08:03                7511
domcharacterdata.deletedata.php                    14-Jun-2024 08:03                5300
domcharacterdata.insertdata.php                    14-Jun-2024 08:03                4928
domcharacterdata.remove.php                        14-Jun-2024 08:03                5442
domcharacterdata.replacedata.php                   14-Jun-2024 08:03                5726
domcharacterdata.replacewith.php                   14-Jun-2024 08:03                7902
domcharacterdata.substringdata.php                 14-Jun-2024 08:03                5114
domchildnode.after.php                             14-Jun-2024 08:03                5881
domchildnode.before.php                            14-Jun-2024 08:03                5269
domchildnode.remove.php                            14-Jun-2024 08:03                3205
domchildnode.replacewith.php                       14-Jun-2024 08:03                5607
domcomment.construct.php                           14-Jun-2024 08:03                5110
domdocument.adoptnode.php                          14-Jun-2024 08:03                6736
domdocument.append.php                             14-Jun-2024 08:03                6947
domdocument.construct.php                          14-Jun-2024 08:03                4447
domdocument.createattribute.php                    14-Jun-2024 08:03                6112
domdocument.createattributens.php                  14-Jun-2024 08:03                8608
domdocument.createcdatasection.php                 14-Jun-2024 08:03                5712
domdocument.createcomment.php                      14-Jun-2024 08:03                6101
domdocument.createdocumentfragment.php             14-Jun-2024 08:03                5945
domdocument.createelement.php                      14-Jun-2024 08:03               11776
domdocument.createelementns.php                    14-Jun-2024 08:03               14400
domdocument.createentityreference.php              14-Jun-2024 08:03                6410
domdocument.createprocessinginstruction.php        14-Jun-2024 08:03                6744
domdocument.createtextnode.php                     14-Jun-2024 08:03                6086
domdocument.getelementbyid.php                     14-Jun-2024 08:03                7859
domdocument.getelementsbytagname.php               14-Jun-2024 08:03                6164
domdocument.getelementsbytagnamens.php             14-Jun-2024 08:03                7851
domdocument.importnode.php                         14-Jun-2024 08:03                9119
domdocument.load.php                               14-Jun-2024 08:03                6857
domdocument.loadhtml.php                           14-Jun-2024 08:03                8235
domdocument.loadhtmlfile.php                       14-Jun-2024 08:03                8363
domdocument.loadxml.php                            14-Jun-2024 08:03                6533
domdocument.normalizedocument.php                  14-Jun-2024 08:03                3043
domdocument.prepend.php                            14-Jun-2024 08:03                7028
domdocument.registernodeclass.php                  14-Jun-2024 08:03               21234
domdocument.relaxngvalidate.php                    14-Jun-2024 08:03                4146
domdocument.relaxngvalidatesource.php              14-Jun-2024 08:03                4212
domdocument.replacechildren.php                    14-Jun-2024 08:03                7257                               14-Jun-2024 08:03                7647
domdocument.savehtml.php                           14-Jun-2024 08:03                7587
domdocument.savehtmlfile.php                       14-Jun-2024 08:03                8193
domdocument.savexml.php                            14-Jun-2024 08:03                9982
domdocument.schemavalidate.php                     14-Jun-2024 08:03                4543
domdocument.schemavalidatesource.php               14-Jun-2024 08:03                4588
domdocument.validate.php                           14-Jun-2024 08:03                6192
domdocument.xinclude.php                           14-Jun-2024 08:03                7310
domdocumentfragment.append.php                     14-Jun-2024 08:03                7637
domdocumentfragment.appendxml.php                  14-Jun-2024 08:03                5604
domdocumentfragment.construct.php                  14-Jun-2024 08:03                2168
domdocumentfragment.prepend.php                    14-Jun-2024 08:03                7684
domdocumentfragment.replacechildren.php            14-Jun-2024 08:03                8001
domelement.after.php                               14-Jun-2024 08:03                7605
domelement.append.php                              14-Jun-2024 08:03                7259
domelement.before.php                              14-Jun-2024 08:03                7146
domelement.construct.php                           14-Jun-2024 08:03                6863
domelement.getattribute.php                        14-Jun-2024 08:03                3620
domelement.getattributenames.php                   14-Jun-2024 08:03                3994
domelement.getattributenode.php                    14-Jun-2024 08:03                4178
domelement.getattributenodens.php                  14-Jun-2024 08:03                4700
domelement.getattributens.php                      14-Jun-2024 08:03                4214
domelement.getelementsbytagname.php                14-Jun-2024 08:03                3901
domelement.getelementsbytagnamens.php              14-Jun-2024 08:03                4821
domelement.hasattribute.php                        14-Jun-2024 08:03                3910
domelement.hasattributens.php                      14-Jun-2024 08:03                4397
domelement.insertadjacentelement.php               14-Jun-2024 08:03                6663
domelement.insertadjacenttext.php                  14-Jun-2024 08:03                6488
domelement.prepend.php                             14-Jun-2024 08:03                7298
domelement.remove.php                              14-Jun-2024 08:03                5079
domelement.removeattribute.php                     14-Jun-2024 08:03                4135
domelement.removeattributenode.php                 14-Jun-2024 08:03                4576
domelement.removeattributens.php                   14-Jun-2024 08:03                4428
domelement.replacechildren.php                     14-Jun-2024 08:03                7821
domelement.replacewith.php                         14-Jun-2024 08:03                7886
domelement.setattribute.php                        14-Jun-2024 08:03                6305
domelement.setattributenode.php                    14-Jun-2024 08:03                4878
domelement.setattributenodens.php                  14-Jun-2024 08:03                4975
domelement.setattributens.php                      14-Jun-2024 08:03                5428
domelement.setidattribute.php                      14-Jun-2024 08:03                5032
domelement.setidattributenode.php                  14-Jun-2024 08:03                5030
domelement.setidattributens.php                    14-Jun-2024 08:03                5512
domelement.toggleattribute.php                     14-Jun-2024 08:03                6443
domentityreference.construct.php                   14-Jun-2024 08:03                4905
domimplementation.construct.php                    14-Jun-2024 08:03                2271
domimplementation.createdocument.php               14-Jun-2024 08:03                7493
domimplementation.createdocumenttype.php           14-Jun-2024 08:03               10097
domimplementation.hasfeature.php                   14-Jun-2024 08:03                9519
domnamednodemap.count.php                          14-Jun-2024 08:03                2548
domnamednodemap.getiterator.php                    14-Jun-2024 08:03                3268
domnamednodemap.getnameditem.php                   14-Jun-2024 08:03                3554
domnamednodemap.getnameditemns.php                 14-Jun-2024 08:03                3876
domnamednodemap.item.php                           14-Jun-2024 08:03                3103
domnode.appendchild.php                            14-Jun-2024 08:03                8874
domnode.c14n.php                                   14-Jun-2024 08:03                8290
domnode.c14nfile.php                               14-Jun-2024 08:03                5915
domnode.clonenode.php                              14-Jun-2024 08:03                2865
domnode.contains.php                               14-Jun-2024 08:03                5378
domnode.getlineno.php                              14-Jun-2024 08:03                4987
domnode.getnodepath.php                            14-Jun-2024 08:03                5269
domnode.getrootnode.php                            14-Jun-2024 08:03                4421
domnode.hasattributes.php                          14-Jun-2024 08:03                3066
domnode.haschildnodes.php                          14-Jun-2024 08:03                2981
domnode.insertbefore.php                           14-Jun-2024 08:03                5613
domnode.isdefaultnamespace.php                     14-Jun-2024 08:03                3007
domnode.isequalnode.php                            14-Jun-2024 08:03                4717
domnode.issamenode.php                             14-Jun-2024 08:03                2842
domnode.issupported.php                            14-Jun-2024 08:03                3998
domnode.lookupnamespaceuri.php                     14-Jun-2024 08:03                3707
domnode.lookupprefix.php                           14-Jun-2024 08:03                3330
domnode.normalize.php                              14-Jun-2024 08:03                2866
domnode.removechild.php                            14-Jun-2024 08:03                7142
domnode.replacechild.php                           14-Jun-2024 08:03                5831
domnodelist.count.php                              14-Jun-2024 08:03                2464
domnodelist.getiterator.php                        14-Jun-2024 08:03                3171
domnodelist.item.php                               14-Jun-2024 08:03                7075
domparentnode.append.php                           14-Jun-2024 08:03                4925
domparentnode.prepend.php                          14-Jun-2024 08:03                4966
domparentnode.replacechildren.php                  14-Jun-2024 08:03                6691
domprocessinginstruction.construct.php             14-Jun-2024 08:03                6675
domtext.construct.php                              14-Jun-2024 08:03                4863
domtext.iselementcontentwhitespace.php             14-Jun-2024 08:03                2699
domtext.iswhitespaceinelementcontent.php           14-Jun-2024 08:03                2840
domtext.splittext.php                              14-Jun-2024 08:03                3339
domxpath.construct.php                             14-Jun-2024 08:03                3604
domxpath.evaluate.php                              14-Jun-2024 08:03                8140
domxpath.query.php                                 14-Jun-2024 08:03               12548
domxpath.registernamespace.php                     14-Jun-2024 08:03                3474
domxpath.registerphpfunctions.php                  14-Jun-2024 08:03               14033
dotnet.construct.php                               14-Jun-2024 08:03                3254
ds-collection.clear.php                            14-Jun-2024 08:03                3974
ds-collection.copy.php                             14-Jun-2024 08:03                4379
ds-collection.isempty.php                          14-Jun-2024 08:03                4280
ds-collection.toarray.php                          14-Jun-2024 08:03                4174
ds-deque.allocate.php                              14-Jun-2024 08:03                4700
ds-deque.apply.php                                 14-Jun-2024 08:03                5000
ds-deque.capacity.php                              14-Jun-2024 08:03                3979
ds-deque.clear.php                                 14-Jun-2024 08:03                3874
ds-deque.construct.php                             14-Jun-2024 08:03                4277
ds-deque.contains.php                              14-Jun-2024 08:03                7108
ds-deque.copy.php                                  14-Jun-2024 08:03                4218
ds-deque.count.php                                 14-Jun-2024 08:03                1625
ds-deque.filter.php                                14-Jun-2024 08:03                7639
ds-deque.find.php                                  14-Jun-2024 08:03                5445
ds-deque.first.php                                 14-Jun-2024 08:03                3791
ds-deque.get.php                                   14-Jun-2024 08:03                6617
ds-deque.insert.php                                14-Jun-2024 08:03                6700
ds-deque.isempty.php                               14-Jun-2024 08:03                4166
ds-deque.join.php                                  14-Jun-2024 08:03                5764
ds-deque.jsonserialize.php                         14-Jun-2024 08:03                1879
ds-deque.last.php                                  14-Jun-2024 08:03                3779                                   14-Jun-2024 08:03                5341
ds-deque.merge.php                                 14-Jun-2024 08:03                4861
ds-deque.pop.php                                   14-Jun-2024 08:03                4276
ds-deque.push.php                                  14-Jun-2024 08:03                4704
ds-deque.reduce.php                                14-Jun-2024 08:03                8018
ds-deque.remove.php                                14-Jun-2024 08:03                4892
ds-deque.reverse.php                               14-Jun-2024 08:03                3710
ds-deque.reversed.php                              14-Jun-2024 08:03                4043
ds-deque.rotate.php                                14-Jun-2024 08:03                5090
ds-deque.set.php                                   14-Jun-2024 08:03                6102
ds-deque.shift.php                                 14-Jun-2024 08:03                4377
ds-deque.slice.php                                 14-Jun-2024 08:03                7169
ds-deque.sort.php                                  14-Jun-2024 08:03                7500
ds-deque.sorted.php                                14-Jun-2024 08:03                7509
ds-deque.sum.php                                   14-Jun-2024 08:03                5294
ds-deque.toarray.php                               14-Jun-2024 08:03                4039
ds-deque.unshift.php                               14-Jun-2024 08:03                4783
ds-hashable.equals.php                             14-Jun-2024 08:03                3717
ds-hashable.hash.php                               14-Jun-2024 08:03                7493
ds-map.allocate.php                                14-Jun-2024 08:03                4566
ds-map.apply.php                                   14-Jun-2024 08:03                5696
ds-map.capacity.php                                14-Jun-2024 08:03                3269
ds-map.clear.php                                   14-Jun-2024 08:03                4350
ds-map.construct.php                               14-Jun-2024 08:03                4779
ds-map.copy.php                                    14-Jun-2024 08:03                4078
ds-map.count.php                                   14-Jun-2024 08:03                1586
ds-map.diff.php                                    14-Jun-2024 08:03                5469
ds-map.filter.php                                  14-Jun-2024 08:03                8423
ds-map.first.php                                   14-Jun-2024 08:03                4090
ds-map.get.php                                     14-Jun-2024 08:03                8440
ds-map.haskey.php                                  14-Jun-2024 08:03                4704
ds-map.hasvalue.php                                14-Jun-2024 08:03                4748
ds-map.intersect.php                               14-Jun-2024 08:03                5990
ds-map.isempty.php                                 14-Jun-2024 08:03                4388
ds-map.jsonserialize.php                           14-Jun-2024 08:03                1857
ds-map.keys.php                                    14-Jun-2024 08:03                3979
ds-map.ksort.php                                   14-Jun-2024 08:03                8187
ds-map.ksorted.php                                 14-Jun-2024 08:03                8258
ds-map.last.php                                    14-Jun-2024 08:03                4075                                     14-Jun-2024 08:03                6322
ds-map.merge.php                                   14-Jun-2024 08:03                5781
ds-map.pairs.php                                   14-Jun-2024 08:03                4394
ds-map.put.php                                     14-Jun-2024 08:03               13975
ds-map.putall.php                                  14-Jun-2024 08:03                5509
ds-map.reduce.php                                  14-Jun-2024 08:03                8953
ds-map.remove.php                                  14-Jun-2024 08:03                6990
ds-map.reverse.php                                 14-Jun-2024 08:03                4162
ds-map.reversed.php                                14-Jun-2024 08:03                4253
ds-map.skip.php                                    14-Jun-2024 08:03                4642
ds-map.slice.php                                   14-Jun-2024 08:03                8021
ds-map.sort.php                                    14-Jun-2024 08:03                8110
ds-map.sorted.php                                  14-Jun-2024 08:03                8237
ds-map.sum.php                                     14-Jun-2024 08:03                5761
ds-map.toarray.php                                 14-Jun-2024 08:03                4980
ds-map.union.php                                   14-Jun-2024 08:03                5974
ds-map.values.php                                  14-Jun-2024 08:03                3978
ds-map.xor.php                                     14-Jun-2024 08:03                5535
ds-pair.clear.php                                  14-Jun-2024 08:03                3779
ds-pair.construct.php                              14-Jun-2024 08:03                2613
ds-pair.copy.php                                   14-Jun-2024 08:03                4132
ds-pair.isempty.php                                14-Jun-2024 08:03                4116
ds-pair.jsonserialize.php                          14-Jun-2024 08:03                1877
ds-pair.toarray.php                                14-Jun-2024 08:03                3973
ds-priorityqueue.allocate.php                      14-Jun-2024 08:03                4866
ds-priorityqueue.capacity.php                      14-Jun-2024 08:03                3478
ds-priorityqueue.clear.php                         14-Jun-2024 08:03                4531
ds-priorityqueue.construct.php                     14-Jun-2024 08:03                2935
ds-priorityqueue.copy.php                          14-Jun-2024 08:03                4521
ds-priorityqueue.count.php                         14-Jun-2024 08:03                1734
ds-priorityqueue.isempty.php                       14-Jun-2024 08:03                5076
ds-priorityqueue.jsonserialize.php                 14-Jun-2024 08:03                1997
ds-priorityqueue.peek.php                          14-Jun-2024 08:03                4769
ds-priorityqueue.pop.php                           14-Jun-2024 08:03                5539
ds-priorityqueue.push.php                          14-Jun-2024 08:03                5630
ds-priorityqueue.toarray.php                       14-Jun-2024 08:03                5138
ds-queue.allocate.php                              14-Jun-2024 08:03                4893
ds-queue.capacity.php                              14-Jun-2024 08:03                3985
ds-queue.clear.php                                 14-Jun-2024 08:03                3859
ds-queue.construct.php                             14-Jun-2024 08:03                4275
ds-queue.copy.php                                  14-Jun-2024 08:03                4320
ds-queue.count.php                                 14-Jun-2024 08:03                1622
ds-queue.isempty.php                               14-Jun-2024 08:03                4182
ds-queue.jsonserialize.php                         14-Jun-2024 08:03                1885
ds-queue.peek.php                                  14-Jun-2024 08:03                4373
ds-queue.pop.php                                   14-Jun-2024 08:03                4907
ds-queue.push.php                                  14-Jun-2024 08:03                4739
ds-queue.toarray.php                               14-Jun-2024 08:03                4203
ds-sequence.allocate.php                           14-Jun-2024 08:03                4604
ds-sequence.apply.php                              14-Jun-2024 08:03                5115
ds-sequence.capacity.php                           14-Jun-2024 08:03                4534
ds-sequence.contains.php                           14-Jun-2024 08:03                7235
ds-sequence.filter.php                             14-Jun-2024 08:03                7778
ds-sequence.find.php                               14-Jun-2024 08:03                5557
ds-sequence.first.php                              14-Jun-2024 08:03                3906
ds-sequence.get.php                                14-Jun-2024 08:03                6745
ds-sequence.insert.php                             14-Jun-2024 08:03                6819
ds-sequence.join.php                               14-Jun-2024 08:03                5860
ds-sequence.last.php                               14-Jun-2024 08:03                3873                                14-Jun-2024 08:03                5470
ds-sequence.merge.php                              14-Jun-2024 08:03                4987
ds-sequence.pop.php                                14-Jun-2024 08:03                4388
ds-sequence.push.php                               14-Jun-2024 08:03                4826
ds-sequence.reduce.php                             14-Jun-2024 08:03                8137
ds-sequence.remove.php                             14-Jun-2024 08:03                5004
ds-sequence.reverse.php                            14-Jun-2024 08:03                3823
ds-sequence.reversed.php                           14-Jun-2024 08:03                4166
ds-sequence.rotate.php                             14-Jun-2024 08:03                5227
ds-sequence.set.php                                14-Jun-2024 08:03                6226
ds-sequence.shift.php                              14-Jun-2024 08:03                4489
ds-sequence.slice.php                              14-Jun-2024 08:03                7334
ds-sequence.sort.php                               14-Jun-2024 08:03                7627
ds-sequence.sorted.php                             14-Jun-2024 08:03                7636
ds-sequence.sum.php                                14-Jun-2024 08:03                5419
ds-sequence.unshift.php                            14-Jun-2024 08:03                4894
ds-set.add.php                                     14-Jun-2024 08:03               12208
ds-set.allocate.php                                14-Jun-2024 08:03                4575
ds-set.capacity.php                                14-Jun-2024 08:03                3937
ds-set.clear.php                                   14-Jun-2024 08:03                3805
ds-set.construct.php                               14-Jun-2024 08:03                4229
ds-set.contains.php                                14-Jun-2024 08:03                7303
ds-set.copy.php                                    14-Jun-2024 08:03                4259
ds-set.count.php                                   14-Jun-2024 08:03                1586
ds-set.diff.php                                    14-Jun-2024 08:03                4759
ds-set.filter.php                                  14-Jun-2024 08:03                7587
ds-set.first.php                                   14-Jun-2024 08:03                3744
ds-set.get.php                                     14-Jun-2024 08:03                6561
ds-set.intersect.php                               14-Jun-2024 08:03                4990
ds-set.isempty.php                                 14-Jun-2024 08:03                4124
ds-set.join.php                                    14-Jun-2024 08:03                5710
ds-set.jsonserialize.php                           14-Jun-2024 08:03                1851
ds-set.last.php                                    14-Jun-2024 08:03                3745
ds-set.merge.php                                   14-Jun-2024 08:03                4787
ds-set.reduce.php                                  14-Jun-2024 08:03                7964
ds-set.remove.php                                  14-Jun-2024 08:03                5010
ds-set.reverse.php                                 14-Jun-2024 08:03                3658
ds-set.reversed.php                                14-Jun-2024 08:03                3981
ds-set.slice.php                                   14-Jun-2024 08:03                7083
ds-set.sort.php                                    14-Jun-2024 08:03                7436
ds-set.sorted.php                                  14-Jun-2024 08:03                7445
ds-set.sum.php                                     14-Jun-2024 08:03                5234
ds-set.toarray.php                                 14-Jun-2024 08:03                3985
ds-set.union.php                                   14-Jun-2024 08:03                4953
ds-set.xor.php                                     14-Jun-2024 08:03                4929
ds-stack.allocate.php                              14-Jun-2024 08:03                2883
ds-stack.capacity.php                              14-Jun-2024 08:03                2215
ds-stack.clear.php                                 14-Jun-2024 08:03                3855
ds-stack.construct.php                             14-Jun-2024 08:03                4241
ds-stack.copy.php                                  14-Jun-2024 08:03                4320
ds-stack.count.php                                 14-Jun-2024 08:03                1622
ds-stack.isempty.php                               14-Jun-2024 08:03                4182
ds-stack.jsonserialize.php                         14-Jun-2024 08:03                1885
ds-stack.peek.php                                  14-Jun-2024 08:03                4367
ds-stack.pop.php                                   14-Jun-2024 08:03                4901
ds-stack.push.php                                  14-Jun-2024 08:03                4739
ds-stack.toarray.php                               14-Jun-2024 08:03                4030
ds-vector.allocate.php                             14-Jun-2024 08:03                4521
ds-vector.apply.php                                14-Jun-2024 08:03                5026
ds-vector.capacity.php                             14-Jun-2024 08:03                4439
ds-vector.clear.php                                14-Jun-2024 08:03                3886
ds-vector.construct.php                            14-Jun-2024 08:03                4309
ds-vector.contains.php                             14-Jun-2024 08:03                7138
ds-vector.copy.php                                 14-Jun-2024 08:03                4344
ds-vector.count.php                                14-Jun-2024 08:03                1639
ds-vector.filter.php                               14-Jun-2024 08:03                7673
ds-vector.find.php                                 14-Jun-2024 08:03                5470
ds-vector.first.php                                14-Jun-2024 08:03                3817
ds-vector.get.php                                  14-Jun-2024 08:03                6648
ds-vector.insert.php                               14-Jun-2024 08:03                6730
ds-vector.isempty.php                              14-Jun-2024 08:03                4190
ds-vector.join.php                                 14-Jun-2024 08:03                5791
ds-vector.jsonserialize.php                        14-Jun-2024 08:03                1893
ds-vector.last.php                                 14-Jun-2024 08:03                3804                                  14-Jun-2024 08:03                5373
ds-vector.merge.php                                14-Jun-2024 08:03                4892
ds-vector.pop.php                                  14-Jun-2024 08:03                4301
ds-vector.push.php                                 14-Jun-2024 08:03                4733
ds-vector.reduce.php                               14-Jun-2024 08:03                8046
ds-vector.remove.php                               14-Jun-2024 08:03                4917
ds-vector.reverse.php                              14-Jun-2024 08:03                3736
ds-vector.reversed.php                             14-Jun-2024 08:03                4073
ds-vector.rotate.php                               14-Jun-2024 08:03                5124
ds-vector.set.php                                  14-Jun-2024 08:03                6133
ds-vector.shift.php                                14-Jun-2024 08:03                4402
ds-vector.slice.php                                14-Jun-2024 08:03                7215
ds-vector.sort.php                                 14-Jun-2024 08:03                7532
ds-vector.sorted.php                               14-Jun-2024 08:03                7541
ds-vector.sum.php                                  14-Jun-2024 08:03                5324
ds-vector.toarray.php                              14-Jun-2024 08:03                4064
ds-vector.unshift.php                              14-Jun-2024 08:03                4813
ds.constants.php                                   14-Jun-2024 08:03                1196
ds.examples.php                                    14-Jun-2024 08:03                4753
ds.installation.php                                14-Jun-2024 08:03                2547
ds.requirements.php                                14-Jun-2024 08:03                1226
ds.setup.php                                       14-Jun-2024 08:03                1452
eio.configuration.php                              14-Jun-2024 08:03                1261
eio.constants.php                                  14-Jun-2024 08:03               22555
eio.examples.php                                   14-Jun-2024 08:03               27636
eio.installation.php                               14-Jun-2024 08:03                1941
eio.requirements.php                               14-Jun-2024 08:03                1370
eio.resources.php                                  14-Jun-2024 08:03                1310
eio.setup.php                                      14-Jun-2024 08:03                1626
emptyiterator.current.php                          14-Jun-2024 08:03                2887
emptyiterator.key.php                              14-Jun-2024 08:03                2812                             14-Jun-2024 08:03                2528
emptyiterator.rewind.php                           14-Jun-2024 08:03                2589
emptyiterator.valid.php                            14-Jun-2024 08:03                2792
enchant.configuration.php                          14-Jun-2024 08:03                1291
enchant.constants.php                              14-Jun-2024 08:03                3012
enchant.examples.php                               14-Jun-2024 08:03                5475
enchant.installation.php                           14-Jun-2024 08:03                3292
enchant.requirements.php                           14-Jun-2024 08:03                1900
enchant.resources.php                              14-Jun-2024 08:03                1417
enchant.setup.php                                  14-Jun-2024 08:03                1677
error.clone.php                                    14-Jun-2024 08:03                2890
error.construct.php                                14-Jun-2024 08:03                3506
error.getcode.php                                  14-Jun-2024 08:03                4145
error.getfile.php                                  14-Jun-2024 08:03                3898
error.getline.php                                  14-Jun-2024 08:03                4166
error.getmessage.php                               14-Jun-2024 08:03                4008
error.getprevious.php                              14-Jun-2024 08:03                6674
error.gettrace.php                                 14-Jun-2024 08:03                4374
error.gettraceasstring.php                         14-Jun-2024 08:03                4390
error.tostring.php                                 14-Jun-2024 08:03                4149
errorexception.construct.php                       14-Jun-2024 08:03                6300
errorexception.getseverity.php                     14-Jun-2024 08:03                4467
errorfunc.configuration.php                        14-Jun-2024 08:03               27135
errorfunc.constants.php                            14-Jun-2024 08:03               13111
errorfunc.examples.php                             14-Jun-2024 08:03               19118
errorfunc.installation.php                         14-Jun-2024 08:03                1333
errorfunc.requirements.php                         14-Jun-2024 08:03                1278
errorfunc.resources.php                            14-Jun-2024 08:03                1291
errorfunc.setup.php                                14-Jun-2024 08:03                1697
ev.backend.php                                     14-Jun-2024 08:03                3534
ev.configuration.php                               14-Jun-2024 08:03                1256
ev.depth.php                                       14-Jun-2024 08:03                3489
ev.embeddablebackends.php                          14-Jun-2024 08:03                6683
ev.examples.php                                    14-Jun-2024 08:03               42942
ev.feedsignal.php                                  14-Jun-2024 08:03                3657
ev.feedsignalevent.php                             14-Jun-2024 08:03                3298                            14-Jun-2024 08:03                1380
ev.installation.php                                14-Jun-2024 08:03                1907
ev.iteration.php                                   14-Jun-2024 08:03                2825                                         14-Jun-2024 08:03                3254
ev.nowupdate.php                                   14-Jun-2024 08:03                3401
ev.periodic-modes.php                              14-Jun-2024 08:03                8001
ev.recommendedbackends.php                         14-Jun-2024 08:03                7534
ev.requirements.php                                14-Jun-2024 08:03                1297
ev.resources.php                                   14-Jun-2024 08:03                1249
ev.resume.php                                      14-Jun-2024 08:03                3964                                         14-Jun-2024 08:03                5546
ev.setup.php                                       14-Jun-2024 08:03                1584
ev.sleep.php                                       14-Jun-2024 08:03                2483
ev.stop.php                                        14-Jun-2024 08:03                3028
ev.supportedbackends.php                           14-Jun-2024 08:03                6714
ev.suspend.php                                     14-Jun-2024 08:03                3697
ev.time.php                                        14-Jun-2024 08:03                2788
ev.verify.php                                      14-Jun-2024 08:03                2363
ev.watcher-callbacks.php                           14-Jun-2024 08:03                4817
ev.watchers.php                                    14-Jun-2024 08:03                3664
evcheck.construct.php                              14-Jun-2024 08:03                3794
evcheck.createstopped.php                          14-Jun-2024 08:03                3890
evchild.construct.php                              14-Jun-2024 08:03                7075
evchild.createstopped.php                          14-Jun-2024 08:03                5311
evchild.set.php                                    14-Jun-2024 08:03                3296
evembed.construct.php                              14-Jun-2024 08:03                8201
evembed.createstopped.php                          14-Jun-2024 08:03                4911
evembed.set.php                                    14-Jun-2024 08:03                2653
evembed.sweep.php                                  14-Jun-2024 08:03                3177
event.add.php                                      14-Jun-2024 08:03               10662
event.addsignal.php                                14-Jun-2024 08:03                1693
event.addtimer.php                                 14-Jun-2024 08:03                1702
event.callbacks.php                                14-Jun-2024 08:03                6078
event.configuration.php                            14-Jun-2024 08:03                1277
event.construct.php                                14-Jun-2024 08:03                4906               14-Jun-2024 08:03                6405
event.del.php                                      14-Jun-2024 08:03                2745
event.delsignal.php                                14-Jun-2024 08:03                1693
event.deltimer.php                                 14-Jun-2024 08:03                1690
event.examples.php                                 14-Jun-2024 08:03              166876
event.flags.php                                    14-Jun-2024 08:03                2981                                     14-Jun-2024 08:03                3189
event.getsupportedmethods.php                      14-Jun-2024 08:03                2729
event.installation.php                             14-Jun-2024 08:03                1930
event.pending.php                                  14-Jun-2024 08:03                3164
event.persistence.php                              14-Jun-2024 08:03                3377
event.requirements.php                             14-Jun-2024 08:03                1554
event.resources.php                                14-Jun-2024 08:03                1233
event.set.php                                      14-Jun-2024 08:03                4970
event.setpriority.php                              14-Jun-2024 08:03                2732
event.settimer.php                                 14-Jun-2024 08:03                4347
event.setup.php                                    14-Jun-2024 08:03                1623
event.signal.php                                   14-Jun-2024 08:03                4570
event.timer.php                                    14-Jun-2024 08:03                3846
eventbase.construct.php                            14-Jun-2024 08:03                3108
eventbase.dispatch.php                             14-Jun-2024 08:03                3472
eventbase.exit.php                                 14-Jun-2024 08:03                3327                                 14-Jun-2024 08:03                3519
eventbase.getfeatures.php                          14-Jun-2024 08:03                5944
eventbase.getmethod.php                            14-Jun-2024 08:03                4795
eventbase.gettimeofdaycached.php                   14-Jun-2024 08:03                2872
eventbase.gotexit.php                              14-Jun-2024 08:03                3678
eventbase.gotstop.php                              14-Jun-2024 08:03                3641
eventbase.loop.php                                 14-Jun-2024 08:03                3773
eventbase.priorityinit.php                         14-Jun-2024 08:03                3229
eventbase.reinit.php                               14-Jun-2024 08:03                2524
eventbase.stop.php                                 14-Jun-2024 08:03                3105
eventbuffer.add.php                                14-Jun-2024 08:03                3203
eventbuffer.addbuffer.php                          14-Jun-2024 08:03                3576
eventbuffer.appendfrom.php                         14-Jun-2024 08:03                5107
eventbuffer.construct.php                          14-Jun-2024 08:03                2021
eventbuffer.copyout.php                            14-Jun-2024 08:03                4098
eventbuffer.drain.php                              14-Jun-2024 08:03                3712
eventbuffer.enablelocking.php                      14-Jun-2024 08:03                3051
eventbuffer.expand.php                             14-Jun-2024 08:03                3010
eventbuffer.freeze.php                             14-Jun-2024 08:03                3349
eventbuffer.lock.php                               14-Jun-2024 08:03                3214
eventbuffer.prepend.php                            14-Jun-2024 08:03                3719
eventbuffer.prependbuffer.php                      14-Jun-2024 08:03                3918
eventbuffer.pullup.php                             14-Jun-2024 08:03                4914                               14-Jun-2024 08:03                5205
eventbuffer.readfrom.php                           14-Jun-2024 08:03                4571
eventbuffer.readline.php                           14-Jun-2024 08:03                4488                             14-Jun-2024 08:03                8645
eventbuffer.searcheol.php                          14-Jun-2024 08:03                5117
eventbuffer.substr.php                             14-Jun-2024 08:03                3637
eventbuffer.unfreeze.php                           14-Jun-2024 08:03                3345
eventbuffer.unlock.php                             14-Jun-2024 08:03                2953
eventbuffer.write.php                              14-Jun-2024 08:03                3596
eventbufferevent.about.callbacks.php               14-Jun-2024 08:03                6452
eventbufferevent.close.php                         14-Jun-2024 08:03                2714
eventbufferevent.connect.php                       14-Jun-2024 08:03               24362
eventbufferevent.connecthost.php                   14-Jun-2024 08:03               18268
eventbufferevent.construct.php                     14-Jun-2024 08:03                7312
eventbufferevent.createpair.php                    14-Jun-2024 08:03                4470
eventbufferevent.disable.php                       14-Jun-2024 08:03                3763
eventbufferevent.enable.php                        14-Jun-2024 08:03                4215                          14-Jun-2024 08:03                3142
eventbufferevent.getdnserrorstring.php             14-Jun-2024 08:03                3216
eventbufferevent.getenabled.php                    14-Jun-2024 08:03                3362
eventbufferevent.getinput.php                      14-Jun-2024 08:03                5221
eventbufferevent.getoutput.php                     14-Jun-2024 08:03                8124                          14-Jun-2024 08:03                3188
eventbufferevent.readbuffer.php                    14-Jun-2024 08:03                3351
eventbufferevent.setcallbacks.php                  14-Jun-2024 08:03                4968
eventbufferevent.setpriority.php                   14-Jun-2024 08:03                3139
eventbufferevent.settimeouts.php                   14-Jun-2024 08:03                3465
eventbufferevent.setwatermark.php                  14-Jun-2024 08:03                4334
eventbufferevent.sslerror.php                      14-Jun-2024 08:03                6102
eventbufferevent.sslfilter.php                     14-Jun-2024 08:03               34870
eventbufferevent.sslgetcipherinfo.php              14-Jun-2024 08:03                3056
eventbufferevent.sslgetciphername.php              14-Jun-2024 08:03                2935
eventbufferevent.sslgetcipherversion.php           14-Jun-2024 08:03                2997
eventbufferevent.sslgetprotocol.php                14-Jun-2024 08:03                2831
eventbufferevent.sslrenegotiate.php                14-Jun-2024 08:03                3056
eventbufferevent.sslsocket.php                     14-Jun-2024 08:03                6082
eventbufferevent.write.php                         14-Jun-2024 08:03                3332
eventbufferevent.writebuffer.php                   14-Jun-2024 08:03                3535
eventconfig.avoidmethod.php                        14-Jun-2024 08:03                4566
eventconfig.construct.php                          14-Jun-2024 08:03                4141
eventconfig.requirefeatures.php                    14-Jun-2024 08:03                6245
eventconfig.setflags.php                           14-Jun-2024 08:03                3471
eventconfig.setmaxdispatchinterval.php             14-Jun-2024 08:03                4915
eventdnsbase.addnameserverip.php                   14-Jun-2024 08:03                3108
eventdnsbase.addsearch.php                         14-Jun-2024 08:03                2714
eventdnsbase.clearsearch.php                       14-Jun-2024 08:03                2958
eventdnsbase.construct.php                         14-Jun-2024 08:03                7796
eventdnsbase.countnameservers.php                  14-Jun-2024 08:03                2669
eventdnsbase.loadhosts.php                         14-Jun-2024 08:03                2888
eventdnsbase.parseresolvconf.php                   14-Jun-2024 08:03                4412
eventdnsbase.setoption.php                         14-Jun-2024 08:03                3527
eventdnsbase.setsearchndots.php                    14-Jun-2024 08:03                3062
eventhttp.accept.php                               14-Jun-2024 08:03               12623
eventhttp.addserveralias.php                       14-Jun-2024 08:03                6598
eventhttp.bind.php                                 14-Jun-2024 08:03                8021
eventhttp.construct.php                            14-Jun-2024 08:03               17620
eventhttp.removeserveralias.php                    14-Jun-2024 08:03                3405
eventhttp.setallowedmethods.php                    14-Jun-2024 08:03                3506
eventhttp.setcallback.php                          14-Jun-2024 08:03               18420
eventhttp.setdefaultcallback.php                   14-Jun-2024 08:03                8173
eventhttp.setmaxbodysize.php                       14-Jun-2024 08:03                3060
eventhttp.setmaxheaderssize.php                    14-Jun-2024 08:03                2950
eventhttp.settimeout.php                           14-Jun-2024 08:03                2665
eventhttpconnection.construct.php                  14-Jun-2024 08:03                5190
eventhttpconnection.getbase.php                    14-Jun-2024 08:03                2715
eventhttpconnection.getpeer.php                    14-Jun-2024 08:03                3113
eventhttpconnection.makerequest.php                14-Jun-2024 08:03               11818
eventhttpconnection.setclosecallback.php           14-Jun-2024 08:03                9616
eventhttpconnection.setlocaladdress.php            14-Jun-2024 08:03                3379
eventhttpconnection.setlocalport.php               14-Jun-2024 08:03                3227
eventhttpconnection.setmaxbodysize.php             14-Jun-2024 08:03                3270
eventhttpconnection.setmaxheaderssize.php          14-Jun-2024 08:03                3293
eventhttpconnection.setretries.php                 14-Jun-2024 08:03                2857
eventhttpconnection.settimeout.php                 14-Jun-2024 08:03                2789
eventhttprequest.addheader.php                     14-Jun-2024 08:03                4107
eventhttprequest.cancel.php                        14-Jun-2024 08:03                2957
eventhttprequest.clearheaders.php                  14-Jun-2024 08:03                2911
eventhttprequest.closeconnection.php               14-Jun-2024 08:03                2490
eventhttprequest.construct.php                     14-Jun-2024 08:03               11596
eventhttprequest.findheader.php                    14-Jun-2024 08:03                3656                          14-Jun-2024 08:03                2412
eventhttprequest.getbufferevent.php                14-Jun-2024 08:03                3832
eventhttprequest.getcommand.php                    14-Jun-2024 08:03                2775
eventhttprequest.getconnection.php                 14-Jun-2024 08:03                4694
eventhttprequest.gethost.php                       14-Jun-2024 08:03                2974
eventhttprequest.getinputbuffer.php                14-Jun-2024 08:03                2860
eventhttprequest.getinputheaders.php               14-Jun-2024 08:03                3007
eventhttprequest.getoutputbuffer.php               14-Jun-2024 08:03                2903
eventhttprequest.getoutputheaders.php              14-Jun-2024 08:03                2930
eventhttprequest.getresponsecode.php               14-Jun-2024 08:03                3251
eventhttprequest.geturi.php                        14-Jun-2024 08:03                3197
eventhttprequest.removeheader.php                  14-Jun-2024 08:03                3551
eventhttprequest.senderror.php                     14-Jun-2024 08:03                5946
eventhttprequest.sendreply.php                     14-Jun-2024 08:03                4155
eventhttprequest.sendreplychunk.php                14-Jun-2024 08:03                3597
eventhttprequest.sendreplyend.php                  14-Jun-2024 08:03                3135
eventhttprequest.sendreplystart.php                14-Jun-2024 08:03                4531
eventlistener.construct.php                        14-Jun-2024 08:03               22743
eventlistener.disable.php                          14-Jun-2024 08:03                2980
eventlistener.enable.php                           14-Jun-2024 08:03                2969
eventlistener.getbase.php                          14-Jun-2024 08:03                2489
eventlistener.getsocketname.php                    14-Jun-2024 08:03                3483
eventlistener.setcallback.php                      14-Jun-2024 08:03                6257
eventlistener.seterrorcallback.php                 14-Jun-2024 08:03                4563
eventsslcontext.construct.php                      14-Jun-2024 08:03                5358
eventutil.construct.php                            14-Jun-2024 08:03                2221
eventutil.getlastsocketerrno.php                   14-Jun-2024 08:03                3472
eventutil.getlastsocketerror.php                   14-Jun-2024 08:03                3295
eventutil.getsocketfd.php                          14-Jun-2024 08:03                3419
eventutil.getsocketname.php                        14-Jun-2024 08:03                3855
eventutil.setsocketoption.php                      14-Jun-2024 08:03                5870
eventutil.sslrandpoll.php                          14-Jun-2024 08:03                2434
evfork.construct.php                               14-Jun-2024 08:03                3834
evfork.createstopped.php                           14-Jun-2024 08:03                4091
evidle.construct.php                               14-Jun-2024 08:03                3836
evidle.createstopped.php                           14-Jun-2024 08:03                4305
evio.construct.php                                 14-Jun-2024 08:03                5004
evio.createstopped.php                             14-Jun-2024 08:03                5348
evio.set.php                                       14-Jun-2024 08:03                2929
evloop.backend.php                                 14-Jun-2024 08:03                2824
evloop.check.php                                   14-Jun-2024 08:03                3438
evloop.child.php                                   14-Jun-2024 08:03                3895
evloop.construct.php                               14-Jun-2024 08:03                4216
evloop.defaultloop.php                             14-Jun-2024 08:03                4840
evloop.embed.php                                   14-Jun-2024 08:03                3926
evloop.fork.php                                    14-Jun-2024 08:03                3523
evloop.idle.php                                    14-Jun-2024 08:03                3534
evloop.invokepending.php                           14-Jun-2024 08:03                2395                                      14-Jun-2024 08:03                3980
evloop.loopfork.php                                14-Jun-2024 08:03                2694                                     14-Jun-2024 08:03                3052
evloop.nowupdate.php                               14-Jun-2024 08:03                3325
evloop.periodic.php                                14-Jun-2024 08:03                4109
evloop.prepare.php                                 14-Jun-2024 08:03                3537
evloop.resume.php                                  14-Jun-2024 08:03                2937                                     14-Jun-2024 08:03                5516
evloop.signal.php                                  14-Jun-2024 08:03                3839
evloop.stat.php                                    14-Jun-2024 08:03                4020
evloop.stop.php                                    14-Jun-2024 08:03                3142
evloop.suspend.php                                 14-Jun-2024 08:03                2929
evloop.timer.php                                   14-Jun-2024 08:03                4038
evloop.verify.php                                  14-Jun-2024 08:03                2714
evperiodic.again.php                               14-Jun-2024 08:03                2631                                  14-Jun-2024 08:03                2714
evperiodic.construct.php                           14-Jun-2024 08:03               10246
evperiodic.createstopped.php                       14-Jun-2024 08:03                6041
evperiodic.set.php                                 14-Jun-2024 08:03                3332
evprepare.construct.php                            14-Jun-2024 08:03                3689
evprepare.createstopped.php                        14-Jun-2024 08:03                4430
evsignal.construct.php                             14-Jun-2024 08:03                5638
evsignal.createstopped.php                         14-Jun-2024 08:03                4979
evsignal.set.php                                   14-Jun-2024 08:03                2575
evstat.attr.php                                    14-Jun-2024 08:03                8391
evstat.construct.php                               14-Jun-2024 08:03                7271
evstat.createstopped.php                           14-Jun-2024 08:03                5307
evstat.prev.php                                    14-Jun-2024 08:03                3057
evstat.set.php                                     14-Jun-2024 08:03                2896
evstat.stat.php                                    14-Jun-2024 08:03                3131
evtimer.again.php                                  14-Jun-2024 08:03                3226
evtimer.construct.php                              14-Jun-2024 08:03               13146
evtimer.createstopped.php                          14-Jun-2024 08:03                8586
evtimer.set.php                                    14-Jun-2024 08:03                3125
evwatcher.clear.php                                14-Jun-2024 08:03                3033
evwatcher.construct.php                            14-Jun-2024 08:03                2159
evwatcher.feed.php                                 14-Jun-2024 08:03                2751
evwatcher.getloop.php                              14-Jun-2024 08:03                2373
evwatcher.invoke.php                               14-Jun-2024 08:03                2778
evwatcher.keepalive.php                            14-Jun-2024 08:03                5287
evwatcher.setcallback.php                          14-Jun-2024 08:03                2695
evwatcher.start.php                                14-Jun-2024 08:03                2588
evwatcher.stop.php                                 14-Jun-2024 08:03                2565
example.xml-external-entity.php                    14-Jun-2024 08:03               21582
example.xml-map-tags.php                           14-Jun-2024 08:03                8200
example.xml-structure.php                          14-Jun-2024 08:03                6359
example.xmlwriter-namespace.php                    14-Jun-2024 08:03                5471
example.xmlwriter-oop.php                          14-Jun-2024 08:03                3449
example.xmlwriter-simple.php                       14-Jun-2024 08:03                8721
exception.clone.php                                14-Jun-2024 08:03                3143
exception.construct.php                            14-Jun-2024 08:03                3914
exception.getcode.php                              14-Jun-2024 08:03                4787
exception.getfile.php                              14-Jun-2024 08:03                4021
exception.getline.php                              14-Jun-2024 08:03                4285
exception.getmessage.php                           14-Jun-2024 08:03                4134
exception.getprevious.php                          14-Jun-2024 08:03                6940
exception.gettrace.php                             14-Jun-2024 08:03                4514
exception.gettraceasstring.php                     14-Jun-2024 08:03                4528
exception.tostring.php                             14-Jun-2024 08:03                4314
exec.configuration.php                             14-Jun-2024 08:03                1270
exec.constants.php                                 14-Jun-2024 08:03                1271
exec.installation.php                              14-Jun-2024 08:03                1298
exec.requirements.php                              14-Jun-2024 08:03                1243
exec.resources.php                                 14-Jun-2024 08:03                1421
exec.setup.php                                     14-Jun-2024 08:03                1655
exif.configuration.php                             14-Jun-2024 08:03                8000
exif.constants.php                                 14-Jun-2024 08:03                2091
exif.installation.php                              14-Jun-2024 08:03                1831
exif.requirements.php                              14-Jun-2024 08:03                1907
exif.resources.php                                 14-Jun-2024 08:03                1256
exif.setup.php                                     14-Jun-2024 08:03                1647
expect.configuration.php                           14-Jun-2024 08:03                5730
expect.constants.php                               14-Jun-2024 08:03                3990
expect.examples-usage.php                          14-Jun-2024 08:03               12447
expect.examples.php                                14-Jun-2024 08:03                1462
expect.installation.php                            14-Jun-2024 08:03                2649
expect.requirements.php                            14-Jun-2024 08:03                1373
expect.resources.php                               14-Jun-2024 08:03                1496
expect.setup.php                                   14-Jun-2024 08:03                1673
extensions.alphabetical.php                        14-Jun-2024 08:03               21073
extensions.membership.php                          14-Jun-2024 08:03               20860
extensions.php                                     14-Jun-2024 08:03                1758
extensions.state.php                               14-Jun-2024 08:03                2822
fann.configuration.php                             14-Jun-2024 08:03                1270
fann.constants.php                                 14-Jun-2024 08:03               23653
fann.examples-1.php                                14-Jun-2024 08:03                8527
fann.examples.php                                  14-Jun-2024 08:03                1389
fann.installation.php                              14-Jun-2024 08:03                4946
fann.requirements.php                              14-Jun-2024 08:03                1207
fann.resources.php                                 14-Jun-2024 08:03                1215
fann.setup.php                                     14-Jun-2024 08:03                1614
fannconnection.construct.php                       14-Jun-2024 08:03                3086
fannconnection.getfromneuron.php                   14-Jun-2024 08:03                2422
fannconnection.gettoneuron.php                     14-Jun-2024 08:03                2388
fannconnection.getweight.php                       14-Jun-2024 08:03                2348
fannconnection.setweight.php                       14-Jun-2024 08:03                3050                                      14-Jun-2024 08:03               24327                                        14-Jun-2024 08:03               12750
faq.databases.php                                  14-Jun-2024 08:03                8550
faq.general.php                                    14-Jun-2024 08:03                5126
faq.html.php                                       14-Jun-2024 08:03               21408
faq.installation.php                               14-Jun-2024 08:03               27835
faq.mailinglist.php                                14-Jun-2024 08:03               11808
faq.misc.php                                       14-Jun-2024 08:03                4732
faq.obtaining.php                                  14-Jun-2024 08:03               11128
faq.passwords.php                                  14-Jun-2024 08:03               10226
faq.php                                            14-Jun-2024 08:03                2171
faq.using.php                                      14-Jun-2024 08:03               23376
fdf.configuration.php                              14-Jun-2024 08:03                1263
fdf.constants.php                                  14-Jun-2024 08:03                9236
fdf.examples.php                                   14-Jun-2024 08:03                6605
fdf.installation.php                               14-Jun-2024 08:03                3657
fdf.requirements.php                               14-Jun-2024 08:03                1617
fdf.resources.php                                  14-Jun-2024 08:03                1846
fdf.setup.php                                      14-Jun-2024 08:03                1625
features.commandline.differences.php               14-Jun-2024 08:03               13087
features.commandline.ini.php                       14-Jun-2024 08:03                2366
features.commandline.interactive.php               14-Jun-2024 08:03                9555                14-Jun-2024 08:03                6205
features.commandline.options.php                   14-Jun-2024 08:03               27287
features.commandline.php                           14-Jun-2024 08:03                7824
features.commandline.usage.php                     14-Jun-2024 08:03               14655
features.commandline.webserver.php                 14-Jun-2024 08:03               14994
features.connection-handling.php                   14-Jun-2024 08:03                6018
features.cookies.php                               14-Jun-2024 08:03                3149
features.dtrace.dtrace.php                         14-Jun-2024 08:03               14938
features.dtrace.introduction.php                   14-Jun-2024 08:03                3693
features.dtrace.php                                14-Jun-2024 08:03                1728
features.dtrace.systemtap.php                      14-Jun-2024 08:03                8233
features.file-upload.common-pitfalls.php           14-Jun-2024 08:03                5421
features.file-upload.errors.php                    14-Jun-2024 08:03                3918
features.file-upload.errors.seealso.php            14-Jun-2024 08:03                1405
features.file-upload.multiple.php                  14-Jun-2024 08:03                7016
features.file-upload.php                           14-Jun-2024 08:03                2077               14-Jun-2024 08:03               16619
features.file-upload.put-method.php                14-Jun-2024 08:03                6229
features.gc.collecting-cycles.php                  14-Jun-2024 08:03                8565
features.gc.performance-considerations.php         14-Jun-2024 08:03               14612
features.gc.php                                    14-Jun-2024 08:03                1922
features.gc.refcounting-basics.php                 14-Jun-2024 08:03               22524
features.http-auth.php                             14-Jun-2024 08:03               23776
features.persistent-connections.php                14-Jun-2024 08:03                8147
features.php                                       14-Jun-2024 08:03                4316
features.remote-files.php                          14-Jun-2024 08:03                8159           14-Jun-2024 08:03               29950
features.sessions.php                              14-Jun-2024 08:03                1486
features.xforms.php                                14-Jun-2024 08:03                5542
ffi-ctype.getalignment.php                         14-Jun-2024 08:03                2412
ffi-ctype.getarrayelementtype.php                  14-Jun-2024 08:03                2498
ffi-ctype.getarraylength.php                       14-Jun-2024 08:03                2455
ffi-ctype.getattributes.php                        14-Jun-2024 08:03                2431
ffi-ctype.getenumkind.php                          14-Jun-2024 08:03                2407
ffi-ctype.getfuncabi.php                           14-Jun-2024 08:03                2415
ffi-ctype.getfuncparametercount.php                14-Jun-2024 08:03                2521
ffi-ctype.getfuncparametertype.php                 14-Jun-2024 08:03                2754
ffi-ctype.getfuncreturntype.php                    14-Jun-2024 08:03                2480
ffi-ctype.getkind.php                              14-Jun-2024 08:03                2369
ffi-ctype.getname.php                              14-Jun-2024 08:03                2375
ffi-ctype.getpointertype.php                       14-Jun-2024 08:03                2424
ffi-ctype.getsize.php                              14-Jun-2024 08:03                2387
ffi-ctype.getstructfieldnames.php                  14-Jun-2024 08:03                2497
ffi-ctype.getstructfieldoffset.php                 14-Jun-2024 08:03                2750
ffi-ctype.getstructfieldtype.php                   14-Jun-2024 08:03                2712
ffi.addr.php                                       14-Jun-2024 08:03                2915
ffi.alignof.php                                    14-Jun-2024 08:03                2991
ffi.arraytype.php                                  14-Jun-2024 08:03                4709
ffi.cast.php                                       14-Jun-2024 08:03                5008
ffi.cdef.php                                       14-Jun-2024 08:03                4638
ffi.configuration.php                              14-Jun-2024 08:03                4602
ffi.constants.php                                  14-Jun-2024 08:03                1195
ffi.examples-basic.php                             14-Jun-2024 08:03               16220
ffi.examples-callback.php                          14-Jun-2024 08:03                5095
ffi.examples-complete.php                          14-Jun-2024 08:03                5366
ffi.examples.php                                   14-Jun-2024 08:03                1578                                       14-Jun-2024 08:03                2512
ffi.installation.php                               14-Jun-2024 08:03                1497
ffi.isnull.php                                     14-Jun-2024 08:03                2593
ffi.load.php                                       14-Jun-2024 08:03                4740
ffi.memcmp.php                                     14-Jun-2024 08:03                4237
ffi.memcpy.php                                     14-Jun-2024 08:03                3376
ffi.memset.php                                     14-Jun-2024 08:03                3194                                        14-Jun-2024 08:03                5361
ffi.requirements.php                               14-Jun-2024 08:03                1315
ffi.resources.php                                  14-Jun-2024 08:03                1249
ffi.scope.php                                      14-Jun-2024 08:03                3269
ffi.setup.php                                      14-Jun-2024 08:03                1614
ffi.sizeof.php                                     14-Jun-2024 08:03                2819
ffi.string.php                                     14-Jun-2024 08:03                4323
ffi.type.php                                       14-Jun-2024 08:03                3680
ffi.typeof.php                                     14-Jun-2024 08:03                2916
fiber.construct.php                                14-Jun-2024 08:03                2417
fiber.getcurrent.php                               14-Jun-2024 08:03                2609
fiber.getreturn.php                                14-Jun-2024 08:03                2710
fiber.isrunning.php                                14-Jun-2024 08:03                2892
fiber.isstarted.php                                14-Jun-2024 08:03                2397
fiber.issuspended.php                              14-Jun-2024 08:03                2402
fiber.isterminated.php                             14-Jun-2024 08:03                2473
fiber.resume.php                                   14-Jun-2024 08:03                3434
fiber.start.php                                    14-Jun-2024 08:03                3124
fiber.suspend.php                                  14-Jun-2024 08:03                4187
fiber.throw.php                                    14-Jun-2024 08:03                3305
fibererror.construct.php                           14-Jun-2024 08:03                2261
fileinfo.configuration.php                         14-Jun-2024 08:03                1298
fileinfo.constants.php                             14-Jun-2024 08:03                6692
fileinfo.installation.php                          14-Jun-2024 08:03                1808
fileinfo.requirements.php                          14-Jun-2024 08:03                1271
fileinfo.resources.php                             14-Jun-2024 08:03                1493
fileinfo.setup.php                                 14-Jun-2024 08:03                1689
filesystem.configuration.php                       14-Jun-2024 08:03                7953
filesystem.constants.php                           14-Jun-2024 08:03               13691
filesystem.installation.php                        14-Jun-2024 08:03                1340
filesystem.requirements.php                        14-Jun-2024 08:03                1285
filesystem.resources.php                           14-Jun-2024 08:03                1458
filesystem.setup.php                               14-Jun-2024 08:03                1731
filesystemiterator.construct.php                   14-Jun-2024 08:03                7813
filesystemiterator.current.php                     14-Jun-2024 08:03                5633
filesystemiterator.getflags.php                    14-Jun-2024 08:03                3291
filesystemiterator.key.php                         14-Jun-2024 08:03                5350                        14-Jun-2024 08:03                4570
filesystemiterator.rewind.php                      14-Jun-2024 08:03                5181
filesystemiterator.setflags.php                    14-Jun-2024 08:03                6875
filter.configuration.php                           14-Jun-2024 08:03                5288
filter.constants.php                               14-Jun-2024 08:03               25813
filter.examples.php                                14-Jun-2024 08:03                1493
filter.examples.sanitization.php                   14-Jun-2024 08:03                5673
filter.examples.validation.php                     14-Jun-2024 08:03               10060
filter.filters.flags.php                           14-Jun-2024 08:03               17205
filter.filters.misc.php                            14-Jun-2024 08:03                1975
filter.filters.php                                 14-Jun-2024 08:03                1663
filter.filters.sanitize.php                        14-Jun-2024 08:03               13748
filter.filters.validate.php                        14-Jun-2024 08:03               14691
filter.installation.php                            14-Jun-2024 08:03                1384
filter.requirements.php                            14-Jun-2024 08:03                1257
filter.resources.php                               14-Jun-2024 08:03                1247
filter.setup.php                                   14-Jun-2024 08:03                1653
filteriterator.accept.php                          14-Jun-2024 08:03                5357
filteriterator.construct.php                       14-Jun-2024 08:03                3156
filteriterator.current.php                         14-Jun-2024 08:03                3139
filteriterator.key.php                             14-Jun-2024 08:03                3058                            14-Jun-2024 08:03                3107
filteriterator.rewind.php                          14-Jun-2024 08:03                3305
filteriterator.valid.php                           14-Jun-2024 08:03                2905
filters.compression.php                            14-Jun-2024 08:03               16091
filters.convert.php                                14-Jun-2024 08:03               11995
filters.encryption.php                             14-Jun-2024 08:03               41089
filters.php                                        14-Jun-2024 08:03                3385
filters.string.php                                 14-Jun-2024 08:03               10402
finfo.buffer.php                                   14-Jun-2024 08:03                2908
finfo.construct.php                                14-Jun-2024 08:03                3087
finfo.file.php                                     14-Jun-2024 08:03                2899
finfo.set-flags.php                                14-Jun-2024 08:03                2128
fpm.observability.php                              14-Jun-2024 08:03                1449
fpm.setup.php                                      14-Jun-2024 08:03                1391
fpm.status.php                                     14-Jun-2024 08:03               10852
ftp.configuration.php                              14-Jun-2024 08:03                1263
ftp.constants.php                                  14-Jun-2024 08:03                5460
ftp.examples-basic.php                             14-Jun-2024 08:03                4957
ftp.examples.php                                   14-Jun-2024 08:03                1399
ftp.installation.php                               14-Jun-2024 08:03                1507
ftp.requirements.php                               14-Jun-2024 08:03                1236
ftp.resources.php                                  14-Jun-2024 08:03                1570
ftp.setup.php                                      14-Jun-2024 08:03                1626
funchand.configuration.php                         14-Jun-2024 08:03                1298
funchand.constants.php                             14-Jun-2024 08:03                1273
funchand.installation.php                          14-Jun-2024 08:03                1326
funchand.requirements.php                          14-Jun-2024 08:03                1271
funchand.resources.php                             14-Jun-2024 08:03                1284
funchand.setup.php                                 14-Jun-2024 08:03                1679
funcref.php                                        14-Jun-2024 08:03               14877
function.abs.php                                   14-Jun-2024 08:03                5514
function.acos.php                                  14-Jun-2024 08:03                3526
function.acosh.php                                 14-Jun-2024 08:03                3230
function.addcslashes.php                           14-Jun-2024 08:03                8390
function.addslashes.php                            14-Jun-2024 08:03                6763
function.apache-child-terminate.php                14-Jun-2024 08:03                3456
function.apache-get-modules.php                    14-Jun-2024 08:03                3398
function.apache-get-version.php                    14-Jun-2024 08:03                4028
function.apache-getenv.php                         14-Jun-2024 08:03                5416
function.apache-lookup-uri.php                     14-Jun-2024 08:03                5902
function.apache-note.php                           14-Jun-2024 08:03                7469
function.apache-request-headers.php                14-Jun-2024 08:03                5922
function.apache-response-headers.php               14-Jun-2024 08:03                4567
function.apache-setenv.php                         14-Jun-2024 08:03                5968
function.apcu-add.php                              14-Jun-2024 08:03                9008
function.apcu-cache-info.php                       14-Jun-2024 08:03                7007
function.apcu-cas.php                              14-Jun-2024 08:03                8942
function.apcu-clear-cache.php                      14-Jun-2024 08:03                2713
function.apcu-dec.php                              14-Jun-2024 08:03                8425
function.apcu-delete.php                           14-Jun-2024 08:03                6075
function.apcu-enabled.php                          14-Jun-2024 08:03                2481
function.apcu-entry.php                            14-Jun-2024 08:03                9026
function.apcu-exists.php                           14-Jun-2024 08:03                7041
function.apcu-fetch.php                            14-Jun-2024 08:03                5967
function.apcu-inc.php                              14-Jun-2024 08:03                8412
function.apcu-key-info.php                         14-Jun-2024 08:03                5114
function.apcu-sma-info.php                         14-Jun-2024 08:03                4846
function.apcu-store.php                            14-Jun-2024 08:03                7838
function.array-change-key-case.php                 14-Jun-2024 08:03                5502
function.array-chunk.php                           14-Jun-2024 08:03                7926
function.array-column.php                          14-Jun-2024 08:03               17382
function.array-combine.php                         14-Jun-2024 08:03                7465
function.array-count-values.php                    14-Jun-2024 08:03                5949
function.array-diff-assoc.php                      14-Jun-2024 08:03               11521
function.array-diff-key.php                        14-Jun-2024 08:03               13196
function.array-diff-uassoc.php                     14-Jun-2024 08:03               12469
function.array-diff-ukey.php                       14-Jun-2024 08:03               12710
function.array-diff.php                            14-Jun-2024 08:03               12660
function.array-fill-keys.php                       14-Jun-2024 08:03                5391
function.array-fill.php                            14-Jun-2024 08:03                9399
function.array-filter.php                          14-Jun-2024 08:03               17040
function.array-flip.php                            14-Jun-2024 08:03                7257
function.array-intersect-assoc.php                 14-Jun-2024 08:03                9208
function.array-intersect-key.php                   14-Jun-2024 08:03               10624
function.array-intersect-uassoc.php                14-Jun-2024 08:03                9419
function.array-intersect-ukey.php                  14-Jun-2024 08:03               12440
function.array-intersect.php                       14-Jun-2024 08:03                7174
function.array-is-list.php                         14-Jun-2024 08:03                7166
function.array-key-exists.php                      14-Jun-2024 08:03               10370
function.array-key-first.php                       14-Jun-2024 08:03                7288
function.array-key-last.php                        14-Jun-2024 08:03                3485
function.array-keys.php                            14-Jun-2024 08:03                8630
function.array-map.php                             14-Jun-2024 08:03               28437
function.array-merge-recursive.php                 14-Jun-2024 08:03                7112
function.array-merge.php                           14-Jun-2024 08:03               12740
function.array-multisort.php                       14-Jun-2024 08:03               24338
function.array-pad.php                             14-Jun-2024 08:03                7816
function.array-pop.php                             14-Jun-2024 08:03                5786
function.array-product.php                         14-Jun-2024 08:03                5833
function.array-push.php                            14-Jun-2024 08:03                7326
function.array-rand.php                            14-Jun-2024 08:03                9834
function.array-reduce.php                          14-Jun-2024 08:03               10157
function.array-replace-recursive.php               14-Jun-2024 08:03               11350
function.array-replace.php                         14-Jun-2024 08:03                6997
function.array-reverse.php                         14-Jun-2024 08:03                6424
function.array-search.php                          14-Jun-2024 08:03                8673
function.array-shift.php                           14-Jun-2024 08:03                5959
function.array-slice.php                           14-Jun-2024 08:03               14590
function.array-splice.php                          14-Jun-2024 08:03               18406
function.array-sum.php                             14-Jun-2024 08:03                6501
function.array-udiff-assoc.php                     14-Jun-2024 08:03               18453
function.array-udiff-uassoc.php                    14-Jun-2024 08:03               19919
function.array-udiff.php                           14-Jun-2024 08:03               30852
function.array-uintersect-assoc.php                14-Jun-2024 08:03               12381
function.array-uintersect-uassoc.php               14-Jun-2024 08:03               12722
function.array-uintersect.php                      14-Jun-2024 08:03               11901
function.array-unique.php                          14-Jun-2024 08:03               10103
function.array-unshift.php                         14-Jun-2024 08:03               11439
function.array-values.php                          14-Jun-2024 08:03                4654
function.array-walk-recursive.php                  14-Jun-2024 08:03                8037
function.array-walk.php                            14-Jun-2024 08:03               14228
function.array.php                                 14-Jun-2024 08:03               12043
function.arsort.php                                14-Jun-2024 08:03                9556
function.asin.php                                  14-Jun-2024 08:03                3574
function.asinh.php                                 14-Jun-2024 08:03                3296
function.asort.php                                 14-Jun-2024 08:03                9546
function.assert-options.php                        14-Jun-2024 08:03               14628
function.assert.php                                14-Jun-2024 08:03               23828
function.atan.php                                  14-Jun-2024 08:03                3544
function.atan2.php                                 14-Jun-2024 08:03                3438
function.atanh.php                                 14-Jun-2024 08:03                3261
function.autoload.php                              14-Jun-2024 08:03                3232
function.base-convert.php                          14-Jun-2024 08:03                6858
function.base64-decode.php                         14-Jun-2024 08:03                5381
function.base64-encode.php                         14-Jun-2024 08:03                4918
function.basename.php                              14-Jun-2024 08:03                7753
function.bcadd.php                                 14-Jun-2024 08:03                6124
function.bccomp.php                                14-Jun-2024 08:03                6174
function.bcdiv.php                                 14-Jun-2024 08:03                5756
function.bcmod.php                                 14-Jun-2024 08:03                7822
function.bcmul.php                                 14-Jun-2024 08:03                7604
function.bcpow.php                                 14-Jun-2024 08:03                7593
function.bcpowmod.php                              14-Jun-2024 08:03                7878
function.bcscale.php                               14-Jun-2024 08:03                5761
function.bcsqrt.php                                14-Jun-2024 08:03                6692
function.bcsub.php                                 14-Jun-2024 08:03                6173
function.bin2hex.php                               14-Jun-2024 08:03                4842
function.bind-textdomain-codeset.php               14-Jun-2024 08:03                4680
function.bindec.php                                14-Jun-2024 08:03               15458
function.bindtextdomain.php                        14-Jun-2024 08:03                5657
function.boolval.php                               14-Jun-2024 08:03               10377
function.bzclose.php                               14-Jun-2024 08:03                3280
function.bzcompress.php                            14-Jun-2024 08:03                5299
function.bzdecompress.php                          14-Jun-2024 08:03                6787
function.bzerrno.php                               14-Jun-2024 08:03                3323
function.bzerror.php                               14-Jun-2024 08:03                4596
function.bzerrstr.php                              14-Jun-2024 08:03                3331
function.bzflush.php                               14-Jun-2024 08:03                3548
function.bzopen.php                                14-Jun-2024 08:03                5416
function.bzread.php                                14-Jun-2024 08:03                6742
function.bzwrite.php                               14-Jun-2024 08:03                6617                     14-Jun-2024 08:03                4725                           14-Jun-2024 08:03                7441                              14-Jun-2024 08:03                6246                             14-Jun-2024 08:03                6363                  14-Jun-2024 08:03               18193                        14-Jun-2024 08:03               14655
function.ceil.php                                  14-Jun-2024 08:03                5179
function.chdir.php                                 14-Jun-2024 08:03                5847
function.checkdate.php                             14-Jun-2024 08:03                5518
function.checkdnsrr.php                            14-Jun-2024 08:03                5165
function.chgrp.php                                 14-Jun-2024 08:03                7025
function.chmod.php                                 14-Jun-2024 08:03                9124
function.chop.php                                  14-Jun-2024 08:03                2102
function.chown.php                                 14-Jun-2024 08:03                7016
function.chr.php                                   14-Jun-2024 08:03                9825
function.chroot.php                                14-Jun-2024 08:03                4991
function.chunk-split.php                           14-Jun-2024 08:03                5455
function.class-alias.php                           14-Jun-2024 08:03                9279
function.class-exists.php                          14-Jun-2024 08:03                7088
function.class-implements.php                      14-Jun-2024 08:03                7523
function.class-parents.php                         14-Jun-2024 08:03                7250
function.class-uses.php                            14-Jun-2024 08:03                6406
function.clearstatcache.php                        14-Jun-2024 08:03               10968
function.cli-get-process-title.php                 14-Jun-2024 08:03                4753
function.cli-set-process-title.php                 14-Jun-2024 08:03                5764
function.closedir.php                              14-Jun-2024 08:03                4786
function.closelog.php                              14-Jun-2024 08:03                3016                       14-Jun-2024 08:03                3047                        14-Jun-2024 08:03               10773                 14-Jun-2024 08:03                6039                      14-Jun-2024 08:03                5436                      14-Jun-2024 08:03                4425                    14-Jun-2024 08:03                5449
function.commonmark-parse.php                      14-Jun-2024 08:03                4191
function.commonmark-render-html.php                14-Jun-2024 08:03                4755
function.commonmark-render-latex.php               14-Jun-2024 08:03                5085
function.commonmark-render-man.php                 14-Jun-2024 08:03                5067
function.commonmark-render-xml.php                 14-Jun-2024 08:03                4712
function.commonmark-render.php                     14-Jun-2024 08:03                5013
function.compact.php                               14-Jun-2024 08:03                8564
function.connection-aborted.php                    14-Jun-2024 08:03                3116
function.connection-status.php                     14-Jun-2024 08:03                3318
function.constant.php                              14-Jun-2024 08:03                9382
function.convert-cyr-string.php                    14-Jun-2024 08:03                5655
function.convert-uudecode.php                      14-Jun-2024 08:03                4777
function.convert-uuencode.php                      14-Jun-2024 08:03                5661
function.copy.php                                  14-Jun-2024 08:03                6297
function.cos.php                                   14-Jun-2024 08:03                3958
function.cosh.php                                  14-Jun-2024 08:03                3237
function.count-chars.php                           14-Jun-2024 08:03                7571
function.count.php                                 14-Jun-2024 08:03               16782
function.crc32.php                                 14-Jun-2024 08:03                7670
function.create-function.php                       14-Jun-2024 08:03               18177
function.crypt.php                                 14-Jun-2024 08:03               14763
function.ctype-alnum.php                           14-Jun-2024 08:03                7031
function.ctype-alpha.php                           14-Jun-2024 08:03                7473
function.ctype-cntrl.php                           14-Jun-2024 08:03                7053
function.ctype-digit.php                           14-Jun-2024 08:03                9207
function.ctype-graph.php                           14-Jun-2024 08:03                7689
function.ctype-lower.php                           14-Jun-2024 08:03                7014
function.ctype-print.php                           14-Jun-2024 08:03                7794
function.ctype-punct.php                           14-Jun-2024 08:03                7021
function.ctype-space.php                           14-Jun-2024 08:03                7920
function.ctype-upper.php                           14-Jun-2024 08:03                7054
function.ctype-xdigit.php                          14-Jun-2024 08:03                6890
function.cubrid-affected-rows.php                  14-Jun-2024 08:03                9622
function.cubrid-bind.php                           14-Jun-2024 08:03               21341
function.cubrid-client-encoding.php                14-Jun-2024 08:03                5694
function.cubrid-close-prepare.php                  14-Jun-2024 08:03                6422
function.cubrid-close-request.php                  14-Jun-2024 08:03                6415
function.cubrid-close.php                          14-Jun-2024 08:03                6634
function.cubrid-col-get.php                        14-Jun-2024 08:03                9054
function.cubrid-col-size.php                       14-Jun-2024 08:03                9091
function.cubrid-column-names.php                   14-Jun-2024 08:03                8803
function.cubrid-column-types.php                   14-Jun-2024 08:03                8781
function.cubrid-commit.php                         14-Jun-2024 08:03               15586
function.cubrid-connect-with-url.php               14-Jun-2024 08:03               16064
function.cubrid-connect.php                        14-Jun-2024 08:03               12776
function.cubrid-current-oid.php                    14-Jun-2024 08:03                6224
function.cubrid-data-seek.php                      14-Jun-2024 08:03                7583
function.cubrid-db-name.php                        14-Jun-2024 08:03                6807
function.cubrid-disconnect.php                     14-Jun-2024 08:03                7263
function.cubrid-drop.php                           14-Jun-2024 08:03               11560
function.cubrid-errno.php                          14-Jun-2024 08:03                6822
function.cubrid-error-code-facility.php            14-Jun-2024 08:03                6072
function.cubrid-error-code.php                     14-Jun-2024 08:03                5965
function.cubrid-error-msg.php                      14-Jun-2024 08:03                5440
function.cubrid-error.php                          14-Jun-2024 08:03                6660
function.cubrid-execute.php                        14-Jun-2024 08:03               14950
function.cubrid-fetch-array.php                    14-Jun-2024 08:03               10339
function.cubrid-fetch-assoc.php                    14-Jun-2024 08:03                9500
function.cubrid-fetch-field.php                    14-Jun-2024 08:03               14492
function.cubrid-fetch-lengths.php                  14-Jun-2024 08:03                6394
function.cubrid-fetch-object.php                   14-Jun-2024 08:03               12083
function.cubrid-fetch-row.php                      14-Jun-2024 08:03                9323
function.cubrid-fetch.php                          14-Jun-2024 08:03               10558
function.cubrid-field-flags.php                    14-Jun-2024 08:03                8135
function.cubrid-field-len.php                      14-Jun-2024 08:03                8536
function.cubrid-field-name.php                     14-Jun-2024 08:03                7431
function.cubrid-field-seek.php                     14-Jun-2024 08:03               11303
function.cubrid-field-table.php                    14-Jun-2024 08:03                7608
function.cubrid-field-type.php                     14-Jun-2024 08:03                7643
function.cubrid-free-result.php                    14-Jun-2024 08:03                6110
function.cubrid-get-autocommit.php                 14-Jun-2024 08:03                3994
function.cubrid-get-charset.php                    14-Jun-2024 08:03                5275
function.cubrid-get-class-name.php                 14-Jun-2024 08:03                6492
function.cubrid-get-client-info.php                14-Jun-2024 08:03                8389
function.cubrid-get-db-parameter.php               14-Jun-2024 08:03               15030
function.cubrid-get-query-timeout.php              14-Jun-2024 08:03                6954
function.cubrid-get-server-info.php                14-Jun-2024 08:03                8677
function.cubrid-get.php                            14-Jun-2024 08:03               10744
function.cubrid-insert-id.php                      14-Jun-2024 08:03                7599
function.cubrid-is-instance.php                    14-Jun-2024 08:03                7315
function.cubrid-list-dbs.php                       14-Jun-2024 08:03                4719
function.cubrid-load-from-glo.php                  14-Jun-2024 08:03                7042
function.cubrid-lob-close.php                      14-Jun-2024 08:03                7506
function.cubrid-lob-export.php                     14-Jun-2024 08:03                8156
function.cubrid-lob-get.php                        14-Jun-2024 08:03                7979
function.cubrid-lob-send.php                       14-Jun-2024 08:03                7257
function.cubrid-lob-size.php                       14-Jun-2024 08:03                6155
function.cubrid-lob2-bind.php                      14-Jun-2024 08:03               10055
function.cubrid-lob2-close.php                     14-Jun-2024 08:03                3602
function.cubrid-lob2-export.php                    14-Jun-2024 08:03                9131
function.cubrid-lob2-import.php                    14-Jun-2024 08:03                8997
function.cubrid-lob2-new.php                       14-Jun-2024 08:03                4101
function.cubrid-lob2-read.php                      14-Jun-2024 08:03               14078
function.cubrid-lob2-seek.php                      14-Jun-2024 08:03               11850
function.cubrid-lob2-seek64.php                    14-Jun-2024 08:03               13513
function.cubrid-lob2-size.php                      14-Jun-2024 08:03                4535
function.cubrid-lob2-size64.php                    14-Jun-2024 08:03                4825
function.cubrid-lob2-tell.php                      14-Jun-2024 08:03                4558
function.cubrid-lob2-tell64.php                    14-Jun-2024 08:03                4867
function.cubrid-lob2-write.php                     14-Jun-2024 08:03               14341
function.cubrid-lock-read.php                      14-Jun-2024 08:03                9316
function.cubrid-lock-write.php                     14-Jun-2024 08:03                9716
function.cubrid-move-cursor.php                    14-Jun-2024 08:03                9825
function.cubrid-new-glo.php                        14-Jun-2024 08:03                7057
function.cubrid-next-result.php                    14-Jun-2024 08:03               16608
function.cubrid-num-cols.php                       14-Jun-2024 08:03                6153
function.cubrid-num-fields.php                     14-Jun-2024 08:03                5921
function.cubrid-num-rows.php                       14-Jun-2024 08:03                7593
function.cubrid-pconnect-with-url.php              14-Jun-2024 08:03               15653
function.cubrid-pconnect.php                       14-Jun-2024 08:03               12642
function.cubrid-ping.php                           14-Jun-2024 08:03                6235
function.cubrid-prepare.php                        14-Jun-2024 08:03               10361
function.cubrid-put.php                            14-Jun-2024 08:03               11827
function.cubrid-query.php                          14-Jun-2024 08:03               15351
function.cubrid-real-escape-string.php             14-Jun-2024 08:03                8559
function.cubrid-result.php                         14-Jun-2024 08:03                7826
function.cubrid-rollback.php                       14-Jun-2024 08:03               14745
function.cubrid-save-to-glo.php                    14-Jun-2024 08:03                6893
function.cubrid-schema.php                         14-Jun-2024 08:03               21008
function.cubrid-send-glo.php                       14-Jun-2024 08:03                6365
function.cubrid-seq-drop.php                       14-Jun-2024 08:03                9964
function.cubrid-seq-insert.php                     14-Jun-2024 08:03               10394
function.cubrid-seq-put.php                        14-Jun-2024 08:03               10365
function.cubrid-set-add.php                        14-Jun-2024 08:03                9683
function.cubrid-set-autocommit.php                 14-Jun-2024 08:03                4349
function.cubrid-set-db-parameter.php               14-Jun-2024 08:03                8458
function.cubrid-set-drop.php                       14-Jun-2024 08:03                9638
function.cubrid-set-query-timeout.php              14-Jun-2024 08:03                3769
function.cubrid-unbuffered-query.php               14-Jun-2024 08:03                7266
function.cubrid-version.php                        14-Jun-2024 08:03                8808
function.curl-close.php                            14-Jun-2024 08:03                6101
function.curl-copy-handle.php                      14-Jun-2024 08:03                6508
function.curl-errno.php                            14-Jun-2024 08:03                6113
function.curl-error.php                            14-Jun-2024 08:03                6028
function.curl-escape.php                           14-Jun-2024 08:03                7549
function.curl-exec.php                             14-Jun-2024 08:03                7548
function.curl-getinfo.php                          14-Jun-2024 08:03               39799
function.curl-init.php                             14-Jun-2024 08:03                7234
function.curl-multi-add-handle.php                 14-Jun-2024 08:03               10279
function.curl-multi-close.php                      14-Jun-2024 08:03                9647
function.curl-multi-errno.php                      14-Jun-2024 08:03                3976
function.curl-multi-exec.php                       14-Jun-2024 08:03               10380
function.curl-multi-getcontent.php                 14-Jun-2024 08:03                4533
function.curl-multi-info-read.php                  14-Jun-2024 08:03               12378
function.curl-multi-init.php                       14-Jun-2024 08:03                8773
function.curl-multi-remove-handle.php              14-Jun-2024 08:03                5491
function.curl-multi-select.php                     14-Jun-2024 08:03                4532
function.curl-multi-setopt.php                     14-Jun-2024 08:03               13328
function.curl-multi-strerror.php                   14-Jun-2024 08:03                7185
function.curl-pause.php                            14-Jun-2024 08:03                4005
function.curl-reset.php                            14-Jun-2024 08:03                6579
function.curl-setopt-array.php                     14-Jun-2024 08:03                7756
function.curl-setopt.php                           14-Jun-2024 08:03              179013
function.curl-share-close.php                      14-Jun-2024 08:03                8123
function.curl-share-errno.php                      14-Jun-2024 08:03                4011
function.curl-share-init.php                       14-Jun-2024 08:03                7701
function.curl-share-setopt.php                     14-Jun-2024 08:03               10432
function.curl-share-strerror.php                   14-Jun-2024 08:03                3577
function.curl-strerror.php                         14-Jun-2024 08:03                6347
function.curl-unescape.php                         14-Jun-2024 08:03                8061
function.curl-version.php                          14-Jun-2024 08:03                7109
function.curl_upkeep.php                           14-Jun-2024 08:03                7061
function.current.php                               14-Jun-2024 08:03               11302                              14-Jun-2024 08:03                1751               14-Jun-2024 08:03                1926     14-Jun-2024 08:03                2038                 14-Jun-2024 08:03                4352                           14-Jun-2024 08:03                4492                         14-Jun-2024 08:03                1810             14-Jun-2024 08:03                7196             14-Jun-2024 08:03                5925                             14-Jun-2024 08:03                1770                           14-Jun-2024 08:03                1778                  14-Jun-2024 08:03                1943 14-Jun-2024 08:03                2054                  14-Jun-2024 08:03                1905                      14-Jun-2024 08:03                1833                           14-Jun-2024 08:03                1782                       14-Jun-2024 08:03                1826                14-Jun-2024 08:03               14318                            14-Jun-2024 08:03               19573                              14-Jun-2024 08:03                2311                         14-Jun-2024 08:03               15898                          14-Jun-2024 08:03               14585                           14-Jun-2024 08:03               14655                         14-Jun-2024 08:03                1796                    14-Jun-2024 08:03                1855                    14-Jun-2024 08:03                1863                     14-Jun-2024 08:03                1853                     14-Jun-2024 08:03                1824                                  14-Jun-2024 08:03               22376
function.db2-autocommit.php                        14-Jun-2024 08:03               11463
function.db2-bind-param.php                        14-Jun-2024 08:03               23843
function.db2-client-info.php                       14-Jun-2024 08:03               12920
function.db2-close.php                             14-Jun-2024 08:03                5872
function.db2-column-privileges.php                 14-Jun-2024 08:03                9681
function.db2-columns.php                           14-Jun-2024 08:03               11781
function.db2-commit.php                            14-Jun-2024 08:03                3877
function.db2-conn-error.php                        14-Jun-2024 08:03                7369
function.db2-conn-errormsg.php                     14-Jun-2024 08:03                7203
function.db2-connect.php                           14-Jun-2024 08:03               42342
function.db2-cursor-type.php                       14-Jun-2024 08:03                3401
function.db2-escape-string.php                     14-Jun-2024 08:03                7873
function.db2-exec.php                              14-Jun-2024 08:03               27085
function.db2-execute.php                           14-Jun-2024 08:03               26541
function.db2-fetch-array.php                       14-Jun-2024 08:03               11941
function.db2-fetch-assoc.php                       14-Jun-2024 08:03               11872
function.db2-fetch-both.php                        14-Jun-2024 08:03               12503
function.db2-fetch-object.php                      14-Jun-2024 08:03                9567
function.db2-fetch-row.php                         14-Jun-2024 08:03               16888
function.db2-field-display-size.php                14-Jun-2024 08:03                5298
function.db2-field-name.php                        14-Jun-2024 08:03                5154
function.db2-field-num.php                         14-Jun-2024 08:03                5189
function.db2-field-precision.php                   14-Jun-2024 08:03                5197
function.db2-field-scale.php                       14-Jun-2024 08:03                5176
function.db2-field-type.php                        14-Jun-2024 08:03                5177
function.db2-field-width.php                       14-Jun-2024 08:03                5418
function.db2-foreign-keys.php                      14-Jun-2024 08:03                9451
function.db2-free-result.php                       14-Jun-2024 08:03                3499
function.db2-free-stmt.php                         14-Jun-2024 08:03                3478
function.db2-get-option.php                        14-Jun-2024 08:03               24881
function.db2-last-insert-id.php                    14-Jun-2024 08:03                8191
function.db2-lob-read.php                          14-Jun-2024 08:03               16822
function.db2-next-result.php                       14-Jun-2024 08:03                9094
function.db2-num-fields.php                        14-Jun-2024 08:03                7464
function.db2-num-rows.php                          14-Jun-2024 08:03                4962
function.db2-pclose.php                            14-Jun-2024 08:03                5969
function.db2-pconnect.php                          14-Jun-2024 08:03               34776
function.db2-prepare.php                           14-Jun-2024 08:03               11139
function.db2-primary-keys.php                      14-Jun-2024 08:03                8112
function.db2-procedure-columns.php                 14-Jun-2024 08:03               12750
function.db2-procedures.php                        14-Jun-2024 08:03                8588
function.db2-result.php                            14-Jun-2024 08:03                8402
function.db2-rollback.php                          14-Jun-2024 08:03                9628
function.db2-server-info.php                       14-Jun-2024 08:03               25374
function.db2-set-option.php                        14-Jun-2024 08:03               66629
function.db2-special-columns.php                   14-Jun-2024 08:03               10850
function.db2-statistics.php                        14-Jun-2024 08:03               13465
function.db2-stmt-error.php                        14-Jun-2024 08:03                4821
function.db2-stmt-errormsg.php                     14-Jun-2024 08:03                4450
function.db2-table-privileges.php                  14-Jun-2024 08:03                9102
function.db2-tables.php                            14-Jun-2024 08:03                9387
function.dba-close.php                             14-Jun-2024 08:03                3385
function.dba-delete.php                            14-Jun-2024 08:03                4443
function.dba-exists.php                            14-Jun-2024 08:03                4361
function.dba-fetch.php                             14-Jun-2024 08:03                7531
function.dba-firstkey.php                          14-Jun-2024 08:03                3876
function.dba-handlers.php                          14-Jun-2024 08:03                5730
function.dba-insert.php                            14-Jun-2024 08:03                5061
function.dba-key-split.php                         14-Jun-2024 08:03                4132
function.dba-list.php                              14-Jun-2024 08:03                2341
function.dba-nextkey.php                           14-Jun-2024 08:03                3803
function.dba-open.php                              14-Jun-2024 08:03               15766
function.dba-optimize.php                          14-Jun-2024 08:03                3399
function.dba-popen.php                             14-Jun-2024 08:03                9655
function.dba-replace.php                           14-Jun-2024 08:03                4826
function.dba-sync.php                              14-Jun-2024 08:03                3446
function.dbase-add-record.php                      14-Jun-2024 08:03                7308
function.dbase-close.php                           14-Jun-2024 08:03                5535
function.dbase-create.php                          14-Jun-2024 08:03                8639
function.dbase-delete-record.php                   14-Jun-2024 08:03                5397
function.dbase-get-header-info.php                 14-Jun-2024 08:03                7426
function.dbase-get-record-with-names.php           14-Jun-2024 08:03                9214
function.dbase-get-record.php                      14-Jun-2024 08:03                6146
function.dbase-numfields.php                       14-Jun-2024 08:03                6259
function.dbase-numrecords.php                      14-Jun-2024 08:03                7255
function.dbase-open.php                            14-Jun-2024 08:03                6885
function.dbase-pack.php                            14-Jun-2024 08:03                6711
function.dbase-replace-record.php                  14-Jun-2024 08:03                9683
function.dcgettext.php                             14-Jun-2024 08:03                3540
function.dcngettext.php                            14-Jun-2024 08:03                4204
function.debug-backtrace.php                       14-Jun-2024 08:03               11996
function.debug-print-backtrace.php                 14-Jun-2024 08:03                6634
function.debug-zval-dump.php                       14-Jun-2024 08:03               10271
function.decbin.php                                14-Jun-2024 08:03                9010
function.dechex.php                                14-Jun-2024 08:03                7414
function.decoct.php                                14-Jun-2024 08:03                4902
function.define.php                                14-Jun-2024 08:03               12317
function.defined.php                               14-Jun-2024 08:03                7982
function.deflate-add.php                           14-Jun-2024 08:03                5991
function.deflate-init.php                          14-Jun-2024 08:03                7934
function.deg2rad.php                               14-Jun-2024 08:03                4031
function.delete.php                                14-Jun-2024 08:03                2485
function.dgettext.php                              14-Jun-2024 08:03                3320
function.die.php                                   14-Jun-2024 08:03                1607
function.dio-close.php                             14-Jun-2024 08:03                4014
function.dio-fcntl.php                             14-Jun-2024 08:03               10038
function.dio-open.php                              14-Jun-2024 08:03                8459
function.dio-read.php                              14-Jun-2024 08:03                3641
function.dio-seek.php                              14-Jun-2024 08:03                7632
function.dio-stat.php                              14-Jun-2024 08:03                4336
function.dio-tcsetattr.php                         14-Jun-2024 08:03                7056
function.dio-truncate.php                          14-Jun-2024 08:03                3851
function.dio-write.php                             14-Jun-2024 08:03                4024
function.dir.php                                   14-Jun-2024 08:03                7439
function.dirname.php                               14-Jun-2024 08:03                9714
function.disk-free-space.php                       14-Jun-2024 08:03                5639
function.disk-total-space.php                      14-Jun-2024 08:03                5371
function.diskfreespace.php                         14-Jun-2024 08:03                1818
function.dl.php                                    14-Jun-2024 08:03               10382
function.dngettext.php                             14-Jun-2024 08:03                3980
function.dns-check-record.php                      14-Jun-2024 08:03                1772
function.dns-get-mx.php                            14-Jun-2024 08:03                1742
function.dns-get-record.php                        14-Jun-2024 08:03               24493
function.dom-import-simplexml.php                  14-Jun-2024 08:03                6998
function.doubleval.php                             14-Jun-2024 08:03                1727
function.each.php                                  14-Jun-2024 08:03               11696
function.easter-date.php                           14-Jun-2024 08:03               14516
function.easter-days.php                           14-Jun-2024 08:03                7486
function.echo.php                                  14-Jun-2024 08:03               18038
function.eio-busy.php                              14-Jun-2024 08:03                5179
function.eio-cancel.php                            14-Jun-2024 08:03                7892
function.eio-chmod.php                             14-Jun-2024 08:03                6629
function.eio-chown.php                             14-Jun-2024 08:03                6803
function.eio-close.php                             14-Jun-2024 08:03                5968
function.eio-custom.php                            14-Jun-2024 08:03               10781
function.eio-dup2.php                              14-Jun-2024 08:03                6009
function.eio-event-loop.php                        14-Jun-2024 08:03                5883
function.eio-fallocate.php                         14-Jun-2024 08:03                8031
function.eio-fchmod.php                            14-Jun-2024 08:03                6555
function.eio-fchown.php                            14-Jun-2024 08:03                6836
function.eio-fdatasync.php                         14-Jun-2024 08:03                5933
function.eio-fstat.php                             14-Jun-2024 08:03               12147
function.eio-fstatvfs.php                          14-Jun-2024 08:03                6144
function.eio-fsync.php                             14-Jun-2024 08:03                6020
function.eio-ftruncate.php                         14-Jun-2024 08:03                6501
function.eio-futime.php                            14-Jun-2024 08:03                6975
function.eio-get-event-stream.php                  14-Jun-2024 08:03                8298
function.eio-get-last-error.php                    14-Jun-2024 08:03                3282
function.eio-grp-add.php                           14-Jun-2024 08:03               11741
function.eio-grp-cancel.php                        14-Jun-2024 08:03                3255
function.eio-grp-limit.php                         14-Jun-2024 08:03                3160
function.eio-grp.php                               14-Jun-2024 08:03               12112
function.eio-init.php                              14-Jun-2024 08:03                2749
function.eio-link.php                              14-Jun-2024 08:03               12873
function.eio-lstat.php                             14-Jun-2024 08:03               10369
function.eio-mkdir.php                             14-Jun-2024 08:03                9595
function.eio-mknod.php                             14-Jun-2024 08:03               12075
function.eio-nop.php                               14-Jun-2024 08:03                5665
function.eio-npending.php                          14-Jun-2024 08:03                3087
function.eio-nready.php                            14-Jun-2024 08:03                2855
function.eio-nreqs.php                             14-Jun-2024 08:03                5660
function.eio-nthreads.php                          14-Jun-2024 08:03                3620
function.eio-open.php                              14-Jun-2024 08:03               12280
function.eio-poll.php                              14-Jun-2024 08:03                5941
function.eio-read.php                              14-Jun-2024 08:03               13048
function.eio-readahead.php                         14-Jun-2024 08:03                6688
function.eio-readdir.php                           14-Jun-2024 08:03               18398
function.eio-readlink.php                          14-Jun-2024 08:03               12558
function.eio-realpath.php                          14-Jun-2024 08:03                5451
function.eio-rename.php                            14-Jun-2024 08:03                9636
function.eio-rmdir.php                             14-Jun-2024 08:03                8560
function.eio-seek.php                              14-Jun-2024 08:03                7266
function.eio-sendfile.php                          14-Jun-2024 08:03                6960
function.eio-set-max-idle.php                      14-Jun-2024 08:03                3272
function.eio-set-max-parallel.php                  14-Jun-2024 08:03                3316
function.eio-set-max-poll-reqs.php                 14-Jun-2024 08:03                2580
function.eio-set-max-poll-time.php                 14-Jun-2024 08:03                2674
function.eio-set-min-parallel.php                  14-Jun-2024 08:03                3307
function.eio-stat.php                              14-Jun-2024 08:03               10430
function.eio-statvfs.php                           14-Jun-2024 08:03                8871
function.eio-symlink.php                           14-Jun-2024 08:03               11198
function.eio-sync-file-range.php                   14-Jun-2024 08:03                7820
function.eio-sync.php                              14-Jun-2024 08:03                2958
function.eio-syncfs.php                            14-Jun-2024 08:03                5537
function.eio-truncate.php                          14-Jun-2024 08:03                6468
function.eio-unlink.php                            14-Jun-2024 08:03                5665
function.eio-utime.php                             14-Jun-2024 08:03                6602
function.eio-write.php                             14-Jun-2024 08:03                7275
function.empty.php                                 14-Jun-2024 08:03                9616
function.enchant-broker-describe.php               14-Jun-2024 08:03                6209
function.enchant-broker-dict-exists.php            14-Jun-2024 08:03                5743
function.enchant-broker-free-dict.php              14-Jun-2024 08:03                4942
function.enchant-broker-free.php                   14-Jun-2024 08:03                4477
function.enchant-broker-get-dict-path.php          14-Jun-2024 08:03                5448
function.enchant-broker-get-error.php              14-Jun-2024 08:03                3762
function.enchant-broker-init.php                   14-Jun-2024 08:03                3575
function.enchant-broker-list-dicts.php             14-Jun-2024 08:03                7043
function.enchant-broker-request-dict.php           14-Jun-2024 08:03                7241
function.enchant-broker-request-pwl-dict.php       14-Jun-2024 08:03                5535
function.enchant-broker-set-dict-path.php          14-Jun-2024 08:03                5748
function.enchant-broker-set-ordering.php           14-Jun-2024 08:03                4978
function.enchant-dict-add-to-personal.php          14-Jun-2024 08:03                2281
function.enchant-dict-add-to-session.php           14-Jun-2024 08:03                4522
function.enchant-dict-add.php                      14-Jun-2024 08:03                6515
function.enchant-dict-check.php                    14-Jun-2024 08:03                4366
function.enchant-dict-describe.php                 14-Jun-2024 08:03                6689
function.enchant-dict-get-error.php                14-Jun-2024 08:03                3986
function.enchant-dict-is-added.php                 14-Jun-2024 08:03                4557
function.enchant-dict-is-in-session.php            14-Jun-2024 08:03                2267
function.enchant-dict-quick-check.php              14-Jun-2024 08:03                8437
function.enchant-dict-store-replacement.php        14-Jun-2024 08:03                4852
function.enchant-dict-suggest.php                  14-Jun-2024 08:03                7562
function.end.php                                   14-Jun-2024 08:03                6646
function.enum-exists.php                           14-Jun-2024 08:03                5463
function.error-clear-last.php                      14-Jun-2024 08:03                4700
function.error-get-last.php                        14-Jun-2024 08:03                4971
function.error-log.php                             14-Jun-2024 08:03               11174
function.error-reporting.php                       14-Jun-2024 08:03                9677
function.escapeshellarg.php                        14-Jun-2024 08:03                5749
function.escapeshellcmd.php                        14-Jun-2024 08:03                7907
function.eval.php                                  14-Jun-2024 08:03                9585
function.exec.php                                  14-Jun-2024 08:03               11133
function.exif-imagetype.php                        14-Jun-2024 08:03               10121
function.exif-read-data.php                        14-Jun-2024 08:03               22421
function.exif-tagname.php                          14-Jun-2024 08:03                4902
function.exif-thumbnail.php                        14-Jun-2024 08:03                9595
function.exit.php                                  14-Jun-2024 08:03                9578
function.exp.php                                   14-Jun-2024 08:03                4350
function.expect-expectl.php                        14-Jun-2024 08:03               11409
function.expect-popen.php                          14-Jun-2024 08:03                4713
function.explode.php                               14-Jun-2024 08:03               15873
function.expm1.php                                 14-Jun-2024 08:03                3533
function.extension-loaded.php                      14-Jun-2024 08:03                5741
function.extract.php                               14-Jun-2024 08:03               14918
function.ezmlm-hash.php                            14-Jun-2024 08:03                4666
function.fann-cascadetrain-on-data.php             14-Jun-2024 08:03                6716
function.fann-cascadetrain-on-file.php             14-Jun-2024 08:03                5660
function.fann-clear-scaling-params.php             14-Jun-2024 08:03                2747
function.fann-copy.php                             14-Jun-2024 08:03                3348
function.fann-create-from-file.php                 14-Jun-2024 08:03                3401
function.fann-create-shortcut-array.php            14-Jun-2024 08:03                4323
function.fann-create-shortcut.php                  14-Jun-2024 08:03                5248
function.fann-create-sparse-array.php              14-Jun-2024 08:03                4828
function.fann-create-sparse.php                    14-Jun-2024 08:03                5586
function.fann-create-standard-array.php            14-Jun-2024 08:03                4502
function.fann-create-standard.php                  14-Jun-2024 08:03                5277
function.fann-create-train-from-callback.php       14-Jun-2024 08:03                9578
function.fann-create-train.php                     14-Jun-2024 08:03                4826
function.fann-descale-input.php                    14-Jun-2024 08:03                3914
function.fann-descale-output.php                   14-Jun-2024 08:03                3923
function.fann-descale-train.php                    14-Jun-2024 08:03                3927
function.fann-destroy-train.php                    14-Jun-2024 08:03                2747
function.fann-destroy.php                          14-Jun-2024 08:03                2746
function.fann-duplicate-train-data.php             14-Jun-2024 08:03                2895
function.fann-get-activation-function.php          14-Jun-2024 08:03                5404
function.fann-get-activation-steepness.php         14-Jun-2024 08:03                5797
function.fann-get-bias-array.php                   14-Jun-2024 08:03                2616
function.fann-get-bit-fail-limit.php               14-Jun-2024 08:03                3867
function.fann-get-bit-fail.php                     14-Jun-2024 08:03                5034
function.fann-get-cascade-activation-functions-..> 14-Jun-2024 08:03                3887
function.fann-get-cascade-activation-functions.php 14-Jun-2024 08:03                4703
function.fann-get-cascade-activation-steepnesse..> 14-Jun-2024 08:03                3943
function.fann-get-cascade-activation-steepnesse..> 14-Jun-2024 08:03                4092
function.fann-get-cascade-candidate-change-frac..> 14-Jun-2024 08:03                5204
function.fann-get-cascade-candidate-limit.php      14-Jun-2024 08:03                3583
function.fann-get-cascade-candidate-stagnation-..> 14-Jun-2024 08:03                4332
function.fann-get-cascade-max-cand-epochs.php      14-Jun-2024 08:03                3475
function.fann-get-cascade-max-out-epochs.php       14-Jun-2024 08:03                3398
function.fann-get-cascade-min-cand-epochs.php      14-Jun-2024 08:03                3792
function.fann-get-cascade-min-out-epochs.php       14-Jun-2024 08:03                3751
function.fann-get-cascade-num-candidate-groups.php 14-Jun-2024 08:03                3863
function.fann-get-cascade-num-candidates.php       14-Jun-2024 08:03                5988
function.fann-get-cascade-output-change-fractio..> 14-Jun-2024 08:03                5135
function.fann-get-cascade-output-stagnation-epo..> 14-Jun-2024 08:03                4277
function.fann-get-cascade-weight-multiplier.php    14-Jun-2024 08:03                3546
function.fann-get-connection-array.php             14-Jun-2024 08:03                2668
function.fann-get-connection-rate.php              14-Jun-2024 08:03                2809
function.fann-get-errno.php                        14-Jun-2024 08:03                3294
function.fann-get-errstr.php                       14-Jun-2024 08:03                3315
function.fann-get-layer-array.php                  14-Jun-2024 08:03                2717
function.fann-get-learning-momentum.php            14-Jun-2024 08:03                3948
function.fann-get-learning-rate.php                14-Jun-2024 08:03                3880
function.fann-get-mse.php                          14-Jun-2024 08:03                3270
function.fann-get-network-type.php                 14-Jun-2024 08:03                2736
function.fann-get-num-input.php                    14-Jun-2024 08:03                2665
function.fann-get-num-layers.php                   14-Jun-2024 08:03                2699
function.fann-get-num-output.php                   14-Jun-2024 08:03                2681
function.fann-get-quickprop-decay.php              14-Jun-2024 08:03                3411
function.fann-get-quickprop-mu.php                 14-Jun-2024 08:03                3389
function.fann-get-rprop-decrease-factor.php        14-Jun-2024 08:03                3491
function.fann-get-rprop-delta-max.php              14-Jun-2024 08:03                3536
function.fann-get-rprop-delta-min.php              14-Jun-2024 08:03                3336
function.fann-get-rprop-delta-zero.php             14-Jun-2024 08:03                3724
function.fann-get-rprop-increase-factor.php        14-Jun-2024 08:03                3482
function.fann-get-sarprop-step-error-shift.php     14-Jun-2024 08:03                3866
function.fann-get-sarprop-step-error-threshold-..> 14-Jun-2024 08:03                3969
function.fann-get-sarprop-temperature.php          14-Jun-2024 08:03                3640
function.fann-get-sarprop-weight-decay-shift.php   14-Jun-2024 08:03                3767
function.fann-get-total-connections.php            14-Jun-2024 08:03                2866
function.fann-get-total-neurons.php                14-Jun-2024 08:03                2936
function.fann-get-train-error-function.php         14-Jun-2024 08:03                3774
function.fann-get-train-stop-function.php          14-Jun-2024 08:03                3762
function.fann-get-training-algorithm.php           14-Jun-2024 08:03                4010
function.fann-init-weights.php                     14-Jun-2024 08:03                4690
function.fann-length-train-data.php                14-Jun-2024 08:03                2864
function.fann-merge-train-data.php                 14-Jun-2024 08:03                3159
function.fann-num-input-train-data.php             14-Jun-2024 08:03                3624
function.fann-num-output-train-data.php            14-Jun-2024 08:03                3610
function.fann-print-error.php                      14-Jun-2024 08:03                2979
function.fann-randomize-weights.php                14-Jun-2024 08:03                4058
function.fann-read-train-from-file.php             14-Jun-2024 08:03                5188
function.fann-reset-errno.php                      14-Jun-2024 08:03                3218
function.fann-reset-errstr.php                     14-Jun-2024 08:03                3193
function.fann-reset-mse.php                        14-Jun-2024 08:03                3527
function.fann-run.php                              14-Jun-2024 08:03                2946
function.fann-save-train.php                       14-Jun-2024 08:03                3639
function.fann-save.php                             14-Jun-2024 08:03                4531
function.fann-scale-input-train-data.php           14-Jun-2024 08:03                4541
function.fann-scale-input.php                      14-Jun-2024 08:03                4078
function.fann-scale-output-train-data.php          14-Jun-2024 08:03                4569
function.fann-scale-output.php                     14-Jun-2024 08:03                4066
function.fann-scale-train-data.php                 14-Jun-2024 08:03                4566
function.fann-scale-train.php                      14-Jun-2024 08:03                3962
function.fann-set-activation-function-hidden.php   14-Jun-2024 08:03                4666
function.fann-set-activation-function-layer.php    14-Jun-2024 08:03                5276
function.fann-set-activation-function-output.php   14-Jun-2024 08:03                4692
function.fann-set-activation-function.php          14-Jun-2024 08:03                6868
function.fann-set-activation-steepness-hidden.php  14-Jun-2024 08:03                4913
function.fann-set-activation-steepness-layer.php   14-Jun-2024 08:03                5454
function.fann-set-activation-steepness-output.php  14-Jun-2024 08:03                4913
function.fann-set-activation-steepness.php         14-Jun-2024 08:03                6482
function.fann-set-bit-fail-limit.php               14-Jun-2024 08:03                3545
function.fann-set-callback.php                     14-Jun-2024 08:03                5926
function.fann-set-cascade-activation-functions.php 14-Jun-2024 08:03                4210
function.fann-set-cascade-activation-steepnesse..> 14-Jun-2024 08:03                4417
function.fann-set-cascade-candidate-change-frac..> 14-Jun-2024 08:03                3893
function.fann-set-cascade-candidate-limit.php      14-Jun-2024 08:03                3667
function.fann-set-cascade-candidate-stagnation-..> 14-Jun-2024 08:03                3958
function.fann-set-cascade-max-cand-epochs.php      14-Jun-2024 08:03                3695
function.fann-set-cascade-max-out-epochs.php       14-Jun-2024 08:03                3652
function.fann-set-cascade-min-cand-epochs.php      14-Jun-2024 08:03                4013
function.fann-set-cascade-min-out-epochs.php       14-Jun-2024 08:03                4005
function.fann-set-cascade-num-candidate-groups.php 14-Jun-2024 08:03                3753
function.fann-set-cascade-output-change-fractio..> 14-Jun-2024 08:03                3859
function.fann-set-cascade-output-stagnation-epo..> 14-Jun-2024 08:03                3925
function.fann-set-cascade-weight-multiplier.php    14-Jun-2024 08:03                3667
function.fann-set-error-log.php                    14-Jun-2024 08:03                3041
function.fann-set-input-scaling-params.php         14-Jun-2024 08:03                4845
function.fann-set-learning-momentum.php            14-Jun-2024 08:03                4003
function.fann-set-learning-rate.php                14-Jun-2024 08:03                3929
function.fann-set-output-scaling-params.php        14-Jun-2024 08:03                4847
function.fann-set-quickprop-decay.php              14-Jun-2024 08:03                3601
function.fann-set-quickprop-mu.php                 14-Jun-2024 08:03                3436
function.fann-set-rprop-decrease-factor.php        14-Jun-2024 08:03                3709
function.fann-set-rprop-delta-max.php              14-Jun-2024 08:03                3841
function.fann-set-rprop-delta-min.php              14-Jun-2024 08:03                3631
function.fann-set-rprop-delta-zero.php             14-Jun-2024 08:03                4008
function.fann-set-rprop-increase-factor.php        14-Jun-2024 08:03                3747
function.fann-set-sarprop-step-error-shift.php     14-Jun-2024 08:03                4146
function.fann-set-sarprop-step-error-threshold-..> 14-Jun-2024 08:03                4312
function.fann-set-sarprop-temperature.php          14-Jun-2024 08:03                3958
function.fann-set-sarprop-weight-decay-shift.php   14-Jun-2024 08:03                4102
function.fann-set-scaling-params.php               14-Jun-2024 08:03                6017
function.fann-set-train-error-function.php         14-Jun-2024 08:03                3994
function.fann-set-train-stop-function.php          14-Jun-2024 08:03                3995
function.fann-set-training-algorithm.php           14-Jun-2024 08:03                3894
function.fann-set-weight-array.php                 14-Jun-2024 08:03                3340
function.fann-set-weight.php                       14-Jun-2024 08:03                3753
function.fann-shuffle-train-data.php               14-Jun-2024 08:03                3014
function.fann-subset-train-data.php                14-Jun-2024 08:03                4303
function.fann-test-data.php                        14-Jun-2024 08:03                4341
function.fann-test.php                             14-Jun-2024 08:03                4820
function.fann-train-epoch.php                      14-Jun-2024 08:03                4898
function.fann-train-on-data.php                    14-Jun-2024 08:03                6873
function.fann-train-on-file.php                    14-Jun-2024 08:03                6912
function.fann-train.php                            14-Jun-2024 08:03                4901
function.fastcgi-finish-request.php                14-Jun-2024 08:03                2711
function.fbird-add-user.php                        14-Jun-2024 08:03                2343
function.fbird-affected-rows.php                   14-Jun-2024 08:03                2358
function.fbird-backup.php                          14-Jun-2024 08:03                1787
function.fbird-blob-add.php                        14-Jun-2024 08:03                2686
function.fbird-blob-cancel.php                     14-Jun-2024 08:03                3779
function.fbird-blob-close.php                      14-Jun-2024 08:03                2717
function.fbird-blob-create.php                     14-Jun-2024 08:03                2717
function.fbird-blob-echo.php                       14-Jun-2024 08:03                2505
function.fbird-blob-get.php                        14-Jun-2024 08:03                2498
function.fbird-blob-import.php                     14-Jun-2024 08:03                2713
function.fbird-blob-info.php                       14-Jun-2024 08:03                1819
function.fbird-blob-open.php                       14-Jun-2024 08:03                2495
function.fbird-close.php                           14-Jun-2024 08:03                2281
function.fbird-commit-ret.php                      14-Jun-2024 08:03                1812
function.fbird-commit.php                          14-Jun-2024 08:03                1780
function.fbird-connect.php                         14-Jun-2024 08:03                2287
function.fbird-db-info.php                         14-Jun-2024 08:03                1793
function.fbird-delete-user.php                     14-Jun-2024 08:03                2355
function.fbird-drop-db.php                         14-Jun-2024 08:03                2303
function.fbird-errcode.php                         14-Jun-2024 08:03                2126
function.fbird-errmsg.php                          14-Jun-2024 08:03                2119
function.fbird-execute.php                         14-Jun-2024 08:03                2131
function.fbird-fetch-assoc.php                     14-Jun-2024 08:03                2371
function.fbird-fetch-object.php                    14-Jun-2024 08:03                2382
function.fbird-fetch-row.php                       14-Jun-2024 08:03                2359
function.fbird-field-info.php                      14-Jun-2024 08:03                2201
function.fbird-free-event-handler.php              14-Jun-2024 08:03                2305
function.fbird-free-query.php                      14-Jun-2024 08:03                1848
function.fbird-free-result.php                     14-Jun-2024 08:03                1833
function.fbird-gen-id.php                          14-Jun-2024 08:03                1790
function.fbird-maintain-db.php                     14-Jun-2024 08:03                1835
function.fbird-modify-user.php                     14-Jun-2024 08:03                2371
function.fbird-name-result.php                     14-Jun-2024 08:03                2354
function.fbird-num-fields.php                      14-Jun-2024 08:03                2190
function.fbird-num-params.php                      14-Jun-2024 08:03                2349
function.fbird-param-info.php                      14-Jun-2024 08:03                2354
function.fbird-pconnect.php                        14-Jun-2024 08:03                2304
function.fbird-prepare.php                         14-Jun-2024 08:03                1783
function.fbird-query.php                           14-Jun-2024 08:03                2620
function.fbird-restore.php                         14-Jun-2024 08:03                1790
function.fbird-rollback-ret.php                    14-Jun-2024 08:03                1842
function.fbird-rollback.php                        14-Jun-2024 08:03                1814
function.fbird-server-info.php                     14-Jun-2024 08:03                1845
function.fbird-service-attach.php                  14-Jun-2024 08:03                1884
function.fbird-service-detach.php                  14-Jun-2024 08:03                1896
function.fbird-set-event-handler.php               14-Jun-2024 08:03                2464
function.fbird-trans.php                           14-Jun-2024 08:03                1789
function.fbird-wait-event.php                      14-Jun-2024 08:03                2389
function.fclose.php                                14-Jun-2024 08:03                4501
function.fdatasync.php                             14-Jun-2024 08:03                6201
function.fdf-add-doc-javascript.php                14-Jun-2024 08:03                5817
function.fdf-add-template.php                      14-Jun-2024 08:03                2951
function.fdf-close.php                             14-Jun-2024 08:03                3179
function.fdf-create.php                            14-Jun-2024 08:03                5687
function.fdf-enum-values.php                       14-Jun-2024 08:03                2522
function.fdf-errno.php                             14-Jun-2024 08:03                2933
function.fdf-error.php                             14-Jun-2024 08:03                3327
function.fdf-get-ap.php                            14-Jun-2024 08:03                4590
function.fdf-get-attachment.php                    14-Jun-2024 08:03                6327
function.fdf-get-encoding.php                      14-Jun-2024 08:03                3589
function.fdf-get-file.php                          14-Jun-2024 08:03                3415
function.fdf-get-flags.php                         14-Jun-2024 08:03                2454
function.fdf-get-opt.php                           14-Jun-2024 08:03                2499
function.fdf-get-status.php                        14-Jun-2024 08:03                3414
function.fdf-get-value.php                         14-Jun-2024 08:03                4861
function.fdf-get-version.php                       14-Jun-2024 08:03                3835
function.fdf-header.php                            14-Jun-2024 08:03                2495
function.fdf-next-field-name.php                   14-Jun-2024 08:03                5682
function.fdf-open-string.php                       14-Jun-2024 08:03                5200
function.fdf-open.php                              14-Jun-2024 08:03                6113
function.fdf-remove-item.php                       14-Jun-2024 08:03                2485
function.fdf-save-string.php                       14-Jun-2024 08:03                6123
function.fdf-save.php                              14-Jun-2024 08:03                4239
function.fdf-set-ap.php                            14-Jun-2024 08:03                4788
function.fdf-set-encoding.php                      14-Jun-2024 08:03                4002
function.fdf-set-file.php                          14-Jun-2024 08:03                6930
function.fdf-set-flags.php                         14-Jun-2024 08:03                4604
function.fdf-set-javascript-action.php             14-Jun-2024 08:03                4800
function.fdf-set-on-import-javascript.php          14-Jun-2024 08:03                3249
function.fdf-set-opt.php                           14-Jun-2024 08:03                4893
function.fdf-set-status.php                        14-Jun-2024 08:03                3959
function.fdf-set-submit-form-action.php            14-Jun-2024 08:03                5088
function.fdf-set-target-frame.php                  14-Jun-2024 08:03                4068
function.fdf-set-value.php                         14-Jun-2024 08:03                5677
function.fdf-set-version.php                       14-Jun-2024 08:03                4167
function.fdiv.php                                  14-Jun-2024 08:03                6365
function.feof.php                                  14-Jun-2024 08:03                7810
function.fflush.php                                14-Jun-2024 08:03                5710
function.fgetc.php                                 14-Jun-2024 08:03                6636
function.fgetcsv.php                               14-Jun-2024 08:03               13401
function.fgets.php                                 14-Jun-2024 08:03                8809
function.fgetss.php                                14-Jun-2024 08:03                9706
function.file-exists.php                           14-Jun-2024 08:03                7468
function.file-get-contents.php                     14-Jun-2024 08:03               19343
function.file-put-contents.php                     14-Jun-2024 08:03               13758
function.file.php                                  14-Jun-2024 08:03               12547
function.fileatime.php                             14-Jun-2024 08:03                7313
function.filectime.php                             14-Jun-2024 08:03                7304
function.filegroup.php                             14-Jun-2024 08:03                6019
function.fileinode.php                             14-Jun-2024 08:03                5497
function.filemtime.php                             14-Jun-2024 08:03                6885
function.fileowner.php                             14-Jun-2024 08:03                5910
function.fileperms.php                             14-Jun-2024 08:03               16405
function.filesize.php                              14-Jun-2024 08:03                6038
function.filetype.php                              14-Jun-2024 08:03                7146
function.filter-has-var.php                        14-Jun-2024 08:03                3494
function.filter-id.php                             14-Jun-2024 08:03                3044
function.filter-input-array.php                    14-Jun-2024 08:03               13540
function.filter-input.php                          14-Jun-2024 08:03                8689
function.filter-list.php                           14-Jun-2024 08:03                3784
function.filter-var-array.php                      14-Jun-2024 08:03               12293
function.filter-var.php                            14-Jun-2024 08:03               14541
function.finfo-buffer.php                          14-Jun-2024 08:03                8633
function.finfo-close.php                           14-Jun-2024 08:03                3637
function.finfo-file.php                            14-Jun-2024 08:03                9253
function.finfo-open.php                            14-Jun-2024 08:03               10440
function.finfo-set-flags.php                       14-Jun-2024 08:03                4685
function.floatval.php                              14-Jun-2024 08:03                7230
function.flock.php                                 14-Jun-2024 08:03               13408
function.floor.php                                 14-Jun-2024 08:03                5098
function.flush.php                                 14-Jun-2024 08:03                4867
function.fmod.php                                  14-Jun-2024 08:03                5005
function.fnmatch.php                               14-Jun-2024 08:03               11633
function.fopen.php                                 14-Jun-2024 08:03               24274
function.forward-static-call-array.php             14-Jun-2024 08:03                9622
function.forward-static-call.php                   14-Jun-2024 08:03                9025
function.fpassthru.php                             14-Jun-2024 08:03                7413
function.fpm-get-status.php                        14-Jun-2024 08:03                2911
function.fprintf.php                               14-Jun-2024 08:03               24182
function.fputcsv.php                               14-Jun-2024 08:03               10712
function.fputs.php                                 14-Jun-2024 08:03                1706
function.fread.php                                 14-Jun-2024 08:03               15138
function.frenchtojd.php                            14-Jun-2024 08:03                4471
function.fscanf.php                                14-Jun-2024 08:03                9742
function.fseek.php                                 14-Jun-2024 08:03                8069
function.fsockopen.php                             14-Jun-2024 08:03               17638
function.fstat.php                                 14-Jun-2024 08:03                6297
function.fsync.php                                 14-Jun-2024 08:03                5964
function.ftell.php                                 14-Jun-2024 08:03                6393
function.ftok.php                                  14-Jun-2024 08:03                3836
function.ftp-alloc.php                             14-Jun-2024 08:03                8735
function.ftp-append.php                            14-Jun-2024 08:03                4693
function.ftp-cdup.php                              14-Jun-2024 08:03                6762
function.ftp-chdir.php                             14-Jun-2024 08:03                7690
function.ftp-chmod.php                             14-Jun-2024 08:03                7584
function.ftp-close.php                             14-Jun-2024 08:03                6136
function.ftp-connect.php                           14-Jun-2024 08:03                6797
function.ftp-delete.php                            14-Jun-2024 08:03                6393
function.ftp-exec.php                              14-Jun-2024 08:03                6925
function.ftp-fget.php                              14-Jun-2024 08:03               10393
function.ftp-fput.php                              14-Jun-2024 08:03                9834
function.ftp-get-option.php                        14-Jun-2024 08:03                6352
function.ftp-get.php                               14-Jun-2024 08:03                9718
function.ftp-login.php                             14-Jun-2024 08:03                7187
function.ftp-mdtm.php                              14-Jun-2024 08:03                7325
function.ftp-mkdir.php                             14-Jun-2024 08:03                7183
function.ftp-mlsd.php                              14-Jun-2024 08:03                9289
function.ftp-nb-continue.php                       14-Jun-2024 08:03                5773
function.ftp-nb-fget.php                           14-Jun-2024 08:03               10888
function.ftp-nb-fput.php                           14-Jun-2024 08:03               10672
function.ftp-nb-get.php                            14-Jun-2024 08:03               14746
function.ftp-nb-put.php                            14-Jun-2024 08:03               12038
function.ftp-nlist.php                             14-Jun-2024 08:03                7062
function.ftp-pasv.php                              14-Jun-2024 08:03                7493
function.ftp-put.php                               14-Jun-2024 08:03                9415
function.ftp-pwd.php                               14-Jun-2024 08:03                6133
function.ftp-quit.php                              14-Jun-2024 08:03                1690
function.ftp-raw.php                               14-Jun-2024 08:03                5776
function.ftp-rawlist.php                           14-Jun-2024 08:03                8396
function.ftp-rename.php                            14-Jun-2024 08:03                7466
function.ftp-rmdir.php                             14-Jun-2024 08:03                6776
function.ftp-set-option.php                        14-Jun-2024 08:03                7644
function.ftp-site.php                              14-Jun-2024 08:03                6955
function.ftp-size.php                              14-Jun-2024 08:03                6988
function.ftp-ssl-connect.php                       14-Jun-2024 08:03                9256
function.ftp-systype.php                           14-Jun-2024 08:03                5704
function.ftruncate.php                             14-Jun-2024 08:03                6701
function.func-get-arg.php                          14-Jun-2024 08:03               11597
function.func-get-args.php                         14-Jun-2024 08:03               12241
function.func-num-args.php                         14-Jun-2024 08:03                6273
function.function-exists.php                       14-Jun-2024 08:03                6357
function.fwrite.php                                14-Jun-2024 08:03               14949
function.gc-collect-cycles.php                     14-Jun-2024 08:03                2768
function.gc-disable.php                            14-Jun-2024 08:03                2661
function.gc-enable.php                             14-Jun-2024 08:03                2626
function.gc-enabled.php                            14-Jun-2024 08:03                3463
function.gc-mem-caches.php                         14-Jun-2024 08:03                2622
function.gc-status.php                             14-Jun-2024 08:03                8943                               14-Jun-2024 08:03                9143
function.geoip-asnum-by-name.php                   14-Jun-2024 08:03                4354
function.geoip-continent-code-by-name.php          14-Jun-2024 08:03                5862
function.geoip-country-code-by-name.php            14-Jun-2024 08:03                5635
function.geoip-country-code3-by-name.php           14-Jun-2024 08:03                5157
function.geoip-country-name-by-name.php            14-Jun-2024 08:03                5120
function.geoip-database-info.php                   14-Jun-2024 08:03                4487
function.geoip-db-avail.php                        14-Jun-2024 08:03                4781
function.geoip-db-filename.php                     14-Jun-2024 08:03                4451
function.geoip-db-get-all-info.php                 14-Jun-2024 08:03                7159
function.geoip-domain-by-name.php                  14-Jun-2024 08:03                4623
function.geoip-id-by-name.php                      14-Jun-2024 08:03                5655
function.geoip-isp-by-name.php                     14-Jun-2024 08:03                4603
function.geoip-netspeedcell-by-name.php            14-Jun-2024 08:03                5478
function.geoip-org-by-name.php                     14-Jun-2024 08:03                4744
function.geoip-record-by-name.php                  14-Jun-2024 08:03                8502
function.geoip-region-by-name.php                  14-Jun-2024 08:03                5306
function.geoip-region-name-by-code.php             14-Jun-2024 08:03                7397
function.geoip-setup-custom-directory.php          14-Jun-2024 08:03                4388
function.geoip-time-zone-by-country-and-region.php 14-Jun-2024 08:03                7598
function.get-browser.php                           14-Jun-2024 08:03                8924
function.get-called-class.php                      14-Jun-2024 08:03                6471
function.get-cfg-var.php                           14-Jun-2024 08:03                4035
function.get-class-methods.php                     14-Jun-2024 08:03                7128
function.get-class-vars.php                        14-Jun-2024 08:03                9872
function.get-class.php                             14-Jun-2024 08:03               12914
function.get-current-user.php                      14-Jun-2024 08:03                4554
function.get-debug-type.php                        14-Jun-2024 08:03                9566
function.get-declared-classes.php                  14-Jun-2024 08:03                5409
function.get-declared-interfaces.php               14-Jun-2024 08:03                4425
function.get-declared-traits.php                   14-Jun-2024 08:03                2938
function.get-defined-constants.php                 14-Jun-2024 08:03                7696
function.get-defined-functions.php                 14-Jun-2024 08:03                7155
function.get-defined-vars.php                      14-Jun-2024 08:03                6401
function.get-extension-funcs.php                   14-Jun-2024 08:03                5662
function.get-headers.php                           14-Jun-2024 08:03                9516
function.get-html-translation-table.php            14-Jun-2024 08:03               14552
function.get-include-path.php                      14-Jun-2024 08:03                4620
function.get-included-files.php                    14-Jun-2024 08:03                6160
function.get-loaded-extensions.php                 14-Jun-2024 08:03                5679
function.get-magic-quotes-gpc.php                  14-Jun-2024 08:03                4314
function.get-magic-quotes-runtime.php              14-Jun-2024 08:03                3812
function.get-mangled-object-vars.php               14-Jun-2024 08:03                8331
function.get-meta-tags.php                         14-Jun-2024 08:03                8397
function.get-object-vars.php                       14-Jun-2024 08:03                6321
function.get-parent-class.php                      14-Jun-2024 08:03                7856
function.get-required-files.php                    14-Jun-2024 08:03                1882
function.get-resource-id.php                       14-Jun-2024 08:03                4965
function.get-resource-type.php                     14-Jun-2024 08:03                5450
function.get-resources.php                         14-Jun-2024 08:03                8083
function.getallheaders.php                         14-Jun-2024 08:03                4868
function.getcwd.php                                14-Jun-2024 08:03                5537
function.getdate.php                               14-Jun-2024 08:03                9764
function.getenv.php                                14-Jun-2024 08:03                9073
function.gethostbyaddr.php                         14-Jun-2024 08:03                4518
function.gethostbyname.php                         14-Jun-2024 08:03                4534
function.gethostbynamel.php                        14-Jun-2024 08:03                5062
function.gethostname.php                           14-Jun-2024 08:03                4026
function.getimagesize.php                          14-Jun-2024 08:03               17565
function.getimagesizefromstring.php                14-Jun-2024 08:03                5857
function.getlastmod.php                            14-Jun-2024 08:03                5398
function.getmxrr.php                               14-Jun-2024 08:03                6068
function.getmygid.php                              14-Jun-2024 08:03                3549
function.getmyinode.php                            14-Jun-2024 08:03                3640
function.getmypid.php                              14-Jun-2024 08:03                3966
function.getmyuid.php                              14-Jun-2024 08:03                3555
function.getopt.php                                14-Jun-2024 08:03               15646
function.getprotobyname.php                        14-Jun-2024 08:03                4803
function.getprotobynumber.php                      14-Jun-2024 08:03                3520
function.getrandmax.php                            14-Jun-2024 08:03                3126
function.getrusage.php                             14-Jun-2024 08:03               11720
function.getservbyname.php                         14-Jun-2024 08:03                6641
function.getservbyport.php                         14-Jun-2024 08:03                4009
function.gettext.php                               14-Jun-2024 08:03                6008
function.gettimeofday.php                          14-Jun-2024 08:03                5082
function.gettype.php                               14-Jun-2024 08:03                9312
function.glob.php                                  14-Jun-2024 08:03               11574
function.gmdate.php                                14-Jun-2024 08:03                7902
function.gmmktime.php                              14-Jun-2024 08:03               11868
function.gmp-abs.php                               14-Jun-2024 08:03                4565
function.gmp-add.php                               14-Jun-2024 08:03                4955
function.gmp-and.php                               14-Jun-2024 08:03                5391
function.gmp-binomial.php                          14-Jun-2024 08:03                4131
function.gmp-clrbit.php                            14-Jun-2024 08:03                5609
function.gmp-cmp.php                               14-Jun-2024 08:03                5805
function.gmp-com.php                               14-Jun-2024 08:03                4069
function.gmp-div-q.php                             14-Jun-2024 08:03               10326
function.gmp-div-qr.php                            14-Jun-2024 08:03                6821
function.gmp-div-r.php                             14-Jun-2024 08:03                6325
function.gmp-div.php                               14-Jun-2024 08:03                1709
function.gmp-divexact.php                          14-Jun-2024 08:03                5994
function.gmp-export.php                            14-Jun-2024 08:03                5833
function.gmp-fact.php                              14-Jun-2024 08:03                4924
function.gmp-gcd.php                               14-Jun-2024 08:03                5412
function.gmp-gcdext.php                            14-Jun-2024 08:03                9558
function.gmp-hamdist.php                           14-Jun-2024 08:03                6718
function.gmp-import.php                            14-Jun-2024 08:03                6128
function.gmp-init.php                              14-Jun-2024 08:03                5953
function.gmp-intval.php                            14-Jun-2024 08:03                5425
function.gmp-invert.php                            14-Jun-2024 08:03                5539
function.gmp-jacobi.php                            14-Jun-2024 08:03                5822
function.gmp-kronecker.php                         14-Jun-2024 08:03                4159
function.gmp-lcm.php                               14-Jun-2024 08:03                3925
function.gmp-legendre.php                          14-Jun-2024 08:03                5835
function.gmp-mod.php                               14-Jun-2024 08:03                5042
function.gmp-mul.php                               14-Jun-2024 08:03                5137
function.gmp-neg.php                               14-Jun-2024 08:03                4593
function.gmp-nextprime.php                         14-Jun-2024 08:03                5258
function.gmp-or.php                                14-Jun-2024 08:03                5642
function.gmp-perfect-power.php                     14-Jun-2024 08:03                3504
function.gmp-perfect-square.php                    14-Jun-2024 08:03                5763
function.gmp-popcount.php                          14-Jun-2024 08:03                5053
function.gmp-pow.php                               14-Jun-2024 08:03                5929
function.gmp-powm.php                              14-Jun-2024 08:03                6042
function.gmp-prob-prime.php                        14-Jun-2024 08:03                6101
function.gmp-random-bits.php                       14-Jun-2024 08:03                6254
function.gmp-random-range.php                      14-Jun-2024 08:03                7606
function.gmp-random-seed.php                       14-Jun-2024 08:03                7773
function.gmp-random.php                            14-Jun-2024 08:03                6593
function.gmp-root.php                              14-Jun-2024 08:03                3351
function.gmp-rootrem.php                           14-Jun-2024 08:03                3508
function.gmp-scan0.php                             14-Jun-2024 08:03                5728
function.gmp-scan1.php                             14-Jun-2024 08:03                5749
function.gmp-setbit.php                            14-Jun-2024 08:03               11965
function.gmp-sign.php                              14-Jun-2024 08:03                5224
function.gmp-sqrt.php                              14-Jun-2024 08:03                5107
function.gmp-sqrtrem.php                           14-Jun-2024 08:03                6577
function.gmp-strval.php                            14-Jun-2024 08:03                4898
function.gmp-sub.php                               14-Jun-2024 08:03                5210
function.gmp-testbit.php                           14-Jun-2024 08:03                6230
function.gmp-xor.php                               14-Jun-2024 08:03                5656
function.gmstrftime.php                            14-Jun-2024 08:03                9649
function.gnupg-adddecryptkey.php                   14-Jun-2024 08:03                5553
function.gnupg-addencryptkey.php                   14-Jun-2024 08:03                5050
function.gnupg-addsignkey.php                      14-Jun-2024 08:03                5565
function.gnupg-cleardecryptkeys.php                14-Jun-2024 08:03                4603
function.gnupg-clearencryptkeys.php                14-Jun-2024 08:03                4606
function.gnupg-clearsignkeys.php                   14-Jun-2024 08:03                4547
function.gnupg-decrypt.php                         14-Jun-2024 08:03                6308
function.gnupg-decryptverify.php                   14-Jun-2024 08:03                7431
function.gnupg-deletekey.php                       14-Jun-2024 08:03                5284
function.gnupg-encrypt.php                         14-Jun-2024 08:03                6161
function.gnupg-encryptsign.php                     14-Jun-2024 08:03                7056
function.gnupg-export.php                          14-Jun-2024 08:03                5371
function.gnupg-getengineinfo.php                   14-Jun-2024 08:03                5666
function.gnupg-geterror.php                        14-Jun-2024 08:03                4520
function.gnupg-geterrorinfo.php                    14-Jun-2024 08:03                5769
function.gnupg-getprotocol.php                     14-Jun-2024 08:03                4583
function.gnupg-gettrustlist.php                    14-Jun-2024 08:03                5350
function.gnupg-import.php                          14-Jun-2024 08:03                5654
function.gnupg-init.php                            14-Jun-2024 08:03                7555
function.gnupg-keyinfo.php                         14-Jun-2024 08:03                5579
function.gnupg-listsignatures.php                  14-Jun-2024 08:03                5574
function.gnupg-setarmor.php                        14-Jun-2024 08:03                5871
function.gnupg-seterrormode.php                    14-Jun-2024 08:03                5869
function.gnupg-setsignmode.php                     14-Jun-2024 08:03                5956
function.gnupg-sign.php                            14-Jun-2024 08:03                6414
function.gnupg-verify.php                          14-Jun-2024 08:03                8714
function.grapheme-extract.php                      14-Jun-2024 08:03                9083
function.grapheme-stripos.php                      14-Jun-2024 08:03                8384
function.grapheme-stristr.php                      14-Jun-2024 08:03                7999
function.grapheme-strlen.php                       14-Jun-2024 08:03                5722
function.grapheme-strpos.php                       14-Jun-2024 08:03                8016
function.grapheme-strripos.php                     14-Jun-2024 08:03                7788
function.grapheme-strrpos.php                      14-Jun-2024 08:03                7473
function.grapheme-strstr.php                       14-Jun-2024 08:03                7680
function.grapheme-substr.php                       14-Jun-2024 08:03                8339
function.gregoriantojd.php                         14-Jun-2024 08:03                8170
function.gzclose.php                               14-Jun-2024 08:03                4544
function.gzcompress.php                            14-Jun-2024 08:03                6325
function.gzdecode.php                              14-Jun-2024 08:03                4036
function.gzdeflate.php                             14-Jun-2024 08:03                5898
function.gzencode.php                              14-Jun-2024 08:03                7325
function.gzeof.php                                 14-Jun-2024 08:03                4413
function.gzfile.php                                14-Jun-2024 08:03                5050
function.gzgetc.php                                14-Jun-2024 08:03                4992
function.gzgets.php                                14-Jun-2024 08:03                6642
function.gzgetss.php                               14-Jun-2024 08:03                6454
function.gzinflate.php                             14-Jun-2024 08:03                5713
function.gzopen.php                                14-Jun-2024 08:03                6047
function.gzpassthru.php                            14-Jun-2024 08:03                5019
function.gzputs.php                                14-Jun-2024 08:03                1675
function.gzread.php                                14-Jun-2024 08:03                7036
function.gzrewind.php                              14-Jun-2024 08:03                3478
function.gzseek.php                                14-Jun-2024 08:03                6754
function.gztell.php                                14-Jun-2024 08:03                3657
function.gzuncompress.php                          14-Jun-2024 08:03                5656
function.gzwrite.php                               14-Jun-2024 08:03                6952
function.halt-compiler.php                         14-Jun-2024 08:03                4950
function.hash-algos.php                            14-Jun-2024 08:03                5872
function.hash-copy.php                             14-Jun-2024 08:03                5653
function.hash-equals.php                           14-Jun-2024 08:03                7595
function.hash-file.php                             14-Jun-2024 08:03                8183
function.hash-final.php                            14-Jun-2024 08:03                5246
function.hash-hkdf.php                             14-Jun-2024 08:03               10413
function.hash-hmac-algos.php                       14-Jun-2024 08:03                5466
function.hash-hmac-file.php                        14-Jun-2024 08:03                9216
function.hash-hmac.php                             14-Jun-2024 08:03                8744
function.hash-init.php                             14-Jun-2024 08:03               11258
function.hash-update-file.php                      14-Jun-2024 08:03                6202
function.hash-update-stream.php                    14-Jun-2024 08:03                7685
function.hash-update.php                           14-Jun-2024 08:03                4601
function.hash.php                                  14-Jun-2024 08:03                7853
function.header-register-callback.php              14-Jun-2024 08:03                7083
function.header-remove.php                         14-Jun-2024 08:03                7159
function.header.php                                14-Jun-2024 08:03               20359
function.headers-list.php                          14-Jun-2024 08:03                6242
function.headers-sent.php                          14-Jun-2024 08:03                8448
function.hebrev.php                                14-Jun-2024 08:03                3519
function.hebrevc.php                               14-Jun-2024 08:03                4059
function.hex2bin.php                               14-Jun-2024 08:03                5275
function.hexdec.php                                14-Jun-2024 08:03                6757
function.highlight-file.php                        14-Jun-2024 08:03                6537
function.highlight-string.php                      14-Jun-2024 08:03                7429
function.hrtime.php                                14-Jun-2024 08:03                5282
function.html-entity-decode.php                    14-Jun-2024 08:03               15409
function.htmlentities.php                          14-Jun-2024 08:03               18438
function.htmlspecialchars-decode.php               14-Jun-2024 08:03                9822
function.htmlspecialchars.php                      14-Jun-2024 08:03               23807
function.http-build-query.php                      14-Jun-2024 08:03               20400
function.http-response-code.php                    14-Jun-2024 08:03                7254
function.hypot.php                                 14-Jun-2024 08:03                3161
function.ibase-add-user.php                        14-Jun-2024 08:03                5476
function.ibase-affected-rows.php                   14-Jun-2024 08:03                3673
function.ibase-backup.php                          14-Jun-2024 08:03               11045
function.ibase-blob-add.php                        14-Jun-2024 08:03                4250
function.ibase-blob-cancel.php                     14-Jun-2024 08:03                4097
function.ibase-blob-close.php                      14-Jun-2024 08:03                4304
function.ibase-blob-create.php                     14-Jun-2024 08:03                4315
function.ibase-blob-echo.php                       14-Jun-2024 08:03                4522
function.ibase-blob-get.php                        14-Jun-2024 08:03                6884
function.ibase-blob-import.php                     14-Jun-2024 08:03                8444
function.ibase-blob-info.php                       14-Jun-2024 08:03                3720
function.ibase-blob-open.php                       14-Jun-2024 08:03                4649
function.ibase-close.php                           14-Jun-2024 08:03                4037
function.ibase-commit-ret.php                      14-Jun-2024 08:03                3465
function.ibase-commit.php                          14-Jun-2024 08:03                3401
function.ibase-connect.php                         14-Jun-2024 08:03               11064
function.ibase-db-info.php                         14-Jun-2024 08:03                2797
function.ibase-delete-user.php                     14-Jun-2024 08:03                3804
function.ibase-drop-db.php                         14-Jun-2024 08:03                3925
function.ibase-errcode.php                         14-Jun-2024 08:03                2849
function.ibase-errmsg.php                          14-Jun-2024 08:03                2826
function.ibase-execute.php                         14-Jun-2024 08:03                7182
function.ibase-fetch-assoc.php                     14-Jun-2024 08:03                4818
function.ibase-fetch-object.php                    14-Jun-2024 08:03                6806
function.ibase-fetch-row.php                       14-Jun-2024 08:03                4692
function.ibase-field-info.php                      14-Jun-2024 08:03                7086
function.ibase-free-event-handler.php              14-Jun-2024 08:03                3730
function.ibase-free-query.php                      14-Jun-2024 08:03                2969
function.ibase-free-result.php                     14-Jun-2024 08:03                3044
function.ibase-gen-id.php                          14-Jun-2024 08:03                3071
function.ibase-maintain-db.php                     14-Jun-2024 08:03                3251
function.ibase-modify-user.php                     14-Jun-2024 08:03                5456
function.ibase-name-result.php                     14-Jun-2024 08:03                5978
function.ibase-num-fields.php                      14-Jun-2024 08:03                6560
function.ibase-num-params.php                      14-Jun-2024 08:03                3742
function.ibase-param-info.php                      14-Jun-2024 08:03                3881
function.ibase-pconnect.php                        14-Jun-2024 08:03                8289
function.ibase-prepare.php                         14-Jun-2024 08:03                4804
function.ibase-query.php                           14-Jun-2024 08:03                7732
function.ibase-restore.php                         14-Jun-2024 08:03               11252
function.ibase-rollback-ret.php                    14-Jun-2024 08:03                3561
function.ibase-rollback.php                        14-Jun-2024 08:03                3389
function.ibase-server-info.php                     14-Jun-2024 08:03                9986
function.ibase-service-attach.php                  14-Jun-2024 08:03               11309
function.ibase-service-detach.php                  14-Jun-2024 08:03                6300
function.ibase-set-event-handler.php               14-Jun-2024 08:03                8325
function.ibase-trans.php                           14-Jun-2024 08:03                6246
function.ibase-wait-event.php                      14-Jun-2024 08:03                4544
function.iconv-get-encoding.php                    14-Jun-2024 08:03                5943
function.iconv-mime-decode-headers.php             14-Jun-2024 08:03               10769
function.iconv-mime-decode.php                     14-Jun-2024 08:03                8540
function.iconv-mime-encode.php                     14-Jun-2024 08:03               12471
function.iconv-set-encoding.php                    14-Jun-2024 08:03                5081
function.iconv-strlen.php                          14-Jun-2024 08:03                5362
function.iconv-strpos.php                          14-Jun-2024 08:03                8042
function.iconv-strrpos.php                         14-Jun-2024 08:03                7269
function.iconv-substr.php                          14-Jun-2024 08:03                9007
function.iconv.php                                 14-Jun-2024 08:03                9568
function.idate.php                                 14-Jun-2024 08:03               11790
function.idn-to-ascii.php                          14-Jun-2024 08:03                8143
function.idn-to-utf8.php                           14-Jun-2024 08:03                8184
function.igbinary-serialize.php                    14-Jun-2024 08:03               10338
function.igbinary-unserialize.php                  14-Jun-2024 08:03               10789
function.ignore-user-abort.php                     14-Jun-2024 08:03                8022
function.image-type-to-extension.php               14-Jun-2024 08:03                5711
function.image-type-to-mime-type.php               14-Jun-2024 08:03                9068
function.image2wbmp.php                            14-Jun-2024 08:03                6805
function.imageaffine.php                           14-Jun-2024 08:03                5041
function.imageaffinematrixconcat.php               14-Jun-2024 08:03                6830
function.imageaffinematrixget.php                  14-Jun-2024 08:03                6891
function.imagealphablending.php                    14-Jun-2024 08:03                7821
function.imageantialias.php                        14-Jun-2024 08:03               11241
function.imagearc.php                              14-Jun-2024 08:03               14080
function.imageavif.php                             14-Jun-2024 08:03                6534
function.imagebmp.php                              14-Jun-2024 08:03                8488
function.imagechar.php                             14-Jun-2024 08:03               10388
function.imagecharup.php                           14-Jun-2024 08:03               10190
function.imagecolorallocate.php                    14-Jun-2024 08:03               10233
function.imagecolorallocatealpha.php               14-Jun-2024 08:03               18440
function.imagecolorat.php                          14-Jun-2024 08:03               10555
function.imagecolorclosest.php                     14-Jun-2024 08:03               12423
function.imagecolorclosestalpha.php                14-Jun-2024 08:03               12981
function.imagecolorclosesthwb.php                  14-Jun-2024 08:03                6687
function.imagecolordeallocate.php                  14-Jun-2024 08:03                6070
function.imagecolorexact.php                       14-Jun-2024 08:03                8775
function.imagecolorexactalpha.php                  14-Jun-2024 08:03                9679
function.imagecolormatch.php                       14-Jun-2024 08:03                8708
function.imagecolorresolve.php                     14-Jun-2024 08:03                8011
function.imagecolorresolvealpha.php                14-Jun-2024 08:03                8786
function.imagecolorset.php                         14-Jun-2024 08:03                9090
function.imagecolorsforindex.php                   14-Jun-2024 08:03                7786
function.imagecolorstotal.php                      14-Jun-2024 08:03                6133
function.imagecolortransparent.php                 14-Jun-2024 08:03                9515
function.imageconvolution.php                      14-Jun-2024 08:03               12367
function.imagecopy.php                             14-Jun-2024 08:03                9702
function.imagecopymerge.php                        14-Jun-2024 08:03               10155
function.imagecopymergegray.php                    14-Jun-2024 08:03               10761
function.imagecopyresampled.php                    14-Jun-2024 08:03               19781
function.imagecopyresized.php                      14-Jun-2024 08:03               14768
function.imagecreate.php                           14-Jun-2024 08:03                8609
function.imagecreatefromavif.php                   14-Jun-2024 08:03                2993
function.imagecreatefrombmp.php                    14-Jun-2024 08:03                5888
function.imagecreatefromgd.php                     14-Jun-2024 08:03                6550
function.imagecreatefromgd2.php                    14-Jun-2024 08:03                6798
function.imagecreatefromgd2part.php                14-Jun-2024 08:03                9416
function.imagecreatefromgif.php                    14-Jun-2024 08:03               10212
function.imagecreatefromjpeg.php                   14-Jun-2024 08:03                9794
function.imagecreatefrompng.php                    14-Jun-2024 08:03                9737
function.imagecreatefromstring.php                 14-Jun-2024 08:03                8396
function.imagecreatefromtga.php                    14-Jun-2024 08:03                3686
function.imagecreatefromwbmp.php                   14-Jun-2024 08:03                9750
function.imagecreatefromwebp.php                   14-Jun-2024 08:03                6069
function.imagecreatefromxbm.php                    14-Jun-2024 08:03                5930
function.imagecreatefromxpm.php                    14-Jun-2024 08:03                6643
function.imagecreatetruecolor.php                  14-Jun-2024 08:03                7375
function.imagecrop.php                             14-Jun-2024 08:03                7676
function.imagecropauto.php                         14-Jun-2024 08:03               11277
function.imagedashedline.php                       14-Jun-2024 08:03               13141
function.imagedestroy.php                          14-Jun-2024 08:03                5363
function.imageellipse.php                          14-Jun-2024 08:03               10394
function.imagefill.php                             14-Jun-2024 08:03                7981
function.imagefilledarc.php                        14-Jun-2024 08:03               19393
function.imagefilledellipse.php                    14-Jun-2024 08:03               10056
function.imagefilledpolygon.php                    14-Jun-2024 08:03               12444
function.imagefilledrectangle.php                  14-Jun-2024 08:03                8743
function.imagefilltoborder.php                     14-Jun-2024 08:03               11835
function.imagefilter.php                           14-Jun-2024 08:03               34869
function.imageflip.php                             14-Jun-2024 08:03               10125
function.imagefontheight.php                       14-Jun-2024 08:03                6684
function.imagefontwidth.php                        14-Jun-2024 08:03                6663
function.imageftbbox.php                           14-Jun-2024 08:03               14713
function.imagefttext.php                           14-Jun-2024 08:03               16618
function.imagegammacorrect.php                     14-Jun-2024 08:03                6177
function.imagegd.php                               14-Jun-2024 08:03               11203
function.imagegd2.php                              14-Jun-2024 08:03               12146
function.imagegetclip.php                          14-Jun-2024 08:03                6274
function.imagegetinterpolation.php                 14-Jun-2024 08:03                3917
function.imagegif.php                              14-Jun-2024 08:03               17336
function.imagegrabscreen.php                       14-Jun-2024 08:03                5027
function.imagegrabwindow.php                       14-Jun-2024 08:03               10261
function.imageinterlace.php                        14-Jun-2024 08:03                7453
function.imageistruecolor.php                      14-Jun-2024 08:03                7557
function.imagejpeg.php                             14-Jun-2024 08:03               15583
function.imagelayereffect.php                      14-Jun-2024 08:03               12357
function.imageline.php                             14-Jun-2024 08:03               15818
function.imageloadfont.php                         14-Jun-2024 08:03                9609
function.imageopenpolygon.php                      14-Jun-2024 08:03               10770
function.imagepalettecopy.php                      14-Jun-2024 08:03                7651
function.imagepalettetotruecolor.php               14-Jun-2024 08:03               10056
function.imagepng.php                              14-Jun-2024 08:03                9621
function.imagepolygon.php                          14-Jun-2024 08:03               11070
function.imagerectangle.php                        14-Jun-2024 08:03               10891
function.imageresolution.php                       14-Jun-2024 08:03                8238
function.imagerotate.php                           14-Jun-2024 08:03                9726
function.imagesavealpha.php                        14-Jun-2024 08:03                8116
function.imagescale.php                            14-Jun-2024 08:03                7267
function.imagesetbrush.php                         14-Jun-2024 08:03                9713
function.imagesetclip.php                          14-Jun-2024 08:03                5484
function.imagesetinterpolation.php                 14-Jun-2024 08:03               11984
function.imagesetpixel.php                         14-Jun-2024 08:03               11730
function.imagesetstyle.php                         14-Jun-2024 08:03               12724
function.imagesetthickness.php                     14-Jun-2024 08:03                8787
function.imagesettile.php                          14-Jun-2024 08:03                9156
function.imagestring.php                           14-Jun-2024 08:03               10551
function.imagestringup.php                         14-Jun-2024 08:03                9825
function.imagesx.php                               14-Jun-2024 08:03                5254
function.imagesy.php                               14-Jun-2024 08:03                5262
function.imagetruecolortopalette.php               14-Jun-2024 08:03                7137
function.imagettfbbox.php                          14-Jun-2024 08:03               20112
function.imagettftext.php                          14-Jun-2024 08:03               19161
function.imagetypes.php                            14-Jun-2024 08:03                5345
function.imagewbmp.php                             14-Jun-2024 08:03               15681
function.imagewebp.php                             14-Jun-2024 08:03                7852
function.imagexbm.php                              14-Jun-2024 08:03               12327
function.imap-8bit.php                             14-Jun-2024 08:03                3299
function.imap-alerts.php                           14-Jun-2024 08:03                3357
function.imap-append.php                           14-Jun-2024 08:03                9992
function.imap-base64.php                           14-Jun-2024 08:03                3708
function.imap-binary.php                           14-Jun-2024 08:03                3268
function.imap-body.php                             14-Jun-2024 08:03                5836
function.imap-bodystruct.php                       14-Jun-2024 08:03                4833
function.imap-check.php                            14-Jun-2024 08:03                6294
function.imap-clearflag-full.php                   14-Jun-2024 08:03                6821
function.imap-close.php                            14-Jun-2024 08:03                5222
function.imap-create.php                           14-Jun-2024 08:03                1780
function.imap-createmailbox.php                    14-Jun-2024 08:03               14307
function.imap-delete.php                           14-Jun-2024 08:03               10853
function.imap-deletemailbox.php                    14-Jun-2024 08:03                5174
function.imap-errors.php                           14-Jun-2024 08:03                3591
function.imap-expunge.php                          14-Jun-2024 08:03                3714
function.imap-fetch-overview.php                   14-Jun-2024 08:03               11566
function.imap-fetchbody.php                        14-Jun-2024 08:03                6636
function.imap-fetchheader.php                      14-Jun-2024 08:03                6095
function.imap-fetchmime.php                        14-Jun-2024 08:03                6725
function.imap-fetchstructure.php                   14-Jun-2024 08:03                9925
function.imap-fetchtext.php                        14-Jun-2024 08:03                1761
function.imap-gc.php                               14-Jun-2024 08:03                6036
function.imap-get-quota.php                        14-Jun-2024 08:03               12731
function.imap-get-quotaroot.php                    14-Jun-2024 08:03                9450
function.imap-getacl.php                           14-Jun-2024 08:03                6194
function.imap-getmailboxes.php                     14-Jun-2024 08:03               12779
function.imap-getsubscribed.php                    14-Jun-2024 08:03                8473
function.imap-header.php                           14-Jun-2024 08:03                1983
function.imap-headerinfo.php                       14-Jun-2024 08:03               14220
function.imap-headers.php                          14-Jun-2024 08:03                3643
function.imap-is-open.php                          14-Jun-2024 08:03                4262
function.imap-last-error.php                       14-Jun-2024 08:03                3315
function.imap-list.php                             14-Jun-2024 08:03                9010
function.imap-listmailbox.php                      14-Jun-2024 08:03                1766
function.imap-listscan.php                         14-Jun-2024 08:03                7263
function.imap-listsubscribed.php                   14-Jun-2024 08:03                1787
function.imap-lsub.php                             14-Jun-2024 08:03                6355
function.imap-mail-compose.php                     14-Jun-2024 08:03               16737
function.imap-mail-copy.php                        14-Jun-2024 08:03                6625
function.imap-mail-move.php                        14-Jun-2024 08:03                7098
function.imap-mail.php                             14-Jun-2024 08:03                7692
function.imap-mailboxmsginfo.php                   14-Jun-2024 08:03                9633
function.imap-mime-header-decode.php               14-Jun-2024 08:03                6572
function.imap-msgno.php                            14-Jun-2024 08:03                4259
function.imap-mutf7-to-utf8.php                    14-Jun-2024 08:03                3603
function.imap-num-msg.php                          14-Jun-2024 08:03                4302
function.imap-num-recent.php                       14-Jun-2024 08:03                4091
function.imap-open.php                             14-Jun-2024 08:03               22898
function.imap-ping.php                             14-Jun-2024 08:03                5085
function.imap-qprint.php                           14-Jun-2024 08:03                3391
function.imap-rename.php                           14-Jun-2024 08:03                1783
function.imap-renamemailbox.php                    14-Jun-2024 08:03                6066
function.imap-reopen.php                           14-Jun-2024 08:03                9082
function.imap-rfc822-parse-adrlist.php             14-Jun-2024 08:03                8250
function.imap-rfc822-parse-headers.php             14-Jun-2024 08:03                3880
function.imap-rfc822-write-address.php             14-Jun-2024 08:03                5497
function.imap-savebody.php                         14-Jun-2024 08:03                7128
function.imap-scan.php                             14-Jun-2024 08:03                1748
function.imap-scanmailbox.php                      14-Jun-2024 08:03                1778
function.imap-search.php                           14-Jun-2024 08:03               14045
function.imap-set-quota.php                        14-Jun-2024 08:03                7235
function.imap-setacl.php                           14-Jun-2024 08:03                5868
function.imap-setflag-full.php                     14-Jun-2024 08:03                8962
function.imap-sort.php                             14-Jun-2024 08:03                9049
function.imap-status.php                           14-Jun-2024 08:03               11147
function.imap-subscribe.php                        14-Jun-2024 08:03                4699
function.imap-thread.php                           14-Jun-2024 08:03                8080
function.imap-timeout.php                          14-Jun-2024 08:03                4892
function.imap-uid.php                              14-Jun-2024 08:03                4802
function.imap-undelete.php                         14-Jun-2024 08:03                5193
function.imap-unsubscribe.php                      14-Jun-2024 08:03                4787
function.imap-utf7-decode.php                      14-Jun-2024 08:03                3989
function.imap-utf7-encode.php                      14-Jun-2024 08:03                3481
function.imap-utf8-to-mutf7.php                    14-Jun-2024 08:03                3613
function.imap-utf8.php                             14-Jun-2024 08:03                4441
function.implode.php                               14-Jun-2024 08:03                8102                              14-Jun-2024 08:03               12100
function.include-once.php                          14-Jun-2024 08:03                2352
function.include.php                               14-Jun-2024 08:03               21097
function.inet-ntop.php                             14-Jun-2024 08:03                6501
function.inet-pton.php                             14-Jun-2024 08:03                4991
function.inflate-add.php                           14-Jun-2024 08:03                6310
function.inflate-get-read-len.php                  14-Jun-2024 08:03                3519
function.inflate-get-status.php                    14-Jun-2024 08:03                3287
function.inflate-init.php                          14-Jun-2024 08:03                7131
function.ini-alter.php                             14-Jun-2024 08:03                1740
function.ini-get-all.php                           14-Jun-2024 08:03               10732
function.ini-get.php                               14-Jun-2024 08:03               10991
function.ini-parse-quantity.php                    14-Jun-2024 08:03                7646
function.ini-restore.php                           14-Jun-2024 08:03                6560
function.ini-set.php                               14-Jun-2024 08:03                7103
function.inotify-add-watch.php                     14-Jun-2024 08:03                4636
function.inotify-init.php                          14-Jun-2024 08:03                9148
function.inotify-queue-len.php                     14-Jun-2024 08:03                3789
function.inotify-read.php                          14-Jun-2024 08:03                4514
function.inotify-rm-watch.php                      14-Jun-2024 08:03                3777
function.intdiv.php                                14-Jun-2024 08:03                7586
function.interface-exists.php                      14-Jun-2024 08:03                5586
function.intl-error-name.php                       14-Jun-2024 08:03                5150
function.intl-get-error-code.php                   14-Jun-2024 08:03                4720
function.intl-get-error-message.php                14-Jun-2024 08:03                4690
function.intl-is-failure.php                       14-Jun-2024 08:03                5617
function.intval.php                                14-Jun-2024 08:03               14284
function.ip2long.php                               14-Jun-2024 08:03                9510
function.iptcembed.php                             14-Jun-2024 08:03               12131
function.iptcparse.php                             14-Jun-2024 08:03                4822                                  14-Jun-2024 08:03                7191                              14-Jun-2024 08:03                5997                               14-Jun-2024 08:03                5727                           14-Jun-2024 08:03               11363                          14-Jun-2024 08:03                6454                                14-Jun-2024 08:03                6858                             14-Jun-2024 08:03                1726                         14-Jun-2024 08:03                6741                               14-Jun-2024 08:03                6292                             14-Jun-2024 08:03                6290                              14-Jun-2024 08:03                6786                           14-Jun-2024 08:03                5384                                14-Jun-2024 08:03                6802                            14-Jun-2024 08:03                1719                           14-Jun-2024 08:03                5933                               14-Jun-2024 08:03                5852                               14-Jun-2024 08:03                1700                                14-Jun-2024 08:03                6667                               14-Jun-2024 08:03                6247                            14-Jun-2024 08:03               12380                             14-Jun-2024 08:03                7319                           14-Jun-2024 08:03                6703                               14-Jun-2024 08:03                1903                           14-Jun-2024 08:03                5252                             14-Jun-2024 08:03                8311                         14-Jun-2024 08:03                8280                             14-Jun-2024 08:03                6821                        14-Jun-2024 08:03               13027                            14-Jun-2024 08:03                2581                      14-Jun-2024 08:03                7011                           14-Jun-2024 08:03                6286                          14-Jun-2024 08:03                1785
function.isset.php                                 14-Jun-2024 08:03               16489
function.iterator-apply.php                        14-Jun-2024 08:03                7023
function.iterator-count.php                        14-Jun-2024 08:03                8939
function.iterator-to-array.php                     14-Jun-2024 08:03                8221
function.jddayofweek.php                           14-Jun-2024 08:03                4172
function.jdmonthname.php                           14-Jun-2024 08:03                5054
function.jdtofrench.php                            14-Jun-2024 08:03                3469
function.jdtogregorian.php                         14-Jun-2024 08:03                3485
function.jdtojewish.php                            14-Jun-2024 08:03                7920
function.jdtojulian.php                            14-Jun-2024 08:03                3443
function.jdtounix.php                              14-Jun-2024 08:03                4727
function.jewishtojd.php                            14-Jun-2024 08:03                4925
function.join.php                                  14-Jun-2024 08:03                1706
function.jpeg2wbmp.php                             14-Jun-2024 08:03                6826
function.json-decode.php                           14-Jun-2024 08:03               23281
function.json-encode.php                           14-Jun-2024 08:03               31727
function.json-last-error-msg.php                   14-Jun-2024 08:03                3561
function.json-last-error.php                       14-Jun-2024 08:03               14395
function.json-validate.php                         14-Jun-2024 08:03                8765
function.juliantojd.php                            14-Jun-2024 08:03                4909
function.key-exists.php                            14-Jun-2024 08:03                1757
function.key.php                                   14-Jun-2024 08:03                8155
function.krsort.php                                14-Jun-2024 08:03                9134
function.ksort.php                                 14-Jun-2024 08:03               11101
function.lcfirst.php                               14-Jun-2024 08:03                6031
function.lcg-value.php                             14-Jun-2024 08:03                5749
function.lchgrp.php                                14-Jun-2024 08:03                6252
function.lchown.php                                14-Jun-2024 08:03                6094
function.ldap-8859-to-t61.php                      14-Jun-2024 08:03                3453
function.ldap-add-ext.php                          14-Jun-2024 08:03                5973
function.ldap-add.php                              14-Jun-2024 08:03               10630
function.ldap-bind-ext.php                         14-Jun-2024 08:03                6222
function.ldap-bind.php                             14-Jun-2024 08:03                9886
function.ldap-close.php                            14-Jun-2024 08:03                1727
function.ldap-compare.php                          14-Jun-2024 08:03               10660
function.ldap-connect-wallet.php                   14-Jun-2024 08:03                4572
function.ldap-connect.php                          14-Jun-2024 08:03               10179
function.ldap-control-paged-result-response.php    14-Jun-2024 08:03                6143
function.ldap-control-paged-result.php             14-Jun-2024 08:03               14976
function.ldap-count-entries.php                    14-Jun-2024 08:03                5927
function.ldap-count-references.php                 14-Jun-2024 08:03                4853
function.ldap-delete-ext.php                       14-Jun-2024 08:03                5490
function.ldap-delete.php                           14-Jun-2024 08:03                5495
function.ldap-dn2ufn.php                           14-Jun-2024 08:03                2809
function.ldap-err2str.php                          14-Jun-2024 08:03                4954
function.ldap-errno.php                            14-Jun-2024 08:03                7822
function.ldap-error.php                            14-Jun-2024 08:03                4668
function.ldap-escape.php                           14-Jun-2024 08:03                6593
function.ldap-exop-passwd.php                      14-Jun-2024 08:03               10638
function.ldap-exop-refresh.php                     14-Jun-2024 08:03                5240
function.ldap-exop-sync.php                        14-Jun-2024 08:03                5703
function.ldap-exop-whoami.php                      14-Jun-2024 08:03                4014
function.ldap-exop.php                             14-Jun-2024 08:03               12582
function.ldap-explode-dn.php                       14-Jun-2024 08:03                3801
function.ldap-first-attribute.php                  14-Jun-2024 08:03                5646
function.ldap-first-entry.php                      14-Jun-2024 08:03                5970
function.ldap-first-reference.php                  14-Jun-2024 08:03                2430
function.ldap-free-result.php                      14-Jun-2024 08:03                4355
function.ldap-get-attributes.php                   14-Jun-2024 08:03                8291
function.ldap-get-dn.php                           14-Jun-2024 08:03                4436
function.ldap-get-entries.php                      14-Jun-2024 08:03                6353
function.ldap-get-option.php                       14-Jun-2024 08:03               16871
function.ldap-get-values-len.php                   14-Jun-2024 08:03                5804
function.ldap-get-values.php                       14-Jun-2024 08:03                8955
function.ldap-list.php                             14-Jun-2024 08:03               16401
function.ldap-mod-add.php                          14-Jun-2024 08:03                7137
function.ldap-mod-del.php                          14-Jun-2024 08:03                6564
function.ldap-mod-replace.php                      14-Jun-2024 08:03                7061
function.ldap-mod_add-ext.php                      14-Jun-2024 08:03                5920
function.ldap-mod_del-ext.php                      14-Jun-2024 08:03                5931
function.ldap-mod_replace-ext.php                  14-Jun-2024 08:03                6000
function.ldap-modify-batch.php                     14-Jun-2024 08:03               19472
function.ldap-modify.php                           14-Jun-2024 08:03                2141
function.ldap-next-attribute.php                   14-Jun-2024 08:03                5371
function.ldap-next-entry.php                       14-Jun-2024 08:03                5987
function.ldap-next-reference.php                   14-Jun-2024 08:03                2355
function.ldap-parse-exop.php                       14-Jun-2024 08:03                6107
function.ldap-parse-reference.php                  14-Jun-2024 08:03                2510
function.ldap-parse-result.php                     14-Jun-2024 08:03               10098
function.ldap-read.php                             14-Jun-2024 08:03               13790
function.ldap-rename-ext.php                       14-Jun-2024 08:03                6267
function.ldap-rename.php                           14-Jun-2024 08:03                7541
function.ldap-sasl-bind.php                        14-Jun-2024 08:03                7387
function.ldap-search.php                           14-Jun-2024 08:03               16769
function.ldap-set-option.php                       14-Jun-2024 08:03               19707
function.ldap-set-rebind-proc.php                  14-Jun-2024 08:03                3362
function.ldap-sort.php                             14-Jun-2024 08:03                7440
function.ldap-start-tls.php                        14-Jun-2024 08:03                2106
function.ldap-t61-to-8859.php                      14-Jun-2024 08:03                2261
function.ldap-unbind.php                           14-Jun-2024 08:03                3976
function.levenshtein.php                           14-Jun-2024 08:03               12681
function.libxml-clear-errors.php                   14-Jun-2024 08:03                2940
function.libxml-disable-entity-loader.php          14-Jun-2024 08:03                5233
function.libxml-get-errors.php                     14-Jun-2024 08:03               10907
function.libxml-get-external-entity-loader.php     14-Jun-2024 08:03                3561
function.libxml-get-last-error.php                 14-Jun-2024 08:03                3413
function.libxml-set-external-entity-loader.php     14-Jun-2024 08:03               10748
function.libxml-set-streams-context.php            14-Jun-2024 08:03                5225
function.libxml-use-internal-errors.php            14-Jun-2024 08:03                6988                                  14-Jun-2024 08:03                6059
function.linkinfo.php                              14-Jun-2024 08:03                4715
function.list.php                                  14-Jun-2024 08:03               17459
function.localeconv.php                            14-Jun-2024 08:03               10609
function.localtime.php                             14-Jun-2024 08:03                9557
function.log.php                                   14-Jun-2024 08:03                4133
function.log10.php                                 14-Jun-2024 08:03                2777
function.log1p.php                                 14-Jun-2024 08:03                3543
function.long2ip.php                               14-Jun-2024 08:03                4689
function.lstat.php                                 14-Jun-2024 08:03                6662
function.ltrim.php                                 14-Jun-2024 08:03                9959
function.lzf-compress.php                          14-Jun-2024 08:03                3051
function.lzf-decompress.php                        14-Jun-2024 08:03                3108
function.lzf-optimized-for.php                     14-Jun-2024 08:03                2321
function.mail.php                                  14-Jun-2024 08:03               28195
function.mailparse-determine-best-xfer-encoding..> 14-Jun-2024 08:03                4356
function.mailparse-msg-create.php                  14-Jun-2024 08:03                3525
function.mailparse-msg-extract-part-file.php       14-Jun-2024 08:03                5559
function.mailparse-msg-extract-part.php            14-Jun-2024 08:03                4241
function.mailparse-msg-extract-whole-part-file.php 14-Jun-2024 08:03                4260
function.mailparse-msg-free.php                    14-Jun-2024 08:03                3763
function.mailparse-msg-get-part-data.php           14-Jun-2024 08:03                2672
function.mailparse-msg-get-part.php                14-Jun-2024 08:03                2951
function.mailparse-msg-get-structure.php           14-Jun-2024 08:03                2683
function.mailparse-msg-parse-file.php              14-Jun-2024 08:03                4492
function.mailparse-msg-parse.php                   14-Jun-2024 08:03                3795
function.mailparse-rfc822-parse-addresses.php      14-Jun-2024 08:03                5967
function.mailparse-stream-encode.php               14-Jun-2024 08:03                6114
function.mailparse-uudecode-all.php                14-Jun-2024 08:03                7133
function.max.php                                   14-Jun-2024 08:03               12685
function.mb-check-encoding.php                     14-Jun-2024 08:03                5754
function.mb-chr.php                                14-Jun-2024 08:03                7304
function.mb-convert-case.php                       14-Jun-2024 08:03               12081
function.mb-convert-encoding.php                   14-Jun-2024 08:03               12156
function.mb-convert-kana.php                       14-Jun-2024 08:03               10220
function.mb-convert-variables.php                  14-Jun-2024 08:03                6851
function.mb-decode-mimeheader.php                  14-Jun-2024 08:03                3142
function.mb-decode-numericentity.php               14-Jun-2024 08:03               34029
function.mb-detect-encoding.php                    14-Jun-2024 08:03               17063
function.mb-detect-order.php                       14-Jun-2024 08:03                9258
function.mb-encode-mimeheader.php                  14-Jun-2024 08:03               10047
function.mb-encode-numericentity.php               14-Jun-2024 08:03               12851
function.mb-encoding-aliases.php                   14-Jun-2024 08:03                6712
function.mb-ereg-match.php                         14-Jun-2024 08:03                5893
function.mb-ereg-replace-callback.php              14-Jun-2024 08:03               13155
function.mb-ereg-replace.php                       14-Jun-2024 08:03                7594
function.mb-ereg-search-getpos.php                 14-Jun-2024 08:03                4245
function.mb-ereg-search-getregs.php                14-Jun-2024 08:03                4592
function.mb-ereg-search-init.php                   14-Jun-2024 08:03                6518
function.mb-ereg-search-pos.php                    14-Jun-2024 08:03                6288
function.mb-ereg-search-regs.php                   14-Jun-2024 08:03                6131
function.mb-ereg-search-setpos.php                 14-Jun-2024 08:03                4933
function.mb-ereg-search.php                        14-Jun-2024 08:03                5935
function.mb-ereg.php                               14-Jun-2024 08:03                7006
function.mb-eregi-replace.php                      14-Jun-2024 08:03                7452
function.mb-eregi.php                              14-Jun-2024 08:03                6889
function.mb-get-info.php                           14-Jun-2024 08:03                6616
function.mb-http-input.php                         14-Jun-2024 08:03                5380
function.mb-http-output.php                        14-Jun-2024 08:03                5352
function.mb-internal-encoding.php                  14-Jun-2024 08:03                7323
function.mb-language.php                           14-Jun-2024 08:03                6768
function.mb-list-encodings.php                     14-Jun-2024 08:03                5250
function.mb-ord.php                                14-Jun-2024 08:03                7095
function.mb-output-handler.php                     14-Jun-2024 08:03                5533
function.mb-parse-str.php                          14-Jun-2024 08:03                4898
function.mb-preferred-mime-name.php                14-Jun-2024 08:03                4496
function.mb-regex-encoding.php                     14-Jun-2024 08:03                4964
function.mb-regex-set-options.php                  14-Jun-2024 08:03                9362
function.mb-scrub.php                              14-Jun-2024 08:03                4373
function.mb-send-mail.php                          14-Jun-2024 08:03               10862
function.mb-split.php                              14-Jun-2024 08:03                4967
function.mb-str-pad.php                            14-Jun-2024 08:03                8729
function.mb-str-split.php                          14-Jun-2024 08:03                5689
function.mb-strcut.php                             14-Jun-2024 08:03                7943
function.mb-strimwidth.php                         14-Jun-2024 08:03                8272
function.mb-stripos.php                            14-Jun-2024 08:03                6890
function.mb-stristr.php                            14-Jun-2024 08:03                7204
function.mb-strlen.php                             14-Jun-2024 08:03                5159
function.mb-strpos.php                             14-Jun-2024 08:03                6837
function.mb-strrchr.php                            14-Jun-2024 08:03                6990
function.mb-strrichr.php                           14-Jun-2024 08:03                7042
function.mb-strripos.php                           14-Jun-2024 08:03                6745
function.mb-strrpos.php                            14-Jun-2024 08:03                6815
function.mb-strstr.php                             14-Jun-2024 08:03                6995
function.mb-strtolower.php                         14-Jun-2024 08:03                7443
function.mb-strtoupper.php                         14-Jun-2024 08:03                7432
function.mb-strwidth.php                           14-Jun-2024 08:03                9331
function.mb-substitute-character.php               14-Jun-2024 08:03                7839
function.mb-substr-count.php                       14-Jun-2024 08:03                6029
function.mb-substr.php                             14-Jun-2024 08:03                6924
function.mcrypt-create-iv.php                      14-Jun-2024 08:03                7430
function.mcrypt-decrypt.php                        14-Jun-2024 08:03                6371
function.mcrypt-enc-get-algorithms-name.php        14-Jun-2024 08:03                5691
function.mcrypt-enc-get-block-size.php             14-Jun-2024 08:03                3119
function.mcrypt-enc-get-iv-size.php                14-Jun-2024 08:03                3528
function.mcrypt-enc-get-key-size.php               14-Jun-2024 08:03                3099
function.mcrypt-enc-get-modes-name.php             14-Jun-2024 08:03                5409
function.mcrypt-enc-get-supported-key-sizes.php    14-Jun-2024 08:03                5369
function.mcrypt-enc-is-block-algorithm-mode.php    14-Jun-2024 08:03                3762
function.mcrypt-enc-is-block-algorithm.php         14-Jun-2024 08:03                3413
function.mcrypt-enc-is-block-mode.php              14-Jun-2024 08:03                3672
function.mcrypt-enc-self-test.php                  14-Jun-2024 08:03                3149
function.mcrypt-encrypt.php                        14-Jun-2024 08:03               14908
function.mcrypt-generic-deinit.php                 14-Jun-2024 08:03                4137
function.mcrypt-generic-init.php                   14-Jun-2024 08:03                5711
function.mcrypt-generic.php                        14-Jun-2024 08:03                6511
function.mcrypt-get-block-size.php                 14-Jun-2024 08:03                6862
function.mcrypt-get-cipher-name.php                14-Jun-2024 08:03                5205
function.mcrypt-get-iv-size.php                    14-Jun-2024 08:03                6769
function.mcrypt-get-key-size.php                   14-Jun-2024 08:03                7049
function.mcrypt-list-algorithms.php                14-Jun-2024 08:03                4910
function.mcrypt-list-modes.php                     14-Jun-2024 08:03                4774
function.mcrypt-module-close.php                   14-Jun-2024 08:03                3628
function.mcrypt-module-get-algo-block-size.php     14-Jun-2024 08:03                3693
function.mcrypt-module-get-algo-key-size.php       14-Jun-2024 08:03                3741
function.mcrypt-module-get-supported-key-sizes.php 14-Jun-2024 08:03                5012
function.mcrypt-module-is-block-algorithm-mode.php 14-Jun-2024 08:03                4667
function.mcrypt-module-is-block-algorithm.php      14-Jun-2024 08:03                4297
function.mcrypt-module-is-block-mode.php           14-Jun-2024 08:03                5031
function.mcrypt-module-open.php                    14-Jun-2024 08:03               14611
function.mcrypt-module-self-test.php               14-Jun-2024 08:03                5175
function.md5-file.php                              14-Jun-2024 08:03                5493
function.md5.php                                   14-Jun-2024 08:03                6339
function.mdecrypt-generic.php                      14-Jun-2024 08:03               11142
function.memcache-debug.php                        14-Jun-2024 08:03                3992
function.memory-get-peak-usage.php                 14-Jun-2024 08:03                3910
function.memory-get-usage.php                      14-Jun-2024 08:03                5746
function.memory-reset-peak-usage.php               14-Jun-2024 08:03                5122
function.metaphone.php                             14-Jun-2024 08:03                8738
function.method-exists.php                         14-Jun-2024 08:03                6827
function.mhash-count.php                           14-Jun-2024 08:03                4784
function.mhash-get-block-size.php                  14-Jun-2024 08:03                4687
function.mhash-get-hash-name.php                   14-Jun-2024 08:03                4623
function.mhash-keygen-s2k.php                      14-Jun-2024 08:03                6257
function.mhash.php                                 14-Jun-2024 08:03                5226
function.microtime.php                             14-Jun-2024 08:03                8161
function.mime-content-type.php                     14-Jun-2024 08:03                5309
function.min.php                                   14-Jun-2024 08:03               13280
function.mkdir.php                                 14-Jun-2024 08:03               10246
function.mktime.php                                14-Jun-2024 08:03               19917                          14-Jun-2024 08:03               19447
function.mongodb.bson-fromjson.php                 14-Jun-2024 08:03                6035
function.mongodb.bson-fromphp.php                  14-Jun-2024 08:03                6301
function.mongodb.bson-tocanonicalextendedjson.php  14-Jun-2024 08:03               14036
function.mongodb.bson-tojson.php                   14-Jun-2024 08:03               15163
function.mongodb.bson-tophp.php                    14-Jun-2024 08:03                9372
function.mongodb.bson-torelaxedextendedjson.php    14-Jun-2024 08:03               13733
function.mongodb.driver.monitoring.addsubscribe..> 14-Jun-2024 08:03                5262
function.mongodb.driver.monitoring.removesubscr..> 14-Jun-2024 08:03                5032
function.move-uploaded-file.php                    14-Jun-2024 08:03                8713
function.mqseries-back.php                         14-Jun-2024 08:03                6595
function.mqseries-begin.php                        14-Jun-2024 08:03                7528
function.mqseries-close.php                        14-Jun-2024 08:03                6684
function.mqseries-cmit.php                         14-Jun-2024 08:03                6512
function.mqseries-conn.php                         14-Jun-2024 08:03                6025
function.mqseries-connx.php                        14-Jun-2024 08:03               12984
function.mqseries-disc.php                         14-Jun-2024 08:03                5676
function.mqseries-get.php                          14-Jun-2024 08:03               12446
function.mqseries-inq.php                          14-Jun-2024 08:03                9429
function.mqseries-open.php                         14-Jun-2024 08:03                7325
function.mqseries-put.php                          14-Jun-2024 08:03               12792
function.mqseries-put1.php                         14-Jun-2024 08:03                6708
function.mqseries-set.php                          14-Jun-2024 08:03                6445
function.mqseries-strerror.php                     14-Jun-2024 08:03                4342
function.msg-get-queue.php                         14-Jun-2024 08:03                6012
function.msg-queue-exists.php                      14-Jun-2024 08:03                3556
function.msg-receive.php                           14-Jun-2024 08:03               11821
function.msg-remove-queue.php                      14-Jun-2024 08:03                4738
function.msg-send.php                              14-Jun-2024 08:03                9951
function.msg-set-queue.php                         14-Jun-2024 08:03                5534
function.msg-stat-queue.php                        14-Jun-2024 08:03                6832                         14-Jun-2024 08:03                3512                               14-Jun-2024 08:03               10994                              14-Jun-2024 08:03                9196
function.mysql-affected-rows.php                   14-Jun-2024 08:03               12603
function.mysql-client-encoding.php                 14-Jun-2024 08:03                6440
function.mysql-close.php                           14-Jun-2024 08:03                7739
function.mysql-connect.php                         14-Jun-2024 08:03               17779
function.mysql-create-db.php                       14-Jun-2024 08:03                8790
function.mysql-data-seek.php                       14-Jun-2024 08:03               12358
function.mysql-db-name.php                         14-Jun-2024 08:03                7978
function.mysql-db-query.php                        14-Jun-2024 08:03               10379
function.mysql-drop-db.php                         14-Jun-2024 08:03                8151
function.mysql-errno.php                           14-Jun-2024 08:03                8491
function.mysql-error.php                           14-Jun-2024 08:03                8523
function.mysql-escape-string.php                   14-Jun-2024 08:03                6884
function.mysql-fetch-array.php                     14-Jun-2024 08:03               16290
function.mysql-fetch-assoc.php                     14-Jun-2024 08:03               12057
function.mysql-fetch-field.php                     14-Jun-2024 08:03               13894
function.mysql-fetch-lengths.php                   14-Jun-2024 08:03                8005
function.mysql-fetch-object.php                    14-Jun-2024 08:03               12344
function.mysql-fetch-row.php                       14-Jun-2024 08:03                8301
function.mysql-field-flags.php                     14-Jun-2024 08:03                8855
function.mysql-field-len.php                       14-Jun-2024 08:03                7178
function.mysql-field-name.php                      14-Jun-2024 08:03                9309
function.mysql-field-seek.php                      14-Jun-2024 08:03                5418
function.mysql-field-table.php                     14-Jun-2024 08:03                7994
function.mysql-field-type.php                      14-Jun-2024 08:03               11851
function.mysql-free-result.php                     14-Jun-2024 08:03                8105
function.mysql-get-client-info.php                 14-Jun-2024 08:03                5346
function.mysql-get-host-info.php                   14-Jun-2024 08:03                7434
function.mysql-get-proto-info.php                  14-Jun-2024 08:03                6827
function.mysql-get-server-info.php                 14-Jun-2024 08:03                7367
function.mysql-info.php                            14-Jun-2024 08:03                6711
function.mysql-insert-id.php                       14-Jun-2024 08:03                8803
function.mysql-list-dbs.php                        14-Jun-2024 08:03                9149
function.mysql-list-fields.php                     14-Jun-2024 08:03                9151
function.mysql-list-processes.php                  14-Jun-2024 08:03                7695
function.mysql-list-tables.php                     14-Jun-2024 08:03                9834
function.mysql-num-fields.php                      14-Jun-2024 08:03                6733
function.mysql-num-rows.php                        14-Jun-2024 08:03                8401
function.mysql-pconnect.php                        14-Jun-2024 08:03                8853
function.mysql-ping.php                            14-Jun-2024 08:03                8238
function.mysql-query.php                           14-Jun-2024 08:03               14900
function.mysql-real-escape-string.php              14-Jun-2024 08:03               16270
function.mysql-result.php                          14-Jun-2024 08:03                9903
function.mysql-select-db.php                       14-Jun-2024 08:03                8051
function.mysql-set-charset.php                     14-Jun-2024 08:03                6259
function.mysql-stat.php                            14-Jun-2024 08:03                9565
function.mysql-tablename.php                       14-Jun-2024 08:03                8290
function.mysql-thread-id.php                       14-Jun-2024 08:03                7041
function.mysql-unbuffered-query.php                14-Jun-2024 08:03                7671
function.mysql-xdevapi-expression.php              14-Jun-2024 08:03                4900
function.mysql-xdevapi-getsession.php              14-Jun-2024 08:03               13140
function.mysqli-connect.php                        14-Jun-2024 08:03                2437
function.mysqli-escape-string.php                  14-Jun-2024 08:03                1977
function.mysqli-execute.php                        14-Jun-2024 08:03                2596
function.mysqli-get-client-stats.php               14-Jun-2024 08:03                8519
function.mysqli-get-links-stats.php                14-Jun-2024 08:03                3462
function.mysqli-report.php                         14-Jun-2024 08:03                1779
function.mysqli-set-opt.php                        14-Jun-2024 08:03                1885
function.natcasesort.php                           14-Jun-2024 08:03                7997
function.natsort.php                               14-Jun-2024 08:03               11335                    14-Jun-2024 08:03                4793                                  14-Jun-2024 08:03                9657
function.ngettext.php                              14-Jun-2024 08:03                5839                           14-Jun-2024 08:03               19371
function.nl2br.php                                 14-Jun-2024 08:03                7059
function.number-format.php                         14-Jun-2024 08:03                9007
function.oauth-get-sbs.php                         14-Jun-2024 08:03                3270
function.oauth-urlencode.php                       14-Jun-2024 08:03                2702
function.ob-clean.php                              14-Jun-2024 08:03                4432
function.ob-end-clean.php                          14-Jun-2024 08:03                5927
function.ob-end-flush.php                          14-Jun-2024 08:03                5801
function.ob-flush.php                              14-Jun-2024 08:03                4848
function.ob-get-clean.php                          14-Jun-2024 08:03                7001
function.ob-get-contents.php                       14-Jun-2024 08:03                4928
function.ob-get-flush.php                          14-Jun-2024 08:03                6839
function.ob-get-length.php                         14-Jun-2024 08:03                4835
function.ob-get-level.php                          14-Jun-2024 08:03                3825
function.ob-get-status.php                         14-Jun-2024 08:03               10751
function.ob-gzhandler.php                          14-Jun-2024 08:03                6176
function.ob-iconv-handler.php                      14-Jun-2024 08:03                5402
function.ob-implicit-flush.php                     14-Jun-2024 08:03                5463
function.ob-list-handlers.php                      14-Jun-2024 08:03               14102
function.ob-start.php                              14-Jun-2024 08:03               16059
function.ob-tidyhandler.php                        14-Jun-2024 08:03                4491
function.oci-bind-array-by-name.php                14-Jun-2024 08:03               14272
function.oci-bind-by-name.php                      14-Jun-2024 08:03               81472
function.oci-cancel.php                            14-Jun-2024 08:03                2812
function.oci-client-version.php                    14-Jun-2024 08:03                4230
function.oci-close.php                             14-Jun-2024 08:03               19233
function.oci-commit.php                            14-Jun-2024 08:03               11548
function.oci-connect.php                           14-Jun-2024 08:03               36595
function.oci-define-by-name.php                    14-Jun-2024 08:03               24728
function.oci-error.php                             14-Jun-2024 08:03               12358
function.oci-execute.php                           14-Jun-2024 08:03               22244
function.oci-fetch-all.php                         14-Jun-2024 08:03               25988
function.oci-fetch-array.php                       14-Jun-2024 08:03               66056
function.oci-fetch-assoc.php                       14-Jun-2024 08:03                9199
function.oci-fetch-object.php                      14-Jun-2024 08:03               18960
function.oci-fetch-row.php                         14-Jun-2024 08:03                9167
function.oci-fetch.php                             14-Jun-2024 08:03               14048
function.oci-field-is-null.php                     14-Jun-2024 08:03                7991
function.oci-field-name.php                        14-Jun-2024 08:03               10085
function.oci-field-precision.php                   14-Jun-2024 08:03                9011
function.oci-field-scale.php                       14-Jun-2024 08:03                8963
function.oci-field-size.php                        14-Jun-2024 08:03               10442
function.oci-field-type-raw.php                    14-Jun-2024 08:03                8137
function.oci-field-type.php                        14-Jun-2024 08:03                6350
function.oci-free-descriptor.php                   14-Jun-2024 08:03                3645
function.oci-free-statement.php                    14-Jun-2024 08:03                3130
function.oci-get-implicit-resultset.php            14-Jun-2024 08:03               28756
function.oci-internal-debug.php                    14-Jun-2024 08:03                3158
function.oci-lob-copy.php                          14-Jun-2024 08:03                4758
function.oci-lob-is-equal.php                      14-Jun-2024 08:03                3336
function.oci-new-collection.php                    14-Jun-2024 08:03                5299
function.oci-new-connect.php                       14-Jun-2024 08:03               17504
function.oci-new-cursor.php                        14-Jun-2024 08:03                7909
function.oci-new-descriptor.php                    14-Jun-2024 08:03               18402
function.oci-num-fields.php                        14-Jun-2024 08:03                7040
function.oci-num-rows.php                          14-Jun-2024 08:03                8139
function.oci-parse.php                             14-Jun-2024 08:03               12906
function.oci-password-change.php                   14-Jun-2024 08:03               14045
function.oci-pconnect.php                          14-Jun-2024 08:03               15884
function.oci-register-taf-callback.php             14-Jun-2024 08:03                5867
function.oci-result.php                            14-Jun-2024 08:03                8851
function.oci-rollback.php                          14-Jun-2024 08:03               15030
function.oci-server-version.php                    14-Jun-2024 08:03                4979
function.oci-set-action.php                        14-Jun-2024 08:03                8997
function.oci-set-call-timout.php                   14-Jun-2024 08:03                6067
function.oci-set-client-identifier.php             14-Jun-2024 08:03                8801
function.oci-set-client-info.php                   14-Jun-2024 08:03                8894
function.oci-set-db-operation.php                  14-Jun-2024 08:03                8034
function.oci-set-edition.php                       14-Jun-2024 08:03               10259
function.oci-set-module-name.php                   14-Jun-2024 08:03                9010
function.oci-set-prefetch-lob.php                  14-Jun-2024 08:03                8964
function.oci-set-prefetch.php                      14-Jun-2024 08:03               22006
function.oci-statement-type.php                    14-Jun-2024 08:03                7230
function.oci-unregister-taf-callback.php           14-Jun-2024 08:03                3718
function.ocibindbyname.php                         14-Jun-2024 08:03                2020
function.ocicancel.php                             14-Jun-2024 08:03                1962
function.ocicloselob.php                           14-Jun-2024 08:03                1961
function.ocicollappend.php                         14-Jun-2024 08:03                2026
function.ocicollassign.php                         14-Jun-2024 08:03                2031
function.ocicollassignelem.php                     14-Jun-2024 08:03                2076
function.ocicollgetelem.php                        14-Jun-2024 08:03                2043
function.ocicollmax.php                            14-Jun-2024 08:03                1995
function.ocicollsize.php                           14-Jun-2024 08:03                1998
function.ocicolltrim.php                           14-Jun-2024 08:03                2008
function.ocicolumnisnull.php                       14-Jun-2024 08:03                2032
function.ocicolumnname.php                         14-Jun-2024 08:03                2024
function.ocicolumnprecision.php                    14-Jun-2024 08:03                2067
function.ocicolumnscale.php                        14-Jun-2024 08:03                2031
function.ocicolumnsize.php                         14-Jun-2024 08:03                2012
function.ocicolumntype.php                         14-Jun-2024 08:03                2016
function.ocicolumntyperaw.php                      14-Jun-2024 08:03                2039
function.ocicommit.php                             14-Jun-2024 08:03                1976
function.ocidefinebyname.php                       14-Jun-2024 08:03                2022
function.ocierror.php                              14-Jun-2024 08:03                1953
function.ociexecute.php                            14-Jun-2024 08:03                1957
function.ocifetch.php                              14-Jun-2024 08:03                1947
function.ocifetchinto.php                          14-Jun-2024 08:03                2712
function.ocifetchstatement.php                     14-Jun-2024 08:03                2040
function.ocifreecollection.php                     14-Jun-2024 08:03                2058
function.ocifreecursor.php                         14-Jun-2024 08:03                2030
function.ocifreedesc.php                           14-Jun-2024 08:03                1974
function.ocifreestatement.php                      14-Jun-2024 08:03                2049
function.ociinternaldebug.php                      14-Jun-2024 08:03                2063
function.ociloadlob.php                            14-Jun-2024 08:03                1959
function.ocilogoff.php                             14-Jun-2024 08:03                1946
function.ocilogon.php                              14-Jun-2024 08:03                1961
function.ocinewcollection.php                      14-Jun-2024 08:03                2047
function.ocinewcursor.php                          14-Jun-2024 08:03                2015
function.ocinewdescriptor.php                      14-Jun-2024 08:03                2037
function.ocinlogon.php                             14-Jun-2024 08:03                1986
function.ocinumcols.php                            14-Jun-2024 08:03                1971
function.ociparse.php                              14-Jun-2024 08:03                1941
function.ociplogon.php                             14-Jun-2024 08:03                1956
function.ociresult.php                             14-Jun-2024 08:03                1954
function.ocirollback.php                           14-Jun-2024 08:03                1976
function.ocirowcount.php                           14-Jun-2024 08:03                1978
function.ocisavelob.php                            14-Jun-2024 08:03                1959
function.ocisavelobfile.php                        14-Jun-2024 08:03                1997
function.ociserverversion.php                      14-Jun-2024 08:03                2051
function.ocisetprefetch.php                        14-Jun-2024 08:03                2037
function.ocistatementtype.php                      14-Jun-2024 08:03                2057
function.ociwritelobtofile.php                     14-Jun-2024 08:03                2038
function.ociwritetemporarylob.php                  14-Jun-2024 08:03                2061
function.octdec.php                                14-Jun-2024 08:03                6134
function.odbc-autocommit.php                       14-Jun-2024 08:03                5930
function.odbc-binmode.php                          14-Jun-2024 08:03                7798
function.odbc-close-all.php                        14-Jun-2024 08:03                2732
function.odbc-close.php                            14-Jun-2024 08:03                3165
function.odbc-columnprivileges.php                 14-Jun-2024 08:03                9070
function.odbc-columns.php                          14-Jun-2024 08:03               12027
function.odbc-commit.php                           14-Jun-2024 08:03                2915
function.odbc-connect.php                          14-Jun-2024 08:03                9265
function.odbc-connection-string-is-quoted.php      14-Jun-2024 08:03                3750
function.odbc-connection-string-quote.php          14-Jun-2024 08:03                5809
function.odbc-connection-string-should-quote.php   14-Jun-2024 08:03                4014
function.odbc-cursor.php                           14-Jun-2024 08:03                3018
function.odbc-data-source.php                      14-Jun-2024 08:03                6495
function.odbc-do.php                               14-Jun-2024 08:03                1710
function.odbc-error.php                            14-Jun-2024 08:03                4487
function.odbc-errormsg.php                         14-Jun-2024 08:03                4399
function.odbc-exec.php                             14-Jun-2024 08:03                4355
function.odbc-execute.php                          14-Jun-2024 08:03                7192
function.odbc-fetch-array.php                      14-Jun-2024 08:03                4543
function.odbc-fetch-into.php                       14-Jun-2024 08:03                5165
function.odbc-fetch-object.php                     14-Jun-2024 08:03                4539
function.odbc-fetch-row.php                        14-Jun-2024 08:03                5051
function.odbc-field-len.php                        14-Jun-2024 08:03                3543
function.odbc-field-name.php                       14-Jun-2024 08:03                3272
function.odbc-field-num.php                        14-Jun-2024 08:03                3232
function.odbc-field-precision.php                  14-Jun-2024 08:03                2260
function.odbc-field-scale.php                      14-Jun-2024 08:03                3375
function.odbc-field-type.php                       14-Jun-2024 08:03                3260
function.odbc-foreignkeys.php                      14-Jun-2024 08:03                9441
function.odbc-free-result.php                      14-Jun-2024 08:03                3538
function.odbc-gettypeinfo.php                      14-Jun-2024 08:03                4700
function.odbc-longreadlen.php                      14-Jun-2024 08:03                4032
function.odbc-next-result.php                      14-Jun-2024 08:03                9348
function.odbc-num-fields.php                       14-Jun-2024 08:03                2730
function.odbc-num-rows.php                         14-Jun-2024 08:03                3482
function.odbc-pconnect.php                         14-Jun-2024 08:03                5098
function.odbc-prepare.php                          14-Jun-2024 08:03                6673
function.odbc-primarykeys.php                      14-Jun-2024 08:03                8144
function.odbc-procedurecolumns.php                 14-Jun-2024 08:03               12233
function.odbc-procedures.php                       14-Jun-2024 08:03                9916
function.odbc-result-all.php                       14-Jun-2024 08:03                4281
function.odbc-result.php                           14-Jun-2024 08:03                6041
function.odbc-rollback.php                         14-Jun-2024 08:03                2920
function.odbc-setoption.php                        14-Jun-2024 08:03                7838
function.odbc-specialcolumns.php                   14-Jun-2024 08:03                8330
function.odbc-statistics.php                       14-Jun-2024 08:03               10264
function.odbc-tableprivileges.php                  14-Jun-2024 08:03                8509
function.odbc-tables.php                           14-Jun-2024 08:03               12935
function.opcache-compile-file.php                  14-Jun-2024 08:03                4002
function.opcache-get-configuration.php             14-Jun-2024 08:03                3445
function.opcache-get-status.php                    14-Jun-2024 08:03                4021
function.opcache-invalidate.php                    14-Jun-2024 08:03                4555
function.opcache-is-script-cached.php              14-Jun-2024 08:03                3590
function.opcache-reset.php                         14-Jun-2024 08:03                3409
function.openal-buffer-create.php                  14-Jun-2024 08:03                3024
function.openal-buffer-data.php                    14-Jun-2024 08:03                5156
function.openal-buffer-destroy.php                 14-Jun-2024 08:03                3286
function.openal-buffer-get.php                     14-Jun-2024 08:03                4104
function.openal-buffer-loadwav.php                 14-Jun-2024 08:03                3873
function.openal-context-create.php                 14-Jun-2024 08:03                3459
function.openal-context-current.php                14-Jun-2024 08:03                3341
function.openal-context-destroy.php                14-Jun-2024 08:03                3323
function.openal-context-process.php                14-Jun-2024 08:03                3735
function.openal-context-suspend.php                14-Jun-2024 08:03                3729
function.openal-device-close.php                   14-Jun-2024 08:03                3281
function.openal-device-open.php                    14-Jun-2024 08:03                3600
function.openal-listener-get.php                   14-Jun-2024 08:03                4438
function.openal-listener-set.php                   14-Jun-2024 08:03                4895
function.openal-source-create.php                  14-Jun-2024 08:03                3189
function.openal-source-destroy.php                 14-Jun-2024 08:03                3304
function.openal-source-get.php                     14-Jun-2024 08:03                7262
function.openal-source-pause.php                   14-Jun-2024 08:03                3646
function.openal-source-play.php                    14-Jun-2024 08:03                3638
function.openal-source-rewind.php                  14-Jun-2024 08:03                3648
function.openal-source-set.php                     14-Jun-2024 08:03                8170
function.openal-source-stop.php                    14-Jun-2024 08:03                3621
function.openal-stream.php                         14-Jun-2024 08:03                4559
function.opendir.php                               14-Jun-2024 08:03                8175
function.openlog.php                               14-Jun-2024 08:03               10864
function.openssl-cipher-iv-length.php              14-Jun-2024 08:03                4678
function.openssl-cipher-key-length.php             14-Jun-2024 08:03                4504
function.openssl-cms-decrypt.php                   14-Jun-2024 08:03                5801
function.openssl-cms-encrypt.php                   14-Jun-2024 08:03                6781
function.openssl-cms-read.php                      14-Jun-2024 08:03                3384
function.openssl-cms-sign.php                      14-Jun-2024 08:03                8450
function.openssl-cms-verify.php                    14-Jun-2024 08:03                7542
function.openssl-csr-export-to-file.php            14-Jun-2024 08:03                8796
function.openssl-csr-export.php                    14-Jun-2024 08:03                8723
function.openssl-csr-get-public-key.php            14-Jun-2024 08:03                9125
function.openssl-csr-get-subject.php               14-Jun-2024 08:03                9794
function.openssl-csr-new.php                       14-Jun-2024 08:03               22706
function.openssl-csr-sign.php                      14-Jun-2024 08:03               14528
function.openssl-decrypt.php                       14-Jun-2024 08:03                8394
function.openssl-dh-compute-key.php                14-Jun-2024 08:03               17046
function.openssl-digest.php                        14-Jun-2024 08:03                4823
function.openssl-encrypt.php                       14-Jun-2024 08:03               18860
function.openssl-error-string.php                  14-Jun-2024 08:03                4140
function.openssl-free-key.php                      14-Jun-2024 08:03                3598
function.openssl-get-cert-locations.php            14-Jun-2024 08:03                4168
function.openssl-get-cipher-methods.php            14-Jun-2024 08:03               14284
function.openssl-get-curve-names.php               14-Jun-2024 08:03                7367
function.openssl-get-md-methods.php                14-Jun-2024 08:03                7158
function.openssl-get-privatekey.php                14-Jun-2024 08:03                1934
function.openssl-get-publickey.php                 14-Jun-2024 08:03                1907
function.openssl-open.php                          14-Jun-2024 08:03               10732
function.openssl-pbkdf2.php                        14-Jun-2024 08:03                7706
function.openssl-pkcs12-export-to-file.php         14-Jun-2024 08:03                8016
function.openssl-pkcs12-export.php                 14-Jun-2024 08:03                7943
function.openssl-pkcs12-read.php                   14-Jun-2024 08:03                5864
function.openssl-pkcs7-decrypt.php                 14-Jun-2024 08:03                7936
function.openssl-pkcs7-encrypt.php                 14-Jun-2024 08:03               11139
function.openssl-pkcs7-read.php                    14-Jun-2024 08:03                7132
function.openssl-pkcs7-sign.php                    14-Jun-2024 08:03               12419
function.openssl-pkcs7-verify.php                  14-Jun-2024 08:03                8733
function.openssl-pkey-derive.php                   14-Jun-2024 08:03                8286
function.openssl-pkey-export-to-file.php           14-Jun-2024 08:03                7012
function.openssl-pkey-export.php                   14-Jun-2024 08:03                6971
function.openssl-pkey-free.php                     14-Jun-2024 08:03                3876
function.openssl-pkey-get-details.php              14-Jun-2024 08:03               10161
function.openssl-pkey-get-private.php              14-Jun-2024 08:03                6614
function.openssl-pkey-get-public.php               14-Jun-2024 08:03                5860
function.openssl-pkey-new.php                      14-Jun-2024 08:03                7331
function.openssl-private-decrypt.php               14-Jun-2024 08:03                7304
function.openssl-private-encrypt.php               14-Jun-2024 08:03                7065
function.openssl-public-decrypt.php                14-Jun-2024 08:03                6955
function.openssl-public-encrypt.php                14-Jun-2024 08:03                7368
function.openssl-random-pseudo-bytes.php           14-Jun-2024 08:03                9378
function.openssl-seal.php                          14-Jun-2024 08:03               11882
function.openssl-sign.php                          14-Jun-2024 08:03               13270
function.openssl-spki-export-challenge.php         14-Jun-2024 08:03                7980
function.openssl-spki-export.php                   14-Jun-2024 08:03                8650
function.openssl-spki-new.php                      14-Jun-2024 08:03                9633
function.openssl-spki-verify.php                   14-Jun-2024 08:03                8029
function.openssl-verify.php                        14-Jun-2024 08:03               13779
function.openssl-x509-check-private-key.php        14-Jun-2024 08:03                6150
function.openssl-x509-checkpurpose.php             14-Jun-2024 08:03                8272
function.openssl-x509-export-to-file.php           14-Jun-2024 08:03                5334
function.openssl-x509-export.php                   14-Jun-2024 08:03                5304
function.openssl-x509-fingerprint.php              14-Jun-2024 08:03                5846
function.openssl-x509-free.php                     14-Jun-2024 08:03                3882
function.openssl-x509-parse.php                    14-Jun-2024 08:03                5216
function.openssl-x509-read.php                     14-Jun-2024 08:03                4676
function.openssl-x509-verify.php                   14-Jun-2024 08:03               12733
function.ord.php                                   14-Jun-2024 08:03                7734
function.output-add-rewrite-var.php                14-Jun-2024 08:03                9951
function.output-reset-rewrite-vars.php             14-Jun-2024 08:03                6975
function.pack.php                                  14-Jun-2024 08:03               14209
function.parse-ini-file.php                        14-Jun-2024 08:03               21303
function.parse-ini-string.php                      14-Jun-2024 08:03                7916
function.parse-str.php                             14-Jun-2024 08:03               10570
function.parse-url.php                             14-Jun-2024 08:03               17317
function.passthru.php                              14-Jun-2024 08:03                8014
function.password-algos.php                        14-Jun-2024 08:03                3593
function.password-get-info.php                     14-Jun-2024 08:03                3743
function.password-hash.php                         14-Jun-2024 08:03               24368
function.password-needs-rehash.php                 14-Jun-2024 08:03                8802
function.password-verify.php                       14-Jun-2024 08:03                7379
function.pathinfo.php                              14-Jun-2024 08:03               14768
function.pclose.php                                14-Jun-2024 08:03                5008
function.pcntl-alarm.php                           14-Jun-2024 08:03                3103
function.pcntl-async-signals.php                   14-Jun-2024 08:03                4278
function.pcntl-errno.php                           14-Jun-2024 08:03                1798
function.pcntl-exec.php                            14-Jun-2024 08:03                4089
function.pcntl-fork.php                            14-Jun-2024 08:03                5132
function.pcntl-get-last-error.php                  14-Jun-2024 08:03                2899
function.pcntl-getpriority.php                     14-Jun-2024 08:03                6030
function.pcntl-rfork.php                           14-Jun-2024 08:03                7758
function.pcntl-setpriority.php                     14-Jun-2024 08:03                5960
function.pcntl-signal-dispatch.php                 14-Jun-2024 08:03                5910
function.pcntl-signal-get-handler.php              14-Jun-2024 08:03                6950
function.pcntl-signal.php                          14-Jun-2024 08:03               11962
function.pcntl-sigprocmask.php                     14-Jun-2024 08:03                6250
function.pcntl-sigtimedwait.php                    14-Jun-2024 08:03                5290
function.pcntl-sigwaitinfo.php                     14-Jun-2024 08:03                7851
function.pcntl-strerror.php                        14-Jun-2024 08:03                3139
function.pcntl-unshare.php                         14-Jun-2024 08:03                4748
function.pcntl-wait.php                            14-Jun-2024 08:03                8549
function.pcntl-waitpid.php                         14-Jun-2024 08:03               10224
function.pcntl-wexitstatus.php                     14-Jun-2024 08:03                3925
function.pcntl-wifexited.php                       14-Jun-2024 08:03                3702
function.pcntl-wifsignaled.php                     14-Jun-2024 08:03                3760
function.pcntl-wifstopped.php                      14-Jun-2024 08:03                3780
function.pcntl-wstopsig.php                        14-Jun-2024 08:03                3920
function.pcntl-wtermsig.php                        14-Jun-2024 08:03                4087
function.pfsockopen.php                            14-Jun-2024 08:03                5883                      14-Jun-2024 08:03                7010                       14-Jun-2024 08:03                7707                    14-Jun-2024 08:03                7128                              14-Jun-2024 08:03                7082                       14-Jun-2024 08:03                4272                            14-Jun-2024 08:03               11605                    14-Jun-2024 08:03                5908                   14-Jun-2024 08:03                6089                  14-Jun-2024 08:03                5694                      14-Jun-2024 08:03                3818                            14-Jun-2024 08:03               10190                          14-Jun-2024 08:03                8348                            14-Jun-2024 08:03                7724                             14-Jun-2024 08:03                5597                             14-Jun-2024 08:03               10359                           14-Jun-2024 08:03                7578                       14-Jun-2024 08:03                8379                  14-Jun-2024 08:03                8272                     14-Jun-2024 08:03                8689                      14-Jun-2024 08:03                7816                            14-Jun-2024 08:03               11058                  14-Jun-2024 08:03                7228                          14-Jun-2024 08:03                9580                        14-Jun-2024 08:03               13256                        14-Jun-2024 08:03                9843                       14-Jun-2024 08:03               12555                       14-Jun-2024 08:03                9734                          14-Jun-2024 08:03               10440                      14-Jun-2024 08:03                8981                         14-Jun-2024 08:03                9149                          14-Jun-2024 08:03                6733                       14-Jun-2024 08:03               11339                         14-Jun-2024 08:03                9446                        14-Jun-2024 08:03                8982                     14-Jun-2024 08:03                7524                         14-Jun-2024 08:03                7390                              14-Jun-2024 08:03                3875                        14-Jun-2024 08:03                7632                         14-Jun-2024 08:03                7826                            14-Jun-2024 08:03                5341                         14-Jun-2024 08:03                8954                               14-Jun-2024 08:03                6416                             14-Jun-2024 08:03               12323                         14-Jun-2024 08:03                7718                        14-Jun-2024 08:03                8602                           14-Jun-2024 08:03                7845                           14-Jun-2024 08:03                7428                          14-Jun-2024 08:03                9003                          14-Jun-2024 08:03                8566                          14-Jun-2024 08:03                7849                            14-Jun-2024 08:03                9417                        14-Jun-2024 08:03                6528                            14-Jun-2024 08:03                7220                            14-Jun-2024 08:03                8285                            14-Jun-2024 08:03                7252                        14-Jun-2024 08:03                6802                          14-Jun-2024 08:03                7649                           14-Jun-2024 08:03                8679                          14-Jun-2024 08:03                7759                         14-Jun-2024 08:03                6139                           14-Jun-2024 08:03                6111                            14-Jun-2024 08:03                5747                   14-Jun-2024 08:03                8829                           14-Jun-2024 08:03               10465                               14-Jun-2024 08:03                6361                               14-Jun-2024 08:03                5988                            14-Jun-2024 08:03               10996                           14-Jun-2024 08:03                9187                       14-Jun-2024 08:03               11591                              14-Jun-2024 08:03               13076                 14-Jun-2024 08:03                9983                       14-Jun-2024 08:03                8385                        14-Jun-2024 08:03                7630                      14-Jun-2024 08:03                8802                             14-Jun-2024 08:03               12847                       14-Jun-2024 08:03               10896                       14-Jun-2024 08:03               11333                  14-Jun-2024 08:03                8462                         14-Jun-2024 08:03               10342                14-Jun-2024 08:03                9141       14-Jun-2024 08:03                7304                14-Jun-2024 08:03                9353                             14-Jun-2024 08:03                3907                              14-Jun-2024 08:03                9504                 14-Jun-2024 08:03                6884                                14-Jun-2024 08:03                6196                     14-Jun-2024 08:03                6925                            14-Jun-2024 08:03                7083                             14-Jun-2024 08:03               11436                            14-Jun-2024 08:03                6793
function.php-ini-loaded-file.php                   14-Jun-2024 08:03                4843
function.php-ini-scanned-files.php                 14-Jun-2024 08:03                6927
function.php-sapi-name.php                         14-Jun-2024 08:03                6185
function.php-strip-whitespace.php                  14-Jun-2024 08:03                4905
function.php-uname.php                             14-Jun-2024 08:03                9613
function.phpcredits.php                            14-Jun-2024 08:03                8461
function.phpdbg-break-file.php                     14-Jun-2024 08:03                3943
function.phpdbg-break-function.php                 14-Jun-2024 08:03                3673
function.phpdbg-break-method.php                   14-Jun-2024 08:03                4001
function.phpdbg-break-next.php                     14-Jun-2024 08:03                3317
function.phpdbg-clear.php                          14-Jun-2024 08:03                3621
function.phpdbg-color.php                          14-Jun-2024 08:03                3784
function.phpdbg-end-oplog.php                      14-Jun-2024 08:03                2695
function.phpdbg-exec.php                           14-Jun-2024 08:03                3293
function.phpdbg-get-executable.php                 14-Jun-2024 08:03                2638
function.phpdbg-prompt.php                         14-Jun-2024 08:03                2941
function.phpdbg-start-oplog.php                    14-Jun-2024 08:03                2363
function.phpinfo.php                               14-Jun-2024 08:03                9986
function.phpversion.php                            14-Jun-2024 08:03               10909
function.pi.php                                    14-Jun-2024 08:03                3207
function.png2wbmp.php                              14-Jun-2024 08:03                6800
function.popen.php                                 14-Jun-2024 08:03                8851
function.pos.php                                   14-Jun-2024 08:03                1653
function.posix-access.php                          14-Jun-2024 08:03                6886
function.posix-ctermid.php                         14-Jun-2024 08:03                4649
function.posix-eaccess.php                         14-Jun-2024 08:03                7594
function.posix-errno.php                           14-Jun-2024 08:03                1804
function.posix-fpathconf.php                       14-Jun-2024 08:03                6727
function.posix-get-last-error.php                  14-Jun-2024 08:03                4303
function.posix-getcwd.php                          14-Jun-2024 08:03                4506
function.posix-getegid.php                         14-Jun-2024 08:03                5361
function.posix-geteuid.php                         14-Jun-2024 08:03                5419
function.posix-getgid.php                          14-Jun-2024 08:03                4706
function.posix-getgrgid.php                        14-Jun-2024 08:03                6490
function.posix-getgrnam.php                        14-Jun-2024 08:03                6352
function.posix-getgroups.php                       14-Jun-2024 08:03                4241
function.posix-getlogin.php                        14-Jun-2024 08:03                3718
function.posix-getpgid.php                         14-Jun-2024 08:03                4804
function.posix-getpgrp.php                         14-Jun-2024 08:03                2695
function.posix-getpid.php                          14-Jun-2024 08:03                3406
function.posix-getppid.php                         14-Jun-2024 08:03                3045
function.posix-getpwnam.php                        14-Jun-2024 08:03                7013
function.posix-getpwuid.php                        14-Jun-2024 08:03                7006
function.posix-getrlimit.php                       14-Jun-2024 08:03                8750
function.posix-getsid.php                          14-Jun-2024 08:03                4889
function.posix-getuid.php                          14-Jun-2024 08:03                3451
function.posix-initgroups.php                      14-Jun-2024 08:03                3439
function.posix-isatty.php                          14-Jun-2024 08:03                4442
function.posix-kill.php                            14-Jun-2024 08:03                3559
function.posix-mkfifo.php                          14-Jun-2024 08:03                3683
function.posix-mknod.php                           14-Jun-2024 08:03                7644
function.posix-pathconf.php                        14-Jun-2024 08:03                6351
function.posix-setegid.php                         14-Jun-2024 08:03                5271
function.posix-seteuid.php                         14-Jun-2024 08:03                3748
function.posix-setgid.php                          14-Jun-2024 08:03                5477
function.posix-setpgid.php                         14-Jun-2024 08:03                3521
function.posix-setrlimit.php                       14-Jun-2024 08:03                4844
function.posix-setsid.php                          14-Jun-2024 08:03                2615
function.posix-setuid.php                          14-Jun-2024 08:03                5668
function.posix-strerror.php                        14-Jun-2024 08:03                5244
function.posix-sysconf.php                         14-Jun-2024 08:03                4090
function.posix-times.php                           14-Jun-2024 08:03                4818
function.posix-ttyname.php                         14-Jun-2024 08:03                5371
function.posix-uname.php                           14-Jun-2024 08:03                5184
function.pow.php                                   14-Jun-2024 08:03                6866
function.preg-filter.php                           14-Jun-2024 08:03               10365
function.preg-grep.php                             14-Jun-2024 08:03                6447
function.preg-last-error-msg.php                   14-Jun-2024 08:03                4141
function.preg-last-error.php                       14-Jun-2024 08:03                5200
function.preg-match-all.php                        14-Jun-2024 08:03               26491
function.preg-match.php                            14-Jun-2024 08:03               24322
function.preg-quote.php                            14-Jun-2024 08:03                8787
function.preg-replace-callback-array.php           14-Jun-2024 08:03               11278
function.preg-replace-callback.php                 14-Jun-2024 08:03               18240
function.preg-replace.php                          14-Jun-2024 08:03               25617
function.preg-split.php                            14-Jun-2024 08:03               13313
function.prev.php                                  14-Jun-2024 08:03                9206
function.print-r.php                               14-Jun-2024 08:03                9401
function.print.php                                 14-Jun-2024 08:03               12870
function.printf.php                                14-Jun-2024 08:03               29770
function.proc-close.php                            14-Jun-2024 08:03                3809
function.proc-get-status.php                       14-Jun-2024 08:03                6848
function.proc-nice.php                             14-Jun-2024 08:03                8260
function.proc-open.php                             14-Jun-2024 08:03               23432
function.proc-terminate.php                        14-Jun-2024 08:03                5071                       14-Jun-2024 08:03                8695                       14-Jun-2024 08:03                5331                     14-Jun-2024 08:03                6165                      14-Jun-2024 08:03                6815                           14-Jun-2024 08:03                7670                        14-Jun-2024 08:03                7010                        14-Jun-2024 08:03                6061                                14-Jun-2024 08:03                5588                               14-Jun-2024 08:03                5591                         14-Jun-2024 08:03                7452                      14-Jun-2024 08:03               13579                     14-Jun-2024 08:03               11699                             14-Jun-2024 08:03                5047                               14-Jun-2024 08:03                3238                        14-Jun-2024 08:03                4118                              14-Jun-2024 08:03                3906                   14-Jun-2024 08:03                3282                          14-Jun-2024 08:03                3448                      14-Jun-2024 08:03                4356                            14-Jun-2024 08:03                5393                             14-Jun-2024 08:03                3818                           14-Jun-2024 08:03                3504                        14-Jun-2024 08:03                3420                       14-Jun-2024 08:03                3408                        14-Jun-2024 08:03                3490                               14-Jun-2024 08:03                3422                           14-Jun-2024 08:03                7825                         14-Jun-2024 08:03                3426                      14-Jun-2024 08:03                8592                          14-Jun-2024 08:03               10119                          14-Jun-2024 08:03                7542                       14-Jun-2024 08:03                3334                             14-Jun-2024 08:03                8433                      14-Jun-2024 08:03               10551                             14-Jun-2024 08:03                4077                                14-Jun-2024 08:03                3178                          14-Jun-2024 08:03                3894                    14-Jun-2024 08:03                5171                         14-Jun-2024 08:03                7323                  14-Jun-2024 08:03                2985                        14-Jun-2024 08:03                5495                               14-Jun-2024 08:03                5284                            14-Jun-2024 08:03                3631                             14-Jun-2024 08:03               12457                               14-Jun-2024 08:03                3380                              14-Jun-2024 08:03                3992                   14-Jun-2024 08:03                5121                    14-Jun-2024 08:03                4715                   14-Jun-2024 08:03                4756                           14-Jun-2024 08:03                6503                      14-Jun-2024 08:03                4206                       14-Jun-2024 08:03                9589                          14-Jun-2024 08:03                5160                           14-Jun-2024 08:03                6324                            14-Jun-2024 08:03                3855                            14-Jun-2024 08:03                3300                            14-Jun-2024 08:03                4291                            14-Jun-2024 08:03                3493                         14-Jun-2024 08:03                4061                        14-Jun-2024 08:03                4079                       14-Jun-2024 08:03                3948                      14-Jun-2024 08:03                4495                   14-Jun-2024 08:03                3373                        14-Jun-2024 08:03                8021                    14-Jun-2024 08:03                4413                            14-Jun-2024 08:03                7373                             14-Jun-2024 08:03                4163                         14-Jun-2024 08:03               13910                            14-Jun-2024 08:03                4448                           14-Jun-2024 08:03                3294                               14-Jun-2024 08:03                6458                              14-Jun-2024 08:03                3527                    14-Jun-2024 08:03                5412                        14-Jun-2024 08:03                4791                             14-Jun-2024 08:03                3620                        14-Jun-2024 08:03                4122                       14-Jun-2024 08:03                4700                             14-Jun-2024 08:03                3981                          14-Jun-2024 08:03               14497
function.pspell-add-to-personal.php                14-Jun-2024 08:03                6589
function.pspell-add-to-session.php                 14-Jun-2024 08:03                4226
function.pspell-check.php                          14-Jun-2024 08:03                5124
function.pspell-clear-session.php                  14-Jun-2024 08:03                5990
function.pspell-config-create.php                  14-Jun-2024 08:03                8605
function.pspell-config-data-dir.php                14-Jun-2024 08:03                3538
function.pspell-config-dict-dir.php                14-Jun-2024 08:03                3527
function.pspell-config-ignore.php                  14-Jun-2024 08:03                5875
function.pspell-config-mode.php                    14-Jun-2024 08:03                6709
function.pspell-config-personal.php                14-Jun-2024 08:03                6736
function.pspell-config-repl.php                    14-Jun-2024 08:03                7077
function.pspell-config-runtogether.php             14-Jun-2024 08:03                6546
function.pspell-config-save-repl.php               14-Jun-2024 08:03                5510
function.pspell-new-config.php                     14-Jun-2024 08:03                6558
function.pspell-new-personal.php                   14-Jun-2024 08:03               11575
function.pspell-new.php                            14-Jun-2024 08:03                9881
function.pspell-save-wordlist.php                  14-Jun-2024 08:03                6174
function.pspell-store-replacement.php              14-Jun-2024 08:03                7887
function.pspell-suggest.php                        14-Jun-2024 08:03                5718
function.putenv.php                                14-Jun-2024 08:03                4238
function.quoted-printable-decode.php               14-Jun-2024 08:03                5480
function.quoted-printable-encode.php               14-Jun-2024 08:03                5255
function.quotemeta.php                             14-Jun-2024 08:03                6091
function.rad2deg.php                               14-Jun-2024 08:03                3592
function.radius-acct-open.php                      14-Jun-2024 08:03                3358
function.radius-add-server.php                     14-Jun-2024 08:03                8062
function.radius-auth-open.php                      14-Jun-2024 08:03                3374
function.radius-close.php                          14-Jun-2024 08:03                2782
function.radius-config.php                         14-Jun-2024 08:03                4248
function.radius-create-request.php                 14-Jun-2024 08:03                5519
function.radius-cvt-addr.php                       14-Jun-2024 08:03                6384
function.radius-cvt-int.php                        14-Jun-2024 08:03                5792
function.radius-cvt-string.php                     14-Jun-2024 08:03                5849
function.radius-demangle-mppe-key.php              14-Jun-2024 08:03                3350
function.radius-demangle.php                       14-Jun-2024 08:03                3126
function.radius-get-attr.php                       14-Jun-2024 08:03                6692
function.radius-get-tagged-attr-data.php           14-Jun-2024 08:03                6679
function.radius-get-tagged-attr-tag.php            14-Jun-2024 08:03                6715
function.radius-get-vendor-attr.php                14-Jun-2024 08:03                8391
function.radius-put-addr.php                       14-Jun-2024 08:03                5753
function.radius-put-attr.php                       14-Jun-2024 08:03                9042
function.radius-put-int.php                        14-Jun-2024 08:03                7832
function.radius-put-string.php                     14-Jun-2024 08:03                8347
function.radius-put-vendor-addr.php                14-Jun-2024 08:03                5710
function.radius-put-vendor-attr.php                14-Jun-2024 08:03                8132
function.radius-put-vendor-int.php                 14-Jun-2024 08:03                6238
function.radius-put-vendor-string.php              14-Jun-2024 08:03                6790
function.radius-request-authenticator.php          14-Jun-2024 08:03                3316
function.radius-salt-encrypt-attr.php              14-Jun-2024 08:03                4430
function.radius-send-request.php                   14-Jun-2024 08:03                4152
function.radius-server-secret.php                  14-Jun-2024 08:03                2813
function.radius-strerror.php                       14-Jun-2024 08:03                2715
function.rand.php                                  14-Jun-2024 08:03               11006
function.random-bytes.php                          14-Jun-2024 08:03               10204
function.random-int.php                            14-Jun-2024 08:03                9845
function.range.php                                 14-Jun-2024 08:03               16805
function.rar-wrapper-cache-stats.php               14-Jun-2024 08:03                2441
function.rawurldecode.php                          14-Jun-2024 08:03                4991
function.rawurlencode.php                          14-Jun-2024 08:03                6415                        14-Jun-2024 08:03                2502
function.readdir.php                               14-Jun-2024 08:03               10653
function.readfile.php                              14-Jun-2024 08:03               10437
function.readgzfile.php                            14-Jun-2024 08:03                4837
function.readline-add-history.php                  14-Jun-2024 08:03                2858
function.readline-callback-handler-install.php     14-Jun-2024 08:03                9540
function.readline-callback-handler-remove.php      14-Jun-2024 08:03                3979
function.readline-callback-read-char.php           14-Jun-2024 08:03                3914
function.readline-clear-history.php                14-Jun-2024 08:03                2569
function.readline-completion-function.php          14-Jun-2024 08:03                3156
function.readline-info.php                         14-Jun-2024 08:03                5175
function.readline-list-history.php                 14-Jun-2024 08:03                2457
function.readline-on-new-line.php                  14-Jun-2024 08:03                2796
function.readline-read-history.php                 14-Jun-2024 08:03                3626
function.readline-redisplay.php                    14-Jun-2024 08:03                2347
function.readline-write-history.php                14-Jun-2024 08:03                3578
function.readline.php                              14-Jun-2024 08:03                5505
function.readlink.php                              14-Jun-2024 08:03                4660
function.realpath-cache-get.php                    14-Jun-2024 08:03                4371
function.realpath-cache-size.php                   14-Jun-2024 08:03                3848
function.realpath.php                              14-Jun-2024 08:03                8919
function.recode-file.php                           14-Jun-2024 08:03                5760
function.recode-string.php                         14-Jun-2024 08:03                5168
function.recode.php                                14-Jun-2024 08:03                1765
function.register-shutdown-function.php            14-Jun-2024 08:03                8188
function.register-tick-function.php                14-Jun-2024 08:03                5668
function.rename.php                                14-Jun-2024 08:03                6250
function.require-once.php                          14-Jun-2024 08:03                1909
function.require.php                               14-Jun-2024 08:03                2138
function.reset.php                                 14-Jun-2024 08:03                9804
function.restore-error-handler.php                 14-Jun-2024 08:03                6045
function.restore-exception-handler.php             14-Jun-2024 08:03                6865
function.restore-include-path.php                  14-Jun-2024 08:03                5432
function.return.php                                14-Jun-2024 08:03                4532
function.rewind.php                                14-Jun-2024 08:03                6477
function.rewinddir.php                             14-Jun-2024 08:03                3687
function.rmdir.php                                 14-Jun-2024 08:03                5446
function.rnp-backend-string.php                    14-Jun-2024 08:03                2295
function.rnp-backend-version.php                   14-Jun-2024 08:03                2228
function.rnp-decrypt.php                           14-Jun-2024 08:03                3272
function.rnp-dump-packets-to-json.php              14-Jun-2024 08:03                3182
function.rnp-dump-packets.php                      14-Jun-2024 08:03                3136
function.rnp-ffi-create.php                        14-Jun-2024 08:03                3231
function.rnp-ffi-destroy.php                       14-Jun-2024 08:03                2470
function.rnp-ffi-set-pass-provider.php             14-Jun-2024 08:03                6770
function.rnp-import-keys.php                       14-Jun-2024 08:03                3524
function.rnp-import-signatures.php                 14-Jun-2024 08:03                3514
function.rnp-key-export-autocrypt.php              14-Jun-2024 08:03                4575
function.rnp-key-export-revocation.php             14-Jun-2024 08:03                5225
function.rnp-key-export.php                        14-Jun-2024 08:03                3494
function.rnp-key-get-info.php                      14-Jun-2024 08:03                8012
function.rnp-key-remove.php                        14-Jun-2024 08:03                3634
function.rnp-key-revoke.php                        14-Jun-2024 08:03                4871
function.rnp-list-keys.php                         14-Jun-2024 08:03                3177
function.rnp-load-keys-from-path.php               14-Jun-2024 08:03                3891
function.rnp-load-keys.php                         14-Jun-2024 08:03                3847
function.rnp-locate-key.php                        14-Jun-2024 08:03                3597
function.rnp-op-encrypt.php                        14-Jun-2024 08:03                7964
function.rnp-op-generate-key.php                   14-Jun-2024 08:03                7583
function.rnp-op-sign-cleartext.php                 14-Jun-2024 08:03                5233
function.rnp-op-sign-detached.php                  14-Jun-2024 08:03                5112
function.rnp-op-sign.php                           14-Jun-2024 08:03                6193
function.rnp-op-verify-detached.php                14-Jun-2024 08:03                7122
function.rnp-op-verify.php                         14-Jun-2024 08:03                6861
function.rnp-save-keys-to-path.php                 14-Jun-2024 08:03                3905
function.rnp-save-keys.php                         14-Jun-2024 08:03                3878
function.rnp-supported-features.php                14-Jun-2024 08:03                2950
function.rnp-version-string-full.php               14-Jun-2024 08:03                2313
function.rnp-version-string.php                    14-Jun-2024 08:03                2210
function.round.php                                 14-Jun-2024 08:03               24593
function.rpmaddtag.php                             14-Jun-2024 08:03                3377
function.rpmdbinfo.php                             14-Jun-2024 08:03                5251
function.rpmdbsearch.php                           14-Jun-2024 08:03                6151
function.rpmgetsymlink.php                         14-Jun-2024 08:03                2993
function.rpminfo.php                               14-Jun-2024 08:03                5433
function.rpmvercmp.php                             14-Jun-2024 08:03                4919
function.rrd-create.php                            14-Jun-2024 08:03                3097
function.rrd-error.php                             14-Jun-2024 08:03                2198
function.rrd-fetch.php                             14-Jun-2024 08:03                3175
function.rrd-first.php                             14-Jun-2024 08:03                2998
function.rrd-graph.php                             14-Jun-2024 08:03                3319
function.rrd-info.php                              14-Jun-2024 08:03                2598
function.rrd-last.php                              14-Jun-2024 08:03                2545
function.rrd-lastupdate.php                        14-Jun-2024 08:03                2765
function.rrd-restore.php                           14-Jun-2024 08:03                3503
function.rrd-tune.php                              14-Jun-2024 08:03                3245
function.rrd-update.php                            14-Jun-2024 08:03                3299
function.rrd-version.php                           14-Jun-2024 08:03                2373
function.rrd-xport.php                             14-Jun-2024 08:03                2885
function.rrdc-disconnect.php                       14-Jun-2024 08:03                2676
function.rsort.php                                 14-Jun-2024 08:03                9460
function.rtrim.php                                 14-Jun-2024 08:03                9917
function.runkit7-constant-add.php                  14-Jun-2024 08:03                4478
function.runkit7-constant-redefine.php             14-Jun-2024 08:03                4365
function.runkit7-constant-remove.php               14-Jun-2024 08:03                3685
function.runkit7-function-add.php                  14-Jun-2024 08:03                9757
function.runkit7-function-copy.php                 14-Jun-2024 08:03                5552
function.runkit7-function-redefine.php             14-Jun-2024 08:03               10285
function.runkit7-function-remove.php               14-Jun-2024 08:03                4230
function.runkit7-function-rename.php               14-Jun-2024 08:03                4507
function.runkit7-import.php                        14-Jun-2024 08:03                3885
function.runkit7-method-add.php                    14-Jun-2024 08:03               11811
function.runkit7-method-copy.php                   14-Jun-2024 08:03                7090
function.runkit7-method-redefine.php               14-Jun-2024 08:03               12247
function.runkit7-method-remove.php                 14-Jun-2024 08:03                6510
function.runkit7-method-rename.php                 14-Jun-2024 08:03                6672
function.runkit7-object-id.php                     14-Jun-2024 08:03                3793
function.runkit7-superglobals.php                  14-Jun-2024 08:03                2667
function.runkit7-zval-inspect.php                  14-Jun-2024 08:03                5137
function.sapi-windows-cp-conv.php                  14-Jun-2024 08:03                4800
function.sapi-windows-cp-get.php                   14-Jun-2024 08:03                3484
function.sapi-windows-cp-is-utf8.php               14-Jun-2024 08:03                2774
function.sapi-windows-cp-set.php                   14-Jun-2024 08:03                3120
function.sapi-windows-generate-ctrl-event.php      14-Jun-2024 08:03                7858
function.sapi-windows-set-ctrl-handler.php         14-Jun-2024 08:03                7628
function.sapi-windows-vt100-support.php            14-Jun-2024 08:03               11267
function.scandir.php                               14-Jun-2024 08:03                9166
function.scoutapm-get-calls.php                    14-Jun-2024 08:03                4498
function.scoutapm-list-instrumented-functions.php  14-Jun-2024 08:03                3835
function.seaslog-get-author.php                    14-Jun-2024 08:03                3155
function.seaslog-get-version.php                   14-Jun-2024 08:03                3153
function.sem-acquire.php                           14-Jun-2024 08:03                5462
function.sem-get.php                               14-Jun-2024 08:03                7472
function.sem-release.php                           14-Jun-2024 08:03                4482
function.sem-remove.php                            14-Jun-2024 08:03                4412
function.serialize.php                             14-Jun-2024 08:03               11145
function.session-abort.php                         14-Jun-2024 08:03                4302
function.session-cache-expire.php                  14-Jun-2024 08:03                7765
function.session-cache-limiter.php                 14-Jun-2024 08:03                9099
function.session-commit.php                        14-Jun-2024 08:03                1849
function.session-create-id.php                     14-Jun-2024 08:03               10485
function.session-decode.php                        14-Jun-2024 08:03                3862
function.session-destroy.php                       14-Jun-2024 08:03                9446
function.session-encode.php                        14-Jun-2024 08:03                4074
function.session-gc.php                            14-Jun-2024 08:03                8350
function.session-get-cookie-params.php             14-Jun-2024 08:03                5756
function.session-id.php                            14-Jun-2024 08:03                6524
function.session-module-name.php                   14-Jun-2024 08:03                4536
function.session-name.php                          14-Jun-2024 08:03                8007
function.session-regenerate-id.php                 14-Jun-2024 08:03               16635
function.session-register-shutdown.php             14-Jun-2024 08:03                2873
function.session-reset.php                         14-Jun-2024 08:03                4412
function.session-save-path.php                     14-Jun-2024 08:03                4876
function.session-set-cookie-params.php             14-Jun-2024 08:03               11273
function.session-set-save-handler.php              14-Jun-2024 08:03               25751
function.session-start.php                         14-Jun-2024 08:03               14872
function.session-status.php                        14-Jun-2024 08:03                3418
function.session-unset.php                         14-Jun-2024 08:03                5160
function.session-write-close.php                   14-Jun-2024 08:03                4330
function.set-error-handler.php                     14-Jun-2024 08:03               27347
function.set-exception-handler.php                 14-Jun-2024 08:03                7310
function.set-file-buffer.php                       14-Jun-2024 08:03                1838
function.set-include-path.php                      14-Jun-2024 08:03                6479
function.set-time-limit.php                        14-Jun-2024 08:03                4963
function.setcookie.php                             14-Jun-2024 08:03               28075
function.setlocale.php                             14-Jun-2024 08:03               16170
function.setrawcookie.php                          14-Jun-2024 08:03                6474
function.settype.php                               14-Jun-2024 08:03                6723
function.sha1-file.php                             14-Jun-2024 08:03                5852
function.sha1.php                                  14-Jun-2024 08:03                6290                            14-Jun-2024 08:03                6092
function.shm-attach.php                            14-Jun-2024 08:03                6114
function.shm-detach.php                            14-Jun-2024 08:03                4721
function.shm-get-var.php                           14-Jun-2024 08:03                4589
function.shm-has-var.php                           14-Jun-2024 08:03                4492
function.shm-put-var.php                           14-Jun-2024 08:03                5706
function.shm-remove-var.php                        14-Jun-2024 08:03                4425
function.shm-remove.php                            14-Jun-2024 08:03                4137
function.shmop-close.php                           14-Jun-2024 08:03                5061
function.shmop-delete.php                          14-Jun-2024 08:03                4382
function.shmop-open.php                            14-Jun-2024 08:03               10283
function.shmop-read.php                            14-Jun-2024 08:03                6929
function.shmop-size.php                            14-Jun-2024 08:03                4447
function.shmop-write.php                           14-Jun-2024 08:03                6418                           14-Jun-2024 08:03                1774
function.shuffle.php                               14-Jun-2024 08:03                7330
function.simdjson-decode.php                       14-Jun-2024 08:03               16999
function.simdjson-is-valid.php                     14-Jun-2024 08:03               10526
function.simdjson-key-count.php                    14-Jun-2024 08:03                4807
function.simdjson-key-exists.php                   14-Jun-2024 08:03                4633
function.simdjson-key-value.php                    14-Jun-2024 08:03                7327
function.similar-text.php                          14-Jun-2024 08:03                7759
function.simplexml-import-dom.php                  14-Jun-2024 08:03                6840
function.simplexml-load-file.php                   14-Jun-2024 08:03               10588
function.simplexml-load-string.php                 14-Jun-2024 08:03               10188
function.sin.php                                   14-Jun-2024 08:03                4542
function.sinh.php                                  14-Jun-2024 08:03                3225
function.sizeof.php                                14-Jun-2024 08:03                1673
function.sleep.php                                 14-Jun-2024 08:03                7543
function.snmp-get-quick-print.php                  14-Jun-2024 08:03                3895
function.snmp-get-valueretrieval.php               14-Jun-2024 08:03                4566
function.snmp-read-mib.php                         14-Jun-2024 08:03                4996
function.snmp-set-enum-print.php                   14-Jun-2024 08:03                5523
function.snmp-set-oid-numeric-print.php            14-Jun-2024 08:03                2357
function.snmp-set-oid-output-format.php            14-Jun-2024 08:03                7876
function.snmp-set-quick-print.php                  14-Jun-2024 08:03                7516
function.snmp-set-valueretrieval.php               14-Jun-2024 08:03                9770
function.snmp2-get.php                             14-Jun-2024 08:03                5981
function.snmp2-getnext.php                         14-Jun-2024 08:03                6458
function.snmp2-real-walk.php                       14-Jun-2024 08:03                6918
function.snmp2-set.php                             14-Jun-2024 08:03               11630
function.snmp2-walk.php                            14-Jun-2024 08:03                7320
function.snmp3-get.php                             14-Jun-2024 08:03                9190
function.snmp3-getnext.php                         14-Jun-2024 08:03                9601
function.snmp3-real-walk.php                       14-Jun-2024 08:03               10183
function.snmp3-set.php                             14-Jun-2024 08:03               14469
function.snmp3-walk.php                            14-Jun-2024 08:03               10752
function.snmpget.php                               14-Jun-2024 08:03                5891
function.snmpgetnext.php                           14-Jun-2024 08:03                6304
function.snmprealwalk.php                          14-Jun-2024 08:03                6739
function.snmpset.php                               14-Jun-2024 08:03               11592
function.snmpwalk.php                              14-Jun-2024 08:03                7270
function.snmpwalkoid.php                           14-Jun-2024 08:03                8002
function.socket-accept.php                         14-Jun-2024 08:03                7149
function.socket-addrinfo-bind.php                  14-Jun-2024 08:03                5482
function.socket-addrinfo-connect.php               14-Jun-2024 08:03                5292
function.socket-addrinfo-explain.php               14-Jun-2024 08:03                4532
function.socket-addrinfo-lookup.php                14-Jun-2024 08:03                6107
function.socket-atmark.php                         14-Jun-2024 08:03                5008
function.socket-bind.php                           14-Jun-2024 08:03               11351
function.socket-clear-error.php                    14-Jun-2024 08:03                4876
function.socket-close.php                          14-Jun-2024 08:03                4661
function.socket-cmsg-space.php                     14-Jun-2024 08:03                3823
function.socket-connect.php                        14-Jun-2024 08:03                8009
function.socket-create-listen.php                  14-Jun-2024 08:03                7583
function.socket-create-pair.php                    14-Jun-2024 08:03               20306
function.socket-create.php                         14-Jun-2024 08:03               14206
function.socket-export-stream.php                  14-Jun-2024 08:03                3610
function.socket-get-option.php                     14-Jun-2024 08:03               33139
function.socket-get-status.php                     14-Jun-2024 08:03                1854
function.socket-getopt.php                         14-Jun-2024 08:03                1837
function.socket-getpeername.php                    14-Jun-2024 08:03                8552
function.socket-getsockname.php                    14-Jun-2024 08:03                7697
function.socket-import-stream.php                  14-Jun-2024 08:03                5228
function.socket-last-error.php                     14-Jun-2024 08:03                7478
function.socket-listen.php                         14-Jun-2024 08:03                7539
function.socket-read.php                           14-Jun-2024 08:03                8320
function.socket-recv.php                           14-Jun-2024 08:03               16818
function.socket-recvfrom.php                       14-Jun-2024 08:03               14249
function.socket-recvmsg.php                        14-Jun-2024 08:03                4508
function.socket-select.php                         14-Jun-2024 08:03               16449
function.socket-send.php                           14-Jun-2024 08:03                7059
function.socket-sendmsg.php                        14-Jun-2024 08:03                4651
function.socket-sendto.php                         14-Jun-2024 08:03               10316
function.socket-set-block.php                      14-Jun-2024 08:03                6366
function.socket-set-blocking.php                   14-Jun-2024 08:03                1874
function.socket-set-nonblock.php                   14-Jun-2024 08:03                6713
function.socket-set-option.php                     14-Jun-2024 08:03               11675
function.socket-set-timeout.php                    14-Jun-2024 08:03                1842
function.socket-setopt.php                         14-Jun-2024 08:03                1831
function.socket-shutdown.php                       14-Jun-2024 08:03                5168
function.socket-strerror.php                       14-Jun-2024 08:03                7374
function.socket-write.php                          14-Jun-2024 08:03                7813
function.socket-wsaprotocol-info-export.php        14-Jun-2024 08:03                5130
function.socket-wsaprotocol-info-import.php        14-Jun-2024 08:03                4498
function.socket-wsaprotocol-info-release.php       14-Jun-2024 08:03                3702
function.sodium-add.php                            14-Jun-2024 08:03                3229
function.sodium-base642bin.php                     14-Jun-2024 08:03                4595
function.sodium-bin2base64.php                     14-Jun-2024 08:03                4125
function.sodium-bin2hex.php                        14-Jun-2024 08:03                2822
function.sodium-compare.php                        14-Jun-2024 08:03                3446
function.sodium-crypto-aead-aes256gcm-decrypt.php  14-Jun-2024 08:03                4826
function.sodium-crypto-aead-aes256gcm-encrypt.php  14-Jun-2024 08:03                4626
function.sodium-crypto-aead-aes256gcm-is-availa..> 14-Jun-2024 08:03                2876
function.sodium-crypto-aead-aes256gcm-keygen.php   14-Jun-2024 08:03                2866
function.sodium-crypto-aead-chacha20poly1305-de..> 14-Jun-2024 08:03                4691
function.sodium-crypto-aead-chacha20poly1305-en..> 14-Jun-2024 08:03                4507
function.sodium-crypto-aead-chacha20poly1305-ie..> 14-Jun-2024 08:03                4921
function.sodium-crypto-aead-chacha20poly1305-ie..> 14-Jun-2024 08:03                4673
function.sodium-crypto-aead-chacha20poly1305-ie..> 14-Jun-2024 08:03                3060
function.sodium-crypto-aead-chacha20poly1305-ke..> 14-Jun-2024 08:03                2995
function.sodium-crypto-aead-xchacha20poly1305-i..> 14-Jun-2024 08:03                5099
function.sodium-crypto-aead-xchacha20poly1305-i..> 14-Jun-2024 08:03                4891
function.sodium-crypto-aead-xchacha20poly1305-i..> 14-Jun-2024 08:03                3036
function.sodium-crypto-auth-keygen.php             14-Jun-2024 08:03                2687
function.sodium-crypto-auth-verify.php             14-Jun-2024 08:03                4033
function.sodium-crypto-auth.php                    14-Jun-2024 08:03                3478
function.sodium-crypto-box-keypair-from-secretk..> 14-Jun-2024 08:03                3557
function.sodium-crypto-box-keypair.php             14-Jun-2024 08:03                2968
function.sodium-crypto-box-open.php                14-Jun-2024 08:03                4126
function.sodium-crypto-box-publickey-from-secre..> 14-Jun-2024 08:03                3388
function.sodium-crypto-box-publickey.php           14-Jun-2024 08:03                3101
function.sodium-crypto-box-seal-open.php           14-Jun-2024 08:03                6179
function.sodium-crypto-box-seal.php                14-Jun-2024 08:03                7305
function.sodium-crypto-box-secretkey.php           14-Jun-2024 08:03                3068
function.sodium-crypto-box-seed-keypair.php        14-Jun-2024 08:03                3127
function.sodium-crypto-box.php                     14-Jun-2024 08:03                4444
function.sodium-crypto-core-ristretto255-add.php   14-Jun-2024 08:03                6173
function.sodium-crypto-core-ristretto255-from-h..> 14-Jun-2024 08:03                5533
function.sodium-crypto-core-ristretto255-is-val..> 14-Jun-2024 08:03                5715
function.sodium-crypto-core-ristretto255-random..> 14-Jun-2024 08:03                5690
function.sodium-crypto-core-ristretto255-scalar..> 14-Jun-2024 08:03                6440
function.sodium-crypto-core-ristretto255-scalar..> 14-Jun-2024 08:03                3673
function.sodium-crypto-core-ristretto255-scalar..> 14-Jun-2024 08:03                5532
function.sodium-crypto-core-ristretto255-scalar..> 14-Jun-2024 08:03                3932
function.sodium-crypto-core-ristretto255-scalar..> 14-Jun-2024 08:03                5516
function.sodium-crypto-core-ristretto255-scalar..> 14-Jun-2024 08:03                5849
function.sodium-crypto-core-ristretto255-scalar..> 14-Jun-2024 08:03                3617
function.sodium-crypto-core-ristretto255-scalar..> 14-Jun-2024 08:03                6431
function.sodium-crypto-core-ristretto255-sub.php   14-Jun-2024 08:03                6210
function.sodium-crypto-generichash-final.php       14-Jun-2024 08:03                6921
function.sodium-crypto-generichash-init.php        14-Jun-2024 08:03                6968
function.sodium-crypto-generichash-keygen.php      14-Jun-2024 08:03                2497
function.sodium-crypto-generichash-update.php      14-Jun-2024 08:03                6604
function.sodium-crypto-generichash.php             14-Jun-2024 08:03                3883
function.sodium-crypto-kdf-derive-from-key.php     14-Jun-2024 08:03                4094
function.sodium-crypto-kdf-keygen.php              14-Jun-2024 08:03                2599
function.sodium-crypto-kx-client-session-keys.php  14-Jun-2024 08:03                3510
function.sodium-crypto-kx-keypair.php              14-Jun-2024 08:03                5052
function.sodium-crypto-kx-publickey.php            14-Jun-2024 08:03                2920
function.sodium-crypto-kx-secretkey.php            14-Jun-2024 08:03                2931
function.sodium-crypto-kx-seed-keypair.php         14-Jun-2024 08:03                2889
function.sodium-crypto-kx-server-session-keys.php  14-Jun-2024 08:03                3576
function.sodium-crypto-pwhash-scryptsalsa208sha..> 14-Jun-2024 08:03                3494
function.sodium-crypto-pwhash-scryptsalsa208sha..> 14-Jun-2024 08:03                3697
function.sodium-crypto-pwhash-scryptsalsa208sha..> 14-Jun-2024 08:03                6576
function.sodium-crypto-pwhash-str-needs-rehash.php 14-Jun-2024 08:03                4053
function.sodium-crypto-pwhash-str-verify.php       14-Jun-2024 08:03                4980
function.sodium-crypto-pwhash-str.php              14-Jun-2024 08:03                8808
function.sodium-crypto-pwhash.php                  14-Jun-2024 08:03               10573
function.sodium-crypto-scalarmult-base.php         14-Jun-2024 08:03                2075
function.sodium-crypto-scalarmult-ristretto255-..> 14-Jun-2024 08:03                3586
function.sodium-crypto-scalarmult-ristretto255.php 14-Jun-2024 08:03                3935
function.sodium-crypto-scalarmult.php              14-Jun-2024 08:03                3102
function.sodium-crypto-secretbox-keygen.php        14-Jun-2024 08:03                6381
function.sodium-crypto-secretbox-open.php          14-Jun-2024 08:03                8983
function.sodium-crypto-secretbox.php               14-Jun-2024 08:03                8983
function.sodium-crypto-secretstream-xchacha20po..> 14-Jun-2024 08:03               11025
function.sodium-crypto-secretstream-xchacha20po..> 14-Jun-2024 08:03               10359
function.sodium-crypto-secretstream-xchacha20po..> 14-Jun-2024 08:03                2763
function.sodium-crypto-secretstream-xchacha20po..> 14-Jun-2024 08:03                5860
function.sodium-crypto-secretstream-xchacha20po..> 14-Jun-2024 08:03                5968
function.sodium-crypto-secretstream-xchacha20po..> 14-Jun-2024 08:03                3024
function.sodium-crypto-shorthash-keygen.php        14-Jun-2024 08:03                2767
function.sodium-crypto-shorthash.php               14-Jun-2024 08:03                3311
function.sodium-crypto-sign-detached.php           14-Jun-2024 08:03                3304
function.sodium-crypto-sign-ed25519-pk-to-curve..> 14-Jun-2024 08:03                2991
function.sodium-crypto-sign-ed25519-sk-to-curve..> 14-Jun-2024 08:03                3144
function.sodium-crypto-sign-keypair-from-secret..> 14-Jun-2024 08:03                3383
function.sodium-crypto-sign-keypair.php            14-Jun-2024 08:03                2485
function.sodium-crypto-sign-open.php               14-Jun-2024 08:03                3395
function.sodium-crypto-sign-publickey-from-secr..> 14-Jun-2024 08:03                2946
function.sodium-crypto-sign-publickey.php          14-Jun-2024 08:03                2956
function.sodium-crypto-sign-secretkey.php          14-Jun-2024 08:03                2932
function.sodium-crypto-sign-seed-keypair.php       14-Jun-2024 08:03                3165
function.sodium-crypto-sign-verify-detached.php    14-Jun-2024 08:03                3713
function.sodium-crypto-sign.php                    14-Jun-2024 08:03                3382
function.sodium-crypto-stream-keygen.php           14-Jun-2024 08:03                2668
function.sodium-crypto-stream-xchacha20-keygen.php 14-Jun-2024 08:03                2826
function.sodium-crypto-stream-xchacha20-xor-ic.php 14-Jun-2024 08:03                9869
function.sodium-crypto-stream-xchacha20-xor.php    14-Jun-2024 08:03                4925
function.sodium-crypto-stream-xchacha20.php        14-Jun-2024 08:03                3838
function.sodium-crypto-stream-xor.php              14-Jun-2024 08:03                3721
function.sodium-crypto-stream.php                  14-Jun-2024 08:03                3557
function.sodium-hex2bin.php                        14-Jun-2024 08:03                3430
function.sodium-increment.php                      14-Jun-2024 08:03                2564
function.sodium-memcmp.php                         14-Jun-2024 08:03                3750
function.sodium-memzero.php                        14-Jun-2024 08:03                2656
function.sodium-pad.php                            14-Jun-2024 08:03                2879
function.sodium-unpad.php                          14-Jun-2024 08:03                2834
function.solr-get-version.php                      14-Jun-2024 08:03                4223
function.sort.php                                  14-Jun-2024 08:03               12778
function.soundex.php                               14-Jun-2024 08:03                7483
function.spl-autoload-call.php                     14-Jun-2024 08:03                2750
function.spl-autoload-extensions.php               14-Jun-2024 08:03                5206
function.spl-autoload-functions.php                14-Jun-2024 08:03                3359
function.spl-autoload-register.php                 14-Jun-2024 08:03               14038
function.spl-autoload-unregister.php               14-Jun-2024 08:03                3161
function.spl-autoload.php                          14-Jun-2024 08:03                4880
function.spl-classes.php                           14-Jun-2024 08:03                3912
function.spl-object-hash.php                       14-Jun-2024 08:03                5341
function.spl-object-id.php                         14-Jun-2024 08:03                4288
function.sprintf.php                               14-Jun-2024 08:03               30668
function.sqlsrv-begin-transaction.php              14-Jun-2024 08:03               11577
function.sqlsrv-cancel.php                         14-Jun-2024 08:03               10649
function.sqlsrv-client-info.php                    14-Jun-2024 08:03                6929
function.sqlsrv-close.php                          14-Jun-2024 08:03                5690
function.sqlsrv-commit.php                         14-Jun-2024 08:03               11343
function.sqlsrv-configure.php                      14-Jun-2024 08:03                5133
function.sqlsrv-connect.php                        14-Jun-2024 08:03               12748
function.sqlsrv-errors.php                         14-Jun-2024 08:03               10424
function.sqlsrv-execute.php                        14-Jun-2024 08:03               10548
function.sqlsrv-fetch-array.php                    14-Jun-2024 08:03               16224
function.sqlsrv-fetch-object.php                   14-Jun-2024 08:03               13171
function.sqlsrv-fetch.php                          14-Jun-2024 08:03               11383
function.sqlsrv-field-metadata.php                 14-Jun-2024 08:03                9311
function.sqlsrv-free-stmt.php                      14-Jun-2024 08:03                8036
function.sqlsrv-get-config.php                     14-Jun-2024 08:03                3429
function.sqlsrv-get-field.php                      14-Jun-2024 08:03               10795
function.sqlsrv-has-rows.php                       14-Jun-2024 08:03                6512
function.sqlsrv-next-result.php                    14-Jun-2024 08:03                9590
function.sqlsrv-num-fields.php                     14-Jun-2024 08:03                8456
function.sqlsrv-num-rows.php                       14-Jun-2024 08:03                8269
function.sqlsrv-prepare.php                        14-Jun-2024 08:03               15336
function.sqlsrv-query.php                          14-Jun-2024 08:03               12387
function.sqlsrv-rollback.php                       14-Jun-2024 08:03               10801
function.sqlsrv-rows-affected.php                  14-Jun-2024 08:03                8128
function.sqlsrv-send-stream-data.php               14-Jun-2024 08:03                8795
function.sqlsrv-server-info.php                    14-Jun-2024 08:03                6260
function.sqrt.php                                  14-Jun-2024 08:03                4644
function.srand.php                                 14-Jun-2024 08:03                7690
function.sscanf.php                                14-Jun-2024 08:03               12040
function.ssdeep-fuzzy-compare.php                  14-Jun-2024 08:03                3449
function.ssdeep-fuzzy-hash-filename.php            14-Jun-2024 08:03                3204
function.ssdeep-fuzzy-hash.php                     14-Jun-2024 08:03                3178
function.ssh2-auth-agent.php                       14-Jun-2024 08:03                4905
function.ssh2-auth-hostbased-file.php              14-Jun-2024 08:03                7939
function.ssh2-auth-none.php                        14-Jun-2024 08:03                5042
function.ssh2-auth-password.php                    14-Jun-2024 08:03                5188
function.ssh2-auth-pubkey-file.php                 14-Jun-2024 08:03                7528
function.ssh2-connect.php                          14-Jun-2024 08:03               16734
function.ssh2-disconnect.php                       14-Jun-2024 08:03                3193
function.ssh2-exec.php                             14-Jun-2024 08:03                7736
function.ssh2-fetch-stream.php                     14-Jun-2024 08:03                5649
function.ssh2-fingerprint.php                      14-Jun-2024 08:03                5701
function.ssh2-forward-accept.php                   14-Jun-2024 08:03                3145
function.ssh2-forward-listen.php                   14-Jun-2024 08:03                4588
function.ssh2-methods-negotiated.php               14-Jun-2024 08:03                8119
function.ssh2-poll.php                             14-Jun-2024 08:03                3624
function.ssh2-publickey-add.php                    14-Jun-2024 08:03                8786
function.ssh2-publickey-init.php                   14-Jun-2024 08:03                4930
function.ssh2-publickey-list.php                   14-Jun-2024 08:03                9229
function.ssh2-publickey-remove.php                 14-Jun-2024 08:03                4972
function.ssh2-scp-recv.php                         14-Jun-2024 08:03                5574
function.ssh2-scp-send.php                         14-Jun-2024 08:03                6180
function.ssh2-send-eof.php                         14-Jun-2024 08:03                3542
function.ssh2-sftp-chmod.php                       14-Jun-2024 08:03                6178
function.ssh2-sftp-lstat.php                       14-Jun-2024 08:03                7464
function.ssh2-sftp-mkdir.php                       14-Jun-2024 08:03                6922
function.ssh2-sftp-readlink.php                    14-Jun-2024 08:03                5455
function.ssh2-sftp-realpath.php                    14-Jun-2024 08:03                5778
function.ssh2-sftp-rename.php                      14-Jun-2024 08:03                5600
function.ssh2-sftp-rmdir.php                       14-Jun-2024 08:03                5700
function.ssh2-sftp-stat.php                        14-Jun-2024 08:03                7407
function.ssh2-sftp-symlink.php                     14-Jun-2024 08:03                5791
function.ssh2-sftp-unlink.php                      14-Jun-2024 08:03                5156
function.ssh2-sftp.php                             14-Jun-2024 08:03                5615
function.ssh2-shell.php                            14-Jun-2024 08:03                8213
function.ssh2-tunnel.php                           14-Jun-2024 08:03                5385
function.stat.php                                  14-Jun-2024 08:03               17143
function.stats-absolute-deviation.php              14-Jun-2024 08:03                2877
function.stats-cdf-beta.php                        14-Jun-2024 08:03                5241
function.stats-cdf-binomial.php                    14-Jun-2024 08:03                5226
function.stats-cdf-cauchy.php                      14-Jun-2024 08:03                5261
function.stats-cdf-chisquare.php                   14-Jun-2024 08:03                4580
function.stats-cdf-exponential.php                 14-Jun-2024 08:03                4611
function.stats-cdf-f.php                           14-Jun-2024 08:03                5166
function.stats-cdf-gamma.php                       14-Jun-2024 08:03                5225
function.stats-cdf-laplace.php                     14-Jun-2024 08:03                5246
function.stats-cdf-logistic.php                    14-Jun-2024 08:03                5281
function.stats-cdf-negative-binomial.php           14-Jun-2024 08:03                5369
function.stats-cdf-noncentral-chisquare.php        14-Jun-2024 08:03                5471
function.stats-cdf-noncentral-f.php                14-Jun-2024 08:03                6045
function.stats-cdf-noncentral-t.php                14-Jun-2024 08:03                5331
function.stats-cdf-normal.php                      14-Jun-2024 08:03                5263
function.stats-cdf-poisson.php                     14-Jun-2024 08:03                4545
function.stats-cdf-t.php                           14-Jun-2024 08:03                4473
function.stats-cdf-uniform.php                     14-Jun-2024 08:03                5226
function.stats-cdf-weibull.php                     14-Jun-2024 08:03                5263
function.stats-covariance.php                      14-Jun-2024 08:03                3074
function.stats-dens-beta.php                       14-Jun-2024 08:03                3560
function.stats-dens-cauchy.php                     14-Jun-2024 08:03                3618
function.stats-dens-chisquare.php                  14-Jun-2024 08:03                3288
function.stats-dens-exponential.php                14-Jun-2024 08:03                3278
function.stats-dens-f.php                          14-Jun-2024 08:03                3558
function.stats-dens-gamma.php                      14-Jun-2024 08:03                3611
function.stats-dens-laplace.php                    14-Jun-2024 08:03                3645
function.stats-dens-logistic.php                   14-Jun-2024 08:03                3657
function.stats-dens-normal.php                     14-Jun-2024 08:03                3628
function.stats-dens-pmf-binomial.php               14-Jun-2024 08:03                3682
function.stats-dens-pmf-hypergeometric.php         14-Jun-2024 08:03                4334
function.stats-dens-pmf-negative-binomial.php      14-Jun-2024 08:03                3811
function.stats-dens-pmf-poisson.php                14-Jun-2024 08:03                3279
function.stats-dens-t.php                          14-Jun-2024 08:03                3192
function.stats-dens-uniform.php                    14-Jun-2024 08:03                3593
function.stats-dens-weibull.php                    14-Jun-2024 08:03                3625
function.stats-harmonic-mean.php                   14-Jun-2024 08:03                2773
function.stats-kurtosis.php                        14-Jun-2024 08:03                2781
function.stats-rand-gen-beta.php                   14-Jun-2024 08:03                3087
function.stats-rand-gen-chisquare.php              14-Jun-2024 08:03                2760
function.stats-rand-gen-exponential.php            14-Jun-2024 08:03                2758
function.stats-rand-gen-f.php                      14-Jun-2024 08:03                3141
function.stats-rand-gen-funiform.php               14-Jun-2024 08:03                3068
function.stats-rand-gen-gamma.php                  14-Jun-2024 08:03                3154
function.stats-rand-gen-ibinomial-negative.php     14-Jun-2024 08:03                3234
function.stats-rand-gen-ibinomial.php              14-Jun-2024 08:03                3158
function.stats-rand-gen-int.php                    14-Jun-2024 08:03                2338
function.stats-rand-gen-ipoisson.php               14-Jun-2024 08:03                2733
function.stats-rand-gen-iuniform.php               14-Jun-2024 08:03                3135
function.stats-rand-gen-noncentral-chisquare.php   14-Jun-2024 08:03                3276
function.stats-rand-gen-noncentral-f.php           14-Jun-2024 08:03                3629
function.stats-rand-gen-noncentral-t.php           14-Jun-2024 08:03                3189
function.stats-rand-gen-normal.php                 14-Jun-2024 08:03                3102
function.stats-rand-gen-t.php                      14-Jun-2024 08:03                2652
function.stats-rand-get-seeds.php                  14-Jun-2024 08:03                2381
function.stats-rand-phrase-to-seeds.php            14-Jun-2024 08:03                2741
function.stats-rand-ranf.php                       14-Jun-2024 08:03                2382
function.stats-rand-setall.php                     14-Jun-2024 08:03                3010
function.stats-skew.php                            14-Jun-2024 08:03                2747
function.stats-standard-deviation.php              14-Jun-2024 08:03                3920
function.stats-stat-binomial-coef.php              14-Jun-2024 08:03                3047
function.stats-stat-correlation.php                14-Jun-2024 08:03                3254
function.stats-stat-factorial.php                  14-Jun-2024 08:03                2620
function.stats-stat-independent-t.php              14-Jun-2024 08:03                3392
function.stats-stat-innerproduct.php               14-Jun-2024 08:03                3196
function.stats-stat-paired-t.php                   14-Jun-2024 08:03                3133
function.stats-stat-percentile.php                 14-Jun-2024 08:03                2999
function.stats-stat-powersum.php                   14-Jun-2024 08:03                2991
function.stats-variance.php                        14-Jun-2024 08:03                3418
function.stomp-connect-error.php                   14-Jun-2024 08:03                3803
function.stomp-version.php                         14-Jun-2024 08:03                3189
function.str-contains.php                          14-Jun-2024 08:03                8733
function.str-decrement.php                         14-Jun-2024 08:03                7069
function.str-ends-with.php                         14-Jun-2024 08:03                8665
function.str-getcsv.php                            14-Jun-2024 08:03                9830
function.str-increment.php                         14-Jun-2024 08:03                6715
function.str-ireplace.php                          14-Jun-2024 08:03               10496
function.str-pad.php                               14-Jun-2024 08:03                8515
function.str-repeat.php                            14-Jun-2024 08:03                4880
function.str-replace.php                           14-Jun-2024 08:03               17843
function.str-rot13.php                             14-Jun-2024 08:03                3767
function.str-shuffle.php                           14-Jun-2024 08:03                6367
function.str-split.php                             14-Jun-2024 08:03                9081
function.str-starts-with.php                       14-Jun-2024 08:03                8685
function.str-word-count.php                        14-Jun-2024 08:03                9542
function.strcasecmp.php                            14-Jun-2024 08:03                6486
function.strchr.php                                14-Jun-2024 08:03                1721
function.strcmp.php                                14-Jun-2024 08:03                6439
function.strcoll.php                               14-Jun-2024 08:03                5378
function.strcspn.php                               14-Jun-2024 08:03               11805                  14-Jun-2024 08:03                2359          14-Jun-2024 08:03                4543                     14-Jun-2024 08:03                2398                 14-Jun-2024 08:03                6451                 14-Jun-2024 08:03                7935            14-Jun-2024 08:03                9159            14-Jun-2024 08:03                4763             14-Jun-2024 08:03                5608            14-Jun-2024 08:03                6424             14-Jun-2024 08:03                5871            14-Jun-2024 08:03                6486             14-Jun-2024 08:03                4967                 14-Jun-2024 08:03                7850                  14-Jun-2024 08:03               11322                 14-Jun-2024 08:03                8624                14-Jun-2024 08:03               18728                  14-Jun-2024 08:03                6906                   14-Jun-2024 08:03                9352                    14-Jun-2024 08:03                4164                       14-Jun-2024 08:03                5584                  14-Jun-2024 08:03               15732                 14-Jun-2024 08:03                4212                   14-Jun-2024 08:03                5030                       14-Jun-2024 08:03                4442                         14-Jun-2024 08:03                4140          14-Jun-2024 08:03               22841               14-Jun-2024 08:03                1956           14-Jun-2024 08:03                4527                         14-Jun-2024 08:03               17168                   14-Jun-2024 08:03                5000                 14-Jun-2024 08:03                4427                14-Jun-2024 08:03                3868                    14-Jun-2024 08:03                8413               14-Jun-2024 08:03                6085                  14-Jun-2024 08:03                7798                  14-Jun-2024 08:03               18278           14-Jun-2024 08:03               13661                14-Jun-2024 08:03                4122                    14-Jun-2024 08:03                9992                14-Jun-2024 08:03               11119                  14-Jun-2024 08:03                7816                  14-Jun-2024 08:03               15632                14-Jun-2024 08:03                6742                  14-Jun-2024 08:03                3299               14-Jun-2024 08:03                9676                14-Jun-2024 08:03                3038             14-Jun-2024 08:03                3262
function.strftime.php                              14-Jun-2024 08:03               57717
function.strip-tags.php                            14-Jun-2024 08:03                9900
function.stripcslashes.php                         14-Jun-2024 08:03                4256
function.stripos.php                               14-Jun-2024 08:03               12760
function.stripslashes.php                          14-Jun-2024 08:03                7818
function.stristr.php                               14-Jun-2024 08:03               11060
function.strlen.php                                14-Jun-2024 08:03                5159
function.strnatcasecmp.php                         14-Jun-2024 08:03                7954
function.strnatcmp.php                             14-Jun-2024 08:03                8975
function.strncasecmp.php                           14-Jun-2024 08:03                7240
function.strncmp.php                               14-Jun-2024 08:03                7198
function.strpbrk.php                               14-Jun-2024 08:03                5578
function.strpos.php                                14-Jun-2024 08:03               14598
function.strptime.php                              14-Jun-2024 08:03               11574
function.strrchr.php                               14-Jun-2024 08:03                8831
function.strrev.php                                14-Jun-2024 08:03                3317
function.strripos.php                              14-Jun-2024 08:03               11526
function.strrpos.php                               14-Jun-2024 08:03               14157
function.strspn.php                                14-Jun-2024 08:03               11119
function.strstr.php                                14-Jun-2024 08:03                9305
function.strtok.php                                14-Jun-2024 08:03               14113
function.strtolower.php                            14-Jun-2024 08:03                6113
function.strtotime.php                             14-Jun-2024 08:03               13403
function.strtoupper.php                            14-Jun-2024 08:03                6212
function.strtr.php                                 14-Jun-2024 08:03               11742
function.strval.php                                14-Jun-2024 08:03                6676
function.substr-compare.php                        14-Jun-2024 08:03               11192
function.substr-count.php                          14-Jun-2024 08:03               10007
function.substr-replace.php                        14-Jun-2024 08:03               16474
function.substr.php                                14-Jun-2024 08:03               23219
function.svn-add.php                               14-Jun-2024 08:03                6918
function.svn-auth-get-parameter.php                14-Jun-2024 08:03                4210
function.svn-auth-set-parameter.php                14-Jun-2024 08:03                5719
function.svn-blame.php                             14-Jun-2024 08:03                5136
function.svn-cat.php                               14-Jun-2024 08:03                5064
function.svn-checkout.php                          14-Jun-2024 08:03                7881
function.svn-cleanup.php                           14-Jun-2024 08:03                5541
function.svn-client-version.php                    14-Jun-2024 08:03                3642
function.svn-commit.php                            14-Jun-2024 08:03                8793
function.svn-delete.php                            14-Jun-2024 08:03                5057
function.svn-diff.php                              14-Jun-2024 08:03               13920
function.svn-export.php                            14-Jun-2024 08:03                5519
function.svn-fs-abort-txn.php                      14-Jun-2024 08:03                3563
function.svn-fs-apply-text.php                     14-Jun-2024 08:03                2912
function.svn-fs-begin-txn2.php                     14-Jun-2024 08:03                2857
function.svn-fs-change-node-prop.php               14-Jun-2024 08:03                3685
function.svn-fs-check-path.php                     14-Jun-2024 08:03                2945
function.svn-fs-contents-changed.php               14-Jun-2024 08:03                3709
function.svn-fs-copy.php                           14-Jun-2024 08:03                4324
function.svn-fs-delete.php                         14-Jun-2024 08:03                3627
function.svn-fs-dir-entries.php                    14-Jun-2024 08:03                2874
function.svn-fs-file-contents.php                  14-Jun-2024 08:03                3009
function.svn-fs-file-length.php                    14-Jun-2024 08:03                2914
function.svn-fs-is-dir.php                         14-Jun-2024 08:03                3657
function.svn-fs-is-file.php                        14-Jun-2024 08:03                3660
function.svn-fs-make-dir.php                       14-Jun-2024 08:03                3638
function.svn-fs-make-file.php                      14-Jun-2024 08:03                3670
function.svn-fs-node-created-rev.php               14-Jun-2024 08:03                2979
function.svn-fs-node-prop.php                      14-Jun-2024 08:03                3077
function.svn-fs-props-changed.php                  14-Jun-2024 08:03                3717
function.svn-fs-revision-prop.php                  14-Jun-2024 08:03                3088
function.svn-fs-revision-root.php                  14-Jun-2024 08:03                2987
function.svn-fs-txn-root.php                       14-Jun-2024 08:03                2683
function.svn-fs-youngest-rev.php                   14-Jun-2024 08:03                2765
function.svn-import.php                            14-Jun-2024 08:03                6505
function.svn-log.php                               14-Jun-2024 08:03                9718
function.svn-ls.php                                14-Jun-2024 08:03                7691
function.svn-mkdir.php                             14-Jun-2024 08:03                3412
function.svn-repos-create.php                      14-Jun-2024 08:03                3133
function.svn-repos-fs-begin-txn-for-commit.php     14-Jun-2024 08:03                3445
function.svn-repos-fs-commit-txn.php               14-Jun-2024 08:03                2800
function.svn-repos-fs.php                          14-Jun-2024 08:03                2694
function.svn-repos-hotcopy.php                     14-Jun-2024 08:03                3058
function.svn-repos-open.php                        14-Jun-2024 08:03                2683
function.svn-repos-recover.php                     14-Jun-2024 08:03                2709
function.svn-revert.php                            14-Jun-2024 08:03                3807
function.svn-status.php                            14-Jun-2024 08:03               15829
function.svn-update.php                            14-Jun-2024 08:03                6732
function.swoole-async-dns-lookup.php               14-Jun-2024 08:03                3933
function.swoole-async-read.php                     14-Jun-2024 08:03                4519
function.swoole-async-readfile.php                 14-Jun-2024 08:03                3955
function.swoole-async-set.php                      14-Jun-2024 08:03                2481
function.swoole-async-write.php                    14-Jun-2024 08:03                3835
function.swoole-async-writefile.php                14-Jun-2024 08:03                3863
function.swoole-clear-error.php                    14-Jun-2024 08:03                2351
function.swoole-client-select.php                  14-Jun-2024 08:03                3551
function.swoole-cpu-num.php                        14-Jun-2024 08:03                2190
function.swoole-errno.php                          14-Jun-2024 08:03                2167
function.swoole-error-log.php                      14-Jun-2024 08:03                3632
function.swoole-event-add.php                      14-Jun-2024 08:03                3558
function.swoole-event-defer.php                    14-Jun-2024 08:03                2718
function.swoole-event-del.php                      14-Jun-2024 08:03                2684
function.swoole-event-exit.php                     14-Jun-2024 08:03                2233
function.swoole-event-set.php                      14-Jun-2024 08:03                3546
function.swoole-event-wait.php                     14-Jun-2024 08:03                2204
function.swoole-event-write.php                    14-Jun-2024 08:03                2956
function.swoole-get-local-ip.php                   14-Jun-2024 08:03                2261
function.swoole-last-error.php                     14-Jun-2024 08:03                2216
function.swoole-load-module.php                    14-Jun-2024 08:03                2374
function.swoole-select.php                         14-Jun-2024 08:03                3518
function.swoole-set-process-name.php               14-Jun-2024 08:03                2691
function.swoole-strerror.php                       14-Jun-2024 08:03                2645
function.swoole-timer-after.php                    14-Jun-2024 08:03                3069
function.swoole-timer-exists.php                   14-Jun-2024 08:03                2482
function.swoole-timer-tick.php                     14-Jun-2024 08:03                2946
function.swoole-version.php                        14-Jun-2024 08:03                2195
function.symlink.php                               14-Jun-2024 08:03                5680
function.sys-get-temp-dir.php                      14-Jun-2024 08:03                4332
function.sys-getloadavg.php                        14-Jun-2024 08:03                4340
function.syslog.php                                14-Jun-2024 08:03                9684
function.system.php                                14-Jun-2024 08:03                8036
function.taint.php                                 14-Jun-2024 08:03                2909
function.tan.php                                   14-Jun-2024 08:03                4216
function.tanh.php                                  14-Jun-2024 08:03                3239
function.tcpwrap-check.php                         14-Jun-2024 08:03                6043
function.tempnam.php                               14-Jun-2024 08:03                7408
function.textdomain.php                            14-Jun-2024 08:03                3382
function.tidy-access-count.php                     14-Jun-2024 08:03                6540
function.tidy-config-count.php                     14-Jun-2024 08:03                4470
function.tidy-error-count.php                      14-Jun-2024 08:03                5506
function.tidy-get-output.php                       14-Jun-2024 08:03                4420
function.tidy-warning-count.php                    14-Jun-2024 08:03                4974
function.time-nanosleep.php                        14-Jun-2024 08:03                8927
function.time-sleep-until.php                      14-Jun-2024 08:03                6114
function.time.php                                  14-Jun-2024 08:03                4836
function.timezone-abbreviations-list.php           14-Jun-2024 08:03                1950
function.timezone-identifiers-list.php             14-Jun-2024 08:03                1966
function.timezone-location-get.php                 14-Jun-2024 08:03                1922
function.timezone-name-from-abbr.php               14-Jun-2024 08:03                6595
function.timezone-name-get.php                     14-Jun-2024 08:03                1866
function.timezone-offset-get.php                   14-Jun-2024 08:03                1864
function.timezone-open.php                         14-Jun-2024 08:03                1852
function.timezone-transitions-get.php              14-Jun-2024 08:03                1925
function.timezone-version-get.php                  14-Jun-2024 08:03                4598
function.tmpfile.php                               14-Jun-2024 08:03                5803
function.token-get-all.php                         14-Jun-2024 08:03               12283
function.token-name.php                            14-Jun-2024 08:03                4269
function.touch.php                                 14-Jun-2024 08:03                8306
function.trader-acos.php                           14-Jun-2024 08:03                2651
function.trader-ad.php                             14-Jun-2024 08:03                3591
function.trader-add.php                            14-Jun-2024 08:03                2993
function.trader-adosc.php                          14-Jun-2024 08:03                4455
function.trader-adx.php                            14-Jun-2024 08:03                3671
function.trader-adxr.php                           14-Jun-2024 08:03                3682
function.trader-apo.php                            14-Jun-2024 08:03                3871
function.trader-aroon.php                          14-Jun-2024 08:03                3234
function.trader-aroonosc.php                       14-Jun-2024 08:03                3271
function.trader-asin.php                           14-Jun-2024 08:03                2666
function.trader-atan.php                           14-Jun-2024 08:03                2661
function.trader-atr.php                            14-Jun-2024 08:03                3661
function.trader-avgprice.php                       14-Jun-2024 08:03                3642
function.trader-bbands.php                         14-Jun-2024 08:03                4674
function.trader-beta.php                           14-Jun-2024 08:03                3201
function.trader-bop.php                            14-Jun-2024 08:03                3591
function.trader-cci.php                            14-Jun-2024 08:03                3666
function.trader-cdl2crows.php                      14-Jun-2024 08:03                3664
function.trader-cdl3blackcrows.php                 14-Jun-2024 08:03                3726
function.trader-cdl3inside.php                     14-Jun-2024 08:03                3718
function.trader-cdl3linestrike.php                 14-Jun-2024 08:03                3730
function.trader-cdl3outside.php                    14-Jun-2024 08:03                3722
function.trader-cdl3starsinsouth.php               14-Jun-2024 08:03                3771
function.trader-cdl3whitesoldiers.php              14-Jun-2024 08:03                3795
function.trader-cdlabandonedbaby.php               14-Jun-2024 08:03                4192
function.trader-cdladvanceblock.php                14-Jun-2024 08:03                3748
function.trader-cdlbelthold.php                    14-Jun-2024 08:03                3704
function.trader-cdlbreakaway.php                   14-Jun-2024 08:03                3718
function.trader-cdlclosingmarubozu.php             14-Jun-2024 08:03                3789
function.trader-cdlconcealbabyswall.php            14-Jun-2024 08:03                3812
function.trader-cdlcounterattack.php               14-Jun-2024 08:03                3776
function.trader-cdldarkcloudcover.php              14-Jun-2024 08:03                4186
function.trader-cdldoji.php                        14-Jun-2024 08:03                3661
function.trader-cdldojistar.php                    14-Jun-2024 08:03                3696
function.trader-cdldragonflydoji.php               14-Jun-2024 08:03                3751
function.trader-cdlengulfing.php                   14-Jun-2024 08:03                3736
function.trader-cdleveningdojistar.php             14-Jun-2024 08:03                4203
function.trader-cdleveningstar.php                 14-Jun-2024 08:03                4180
function.trader-cdlgapsidesidewhite.php            14-Jun-2024 08:03                3778
function.trader-cdlgravestonedoji.php              14-Jun-2024 08:03                3772
function.trader-cdlhammer.php                      14-Jun-2024 08:03                3687
function.trader-cdlhangingman.php                  14-Jun-2024 08:03                3708
function.trader-cdlharami.php                      14-Jun-2024 08:03                3689
function.trader-cdlharamicross.php                 14-Jun-2024 08:03                3731
function.trader-cdlhighwave.php                    14-Jun-2024 08:03                3705
function.trader-cdlhikkake.php                     14-Jun-2024 08:03                3694
function.trader-cdlhikkakemod.php                  14-Jun-2024 08:03                3735
function.trader-cdlhomingpigeon.php                14-Jun-2024 08:03                3756
function.trader-cdlidentical3crows.php             14-Jun-2024 08:03                3780
function.trader-cdlinneck.php                      14-Jun-2024 08:03                3705
function.trader-cdlinvertedhammer.php              14-Jun-2024 08:03                3755
function.trader-cdlkicking.php                     14-Jun-2024 08:03                3708
function.trader-cdlkickingbylength.php             14-Jun-2024 08:03                3813
function.trader-cdlladderbottom.php                14-Jun-2024 08:03                3773
function.trader-cdllongleggeddoji.php              14-Jun-2024 08:03                3779
function.trader-cdllongline.php                    14-Jun-2024 08:03                3713
function.trader-cdlmarubozu.php                    14-Jun-2024 08:03                3699
function.trader-cdlmatchinglow.php                 14-Jun-2024 08:03                3725
function.trader-cdlmathold.php                     14-Jun-2024 08:03                4126
function.trader-cdlmorningdojistar.php             14-Jun-2024 08:03                4202
function.trader-cdlmorningstar.php                 14-Jun-2024 08:03                4163
function.trader-cdlonneck.php                      14-Jun-2024 08:03                3685
function.trader-cdlpiercing.php                    14-Jun-2024 08:03                3702
function.trader-cdlrickshawman.php                 14-Jun-2024 08:03                3743
function.trader-cdlrisefall3methods.php            14-Jun-2024 08:03                3814
function.trader-cdlseparatinglines.php             14-Jun-2024 08:03                3796
function.trader-cdlshootingstar.php                14-Jun-2024 08:03                3755
function.trader-cdlshortline.php                   14-Jun-2024 08:03                3731
function.trader-cdlspinningtop.php                 14-Jun-2024 08:03                3735
function.trader-cdlstalledpattern.php              14-Jun-2024 08:03                3783
function.trader-cdlsticksandwich.php               14-Jun-2024 08:03                3761
function.trader-cdltakuri.php                      14-Jun-2024 08:03                3740
function.trader-cdltasukigap.php                   14-Jun-2024 08:03                3705
function.trader-cdlthrusting.php                   14-Jun-2024 08:03                3713
function.trader-cdltristar.php                     14-Jun-2024 08:03                3699
function.trader-cdlunique3river.php                14-Jun-2024 08:03                3751
function.trader-cdlupsidegap2crows.php             14-Jun-2024 08:03                3811
function.trader-cdlxsidegap3methods.php            14-Jun-2024 08:03                3816
function.trader-ceil.php                           14-Jun-2024 08:03                2708
function.trader-cmo.php                            14-Jun-2024 08:03                2917
function.trader-correl.php                         14-Jun-2024 08:03                3261
function.trader-cos.php                            14-Jun-2024 08:03                2662
function.trader-cosh.php                           14-Jun-2024 08:03                2680
function.trader-dema.php                           14-Jun-2024 08:03                2928
function.trader-div.php                            14-Jun-2024 08:03                3038
function.trader-dx.php                             14-Jun-2024 08:03                3867
function.trader-ema.php                            14-Jun-2024 08:03                2903
function.trader-errno.php                          14-Jun-2024 08:03                2296
function.trader-exp.php                            14-Jun-2024 08:03                2742
function.trader-floor.php                          14-Jun-2024 08:03                2703
function.trader-get-compat.php                     14-Jun-2024 08:03                2546
function.trader-get-unstable-period.php            14-Jun-2024 08:03                2916
function.trader-ht-dcperiod.php                    14-Jun-2024 08:03                2678
function.trader-ht-dcphase.php                     14-Jun-2024 08:03                2647
function.trader-ht-phasor.php                      14-Jun-2024 08:03                2630
function.trader-ht-sine.php                        14-Jun-2024 08:03                2613
function.trader-ht-trendline.php                   14-Jun-2024 08:03                2663
function.trader-ht-trendmode.php                   14-Jun-2024 08:03                2663
function.trader-kama.php                           14-Jun-2024 08:03                2966
function.trader-linearreg-angle.php                14-Jun-2024 08:03                3065
function.trader-linearreg-intercept.php            14-Jun-2024 08:03                3126
function.trader-linearreg-slope.php                14-Jun-2024 08:03                3075
function.trader-linearreg.php                      14-Jun-2024 08:03                2979
function.trader-ln.php                             14-Jun-2024 08:03                2660
function.trader-log10.php                          14-Jun-2024 08:03                2661
function.trader-ma.php                             14-Jun-2024 08:03                3343
function.trader-macd.php                           14-Jun-2024 08:03                3869
function.trader-macdext.php                        14-Jun-2024 08:03                5402
function.trader-macdfix.php                        14-Jun-2024 08:03                3026
function.trader-mama.php                           14-Jun-2024 08:03                3370
function.trader-mavp.php                           14-Jun-2024 08:03                4306
function.trader-max.php                            14-Jun-2024 08:03                2946
function.trader-maxindex.php                       14-Jun-2024 08:03                3007
function.trader-medprice.php                       14-Jun-2024 08:03                2904
function.trader-mfi.php                            14-Jun-2024 08:03                4048
function.trader-midpoint.php                       14-Jun-2024 08:03                2963
function.trader-midprice.php                       14-Jun-2024 08:03                3293
function.trader-min.php                            14-Jun-2024 08:03                2950
function.trader-minindex.php                       14-Jun-2024 08:03                3000
function.trader-minmax.php                         14-Jun-2024 08:03                2992
function.trader-minmaxindex.php                    14-Jun-2024 08:03                3044
function.trader-minus-di.php                       14-Jun-2024 08:03                3746
function.trader-minus-dm.php                       14-Jun-2024 08:03                3297
function.trader-mom.php                            14-Jun-2024 08:03                2897
function.trader-mult.php                           14-Jun-2024 08:03                3008
function.trader-natr.php                           14-Jun-2024 08:03                3684
function.trader-obv.php                            14-Jun-2024 08:03                2866
function.trader-plus-di.php                        14-Jun-2024 08:03                3715
function.trader-plus-dm.php                        14-Jun-2024 08:03                3282
function.trader-ppo.php                            14-Jun-2024 08:03                3887
function.trader-roc.php                            14-Jun-2024 08:03                2925
function.trader-rocp.php                           14-Jun-2024 08:03                2958
function.trader-rocr.php                           14-Jun-2024 08:03                2945
function.trader-rocr100.php                        14-Jun-2024 08:03                2997
function.trader-rsi.php                            14-Jun-2024 08:03                2907
function.trader-sar.php                            14-Jun-2024 08:03                3973
function.trader-sarext.php                         14-Jun-2024 08:03                7570
function.trader-set-compat.php                     14-Jun-2024 08:03                2803
function.trader-set-unstable-period.php            14-Jun-2024 08:03                3441
function.trader-sin.php                            14-Jun-2024 08:03                2673
function.trader-sinh.php                           14-Jun-2024 08:03                2665
function.trader-sma.php                            14-Jun-2024 08:03                2906
function.trader-sqrt.php                           14-Jun-2024 08:03                2661
function.trader-stddev.php                         14-Jun-2024 08:03                3251
function.trader-stoch.php                          14-Jun-2024 08:03                5605
function.trader-stochf.php                         14-Jun-2024 08:03                4698
function.trader-stochrsi.php                       14-Jun-2024 08:03                4422
function.trader-sub.php                            14-Jun-2024 08:03                3019
function.trader-sum.php                            14-Jun-2024 08:03                2882
function.trader-t3.php                             14-Jun-2024 08:03                3271
function.trader-tan.php                            14-Jun-2024 08:03                2648
function.trader-tanh.php                           14-Jun-2024 08:03                2674
function.trader-tema.php                           14-Jun-2024 08:03                2929
function.trader-trange.php                         14-Jun-2024 08:03                3198
function.trader-trima.php                          14-Jun-2024 08:03                2931
function.trader-trix.php                           14-Jun-2024 08:03                2958
function.trader-tsf.php                            14-Jun-2024 08:03                2926
function.trader-typprice.php                       14-Jun-2024 08:03                3220
function.trader-ultosc.php                         14-Jun-2024 08:03                4606
function.trader-var.php                            14-Jun-2024 08:03                3215
function.trader-wclprice.php                       14-Jun-2024 08:03                3225
function.trader-willr.php                          14-Jun-2024 08:03                3681
function.trader-wma.php                            14-Jun-2024 08:03                2940
function.trait-exists.php                          14-Jun-2024 08:03                3160
function.trigger-error.php                         14-Jun-2024 08:03                8261
function.trim.php                                  14-Jun-2024 08:03               14189
function.uasort.php                                14-Jun-2024 08:03               10538
function.ucfirst.php                               14-Jun-2024 08:03                6236
function.ucwords.php                               14-Jun-2024 08:03               10054
function.ui-draw-text-font-fontfamilies.php        14-Jun-2024 08:03                2467
function.ui-quit.php                               14-Jun-2024 08:03                2110
function.ui-run.php                                14-Jun-2024 08:03                2540
function.uksort.php                                14-Jun-2024 08:03                9920
function.umask.php                                 14-Jun-2024 08:03                5918
function.uniqid.php                                14-Jun-2024 08:03                8876
function.unixtojd.php                              14-Jun-2024 08:03                4081
function.unlink.php                                14-Jun-2024 08:03                6442
function.unpack.php                                14-Jun-2024 08:03               11131
function.unregister-tick-function.php              14-Jun-2024 08:03                3220
function.unserialize.php                           14-Jun-2024 08:03               18242
function.unset.php                                 14-Jun-2024 08:03               15522
function.untaint.php                               14-Jun-2024 08:03                2612
function.uopz-add-function.php                     14-Jun-2024 08:03                7220
function.uopz-allow-exit.php                       14-Jun-2024 08:03                4689
function.uopz-backup.php                           14-Jun-2024 08:03                4656
function.uopz-compose.php                          14-Jun-2024 08:03                7052
function.uopz-copy.php                             14-Jun-2024 08:03                5289
function.uopz-del-function.php                     14-Jun-2024 08:03                6657
function.uopz-delete.php                           14-Jun-2024 08:03                6094
function.uopz-extend.php                           14-Jun-2024 08:03                5179
function.uopz-flags.php                            14-Jun-2024 08:03               11393
function.uopz-function.php                         14-Jun-2024 08:03                7484
function.uopz-get-exit-status.php                  14-Jun-2024 08:03                4240
function.uopz-get-hook.php                         14-Jun-2024 08:03                5390
function.uopz-get-mock.php                         14-Jun-2024 08:03                5008
function.uopz-get-property.php                     14-Jun-2024 08:03                6253
function.uopz-get-return.php                       14-Jun-2024 08:03                4497
function.uopz-get-static.php                       14-Jun-2024 08:03                5208
function.uopz-implement.php                        14-Jun-2024 08:03                5209
function.uopz-overload.php                         14-Jun-2024 08:03                4071
function.uopz-redefine.php                         14-Jun-2024 08:03                5267
function.uopz-rename.php                           14-Jun-2024 08:03                6910
function.uopz-restore.php                          14-Jun-2024 08:03                5015
function.uopz-set-hook.php                         14-Jun-2024 08:03                5737
function.uopz-set-mock.php                         14-Jun-2024 08:03               10878
function.uopz-set-property.php                     14-Jun-2024 08:03                7566
function.uopz-set-return.php                       14-Jun-2024 08:03                9703
function.uopz-set-static.php                       14-Jun-2024 08:03                5819
function.uopz-undefine.php                         14-Jun-2024 08:03                4813
function.uopz-unset-hook.php                       14-Jun-2024 08:03                5628
function.uopz-unset-mock.php                       14-Jun-2024 08:03                5382
function.uopz-unset-return.php                     14-Jun-2024 08:03                4973
function.urldecode.php                             14-Jun-2024 08:03                6569
function.urlencode.php                             14-Jun-2024 08:03               10145
function.use-soap-error-handler.php                14-Jun-2024 08:03                4254
function.user-error.php                            14-Jun-2024 08:03                1755
function.usleep.php                                14-Jun-2024 08:03                7241
function.usort.php                                 14-Jun-2024 08:03               27336
function.utf8-decode.php                           14-Jun-2024 08:03               19443
function.utf8-encode.php                           14-Jun-2024 08:03               15916
function.var-dump.php                              14-Jun-2024 08:03                7190
function.var-export.php                            14-Jun-2024 08:03               16946
function.var-representation.php                    14-Jun-2024 08:03               13407
function.variant-abs.php                           14-Jun-2024 08:03                4440
function.variant-add.php                           14-Jun-2024 08:03                5851
function.variant-and.php                           14-Jun-2024 08:03                7900
function.variant-cast.php                          14-Jun-2024 08:03                3650
function.variant-cat.php                           14-Jun-2024 08:03                5029
function.variant-cmp.php                           14-Jun-2024 08:03                8436
function.variant-date-from-timestamp.php           14-Jun-2024 08:03                3744
function.variant-date-to-timestamp.php             14-Jun-2024 08:03                3886
function.variant-div.php                           14-Jun-2024 08:03                6752
function.variant-eqv.php                           14-Jun-2024 08:03                4738
function.variant-fix.php                           14-Jun-2024 08:03                5863
function.variant-get-type.php                      14-Jun-2024 08:03                3627
function.variant-idiv.php                          14-Jun-2024 08:03                6123
function.variant-imp.php                           14-Jun-2024 08:03                7460
function.variant-int.php                           14-Jun-2024 08:03                5364
function.variant-mod.php                           14-Jun-2024 08:03                5058
function.variant-mul.php                           14-Jun-2024 08:03                6256
function.variant-neg.php                           14-Jun-2024 08:03                4117
function.variant-not.php                           14-Jun-2024 08:03                4394
function.variant-or.php                            14-Jun-2024 08:03                8114
function.variant-pow.php                           14-Jun-2024 08:03                4907
function.variant-round.php                         14-Jun-2024 08:03                4781
function.variant-set-type.php                      14-Jun-2024 08:03                3774
function.variant-set.php                           14-Jun-2024 08:03                2992
function.variant-sub.php                           14-Jun-2024 08:03                5800
function.variant-xor.php                           14-Jun-2024 08:03                6822
function.version-compare.php                       14-Jun-2024 08:03               11918
function.vfprintf.php                              14-Jun-2024 08:03               21825
function.virtual.php                               14-Jun-2024 08:03                5604
function.vprintf.php                               14-Jun-2024 08:03               21328
function.vsprintf.php                              14-Jun-2024 08:03               21176
function.wddx-add-vars.php                         14-Jun-2024 08:03                4039
function.wddx-deserialize.php                      14-Jun-2024 08:03                3975
function.wddx-packet-end.php                       14-Jun-2024 08:03                2971
function.wddx-packet-start.php                     14-Jun-2024 08:03                3367
function.wddx-serialize-value.php                  14-Jun-2024 08:03                3452
function.wddx-serialize-vars.php                   14-Jun-2024 08:03                6187
function.win32-continue-service.php                14-Jun-2024 08:03                6933
function.win32-create-service.php                  14-Jun-2024 08:03               30274
function.win32-delete-service.php                  14-Jun-2024 08:03                7444
function.win32-get-last-control-message.php        14-Jun-2024 08:03                8880
function.win32-pause-service.php                   14-Jun-2024 08:03                6933
function.win32-query-service-status.php            14-Jun-2024 08:03                9236
function.win32-send-custom-control.php             14-Jun-2024 08:03                7592
function.win32-set-service-exit-code.php           14-Jun-2024 08:03                6226
function.win32-set-service-exit-mode.php           14-Jun-2024 08:03                6326
function.win32-set-service-status.php              14-Jun-2024 08:03                9718
function.win32-start-service-ctrl-dispatcher.php   14-Jun-2024 08:03               11816
function.win32-start-service.php                   14-Jun-2024 08:03                6932
function.win32-stop-service.php                    14-Jun-2024 08:03                6856
function.wincache-fcache-fileinfo.php              14-Jun-2024 08:03                9794
function.wincache-fcache-meminfo.php               14-Jun-2024 08:03                7626
function.wincache-lock.php                         14-Jun-2024 08:03                9138
function.wincache-ocache-fileinfo.php              14-Jun-2024 08:03               10459
function.wincache-ocache-meminfo.php               14-Jun-2024 08:03                7803
function.wincache-refresh-if-changed.php           14-Jun-2024 08:03                8383
function.wincache-rplist-fileinfo.php              14-Jun-2024 08:03                8130
function.wincache-rplist-meminfo.php               14-Jun-2024 08:03                7760
function.wincache-scache-info.php                  14-Jun-2024 08:03               10314
function.wincache-scache-meminfo.php               14-Jun-2024 08:03                7034
function.wincache-ucache-add.php                   14-Jun-2024 08:03               14713
function.wincache-ucache-cas.php                   14-Jun-2024 08:03                6760
function.wincache-ucache-clear.php                 14-Jun-2024 08:03                7850
function.wincache-ucache-dec.php                   14-Jun-2024 08:03                6604
function.wincache-ucache-delete.php                14-Jun-2024 08:03               12072
function.wincache-ucache-exists.php                14-Jun-2024 08:03                6453
function.wincache-ucache-get.php                   14-Jun-2024 08:03               11320
function.wincache-ucache-inc.php                   14-Jun-2024 08:03                6630
function.wincache-ucache-info.php                  14-Jun-2024 08:03               12151
function.wincache-ucache-meminfo.php               14-Jun-2024 08:03                7388
function.wincache-ucache-set.php                   14-Jun-2024 08:03               14756
function.wincache-unlock.php                       14-Jun-2024 08:03                8244
function.wordwrap.php                              14-Jun-2024 08:03                9412
function.xattr-get.php                             14-Jun-2024 08:03                6666
function.xattr-list.php                            14-Jun-2024 08:03                7109
function.xattr-remove.php                          14-Jun-2024 08:03                6974
function.xattr-set.php                             14-Jun-2024 08:03                8790
function.xattr-supported.php                       14-Jun-2024 08:03                5705
function.xdiff-file-bdiff-size.php                 14-Jun-2024 08:03                5041
function.xdiff-file-bdiff.php                      14-Jun-2024 08:03                6190
function.xdiff-file-bpatch.php                     14-Jun-2024 08:03                6743
function.xdiff-file-diff-binary.php                14-Jun-2024 08:03                6707
function.xdiff-file-diff.php                       14-Jun-2024 08:03                7833
function.xdiff-file-merge3.php                     14-Jun-2024 08:03                7135
function.xdiff-file-patch-binary.php               14-Jun-2024 08:03                6824
function.xdiff-file-patch.php                      14-Jun-2024 08:03                9331
function.xdiff-file-rabdiff.php                    14-Jun-2024 08:03                6864
function.xdiff-string-bdiff-size.php               14-Jun-2024 08:03                5343
function.xdiff-string-bdiff.php                    14-Jun-2024 08:03                4066
function.xdiff-string-bpatch.php                   14-Jun-2024 08:03                4197
function.xdiff-string-diff-binary.php              14-Jun-2024 08:03                4557
function.xdiff-string-diff.php                     14-Jun-2024 08:03                7995
function.xdiff-string-merge3.php                   14-Jun-2024 08:03                5037
function.xdiff-string-patch-binary.php             14-Jun-2024 08:03                4641
function.xdiff-string-patch.php                    14-Jun-2024 08:03                8530
function.xdiff-string-rabdiff.php                  14-Jun-2024 08:03                4723
function.xhprof-disable.php                        14-Jun-2024 08:03                4024
function.xhprof-enable.php                         14-Jun-2024 08:03                7363
function.xhprof-sample-disable.php                 14-Jun-2024 08:03                4753
function.xhprof-sample-enable.php                  14-Jun-2024 08:03                3773
function.xml-error-string.php                      14-Jun-2024 08:03                3532
function.xml-get-current-byte-index.php            14-Jun-2024 08:03                4698
function.xml-get-current-column-number.php         14-Jun-2024 08:03                4564
function.xml-get-current-line-number.php           14-Jun-2024 08:03                4174
function.xml-get-error-code.php                    14-Jun-2024 08:03                3912
function.xml-parse-into-struct.php                 14-Jun-2024 08:03               19644
function.xml-parse.php                             14-Jun-2024 08:03                8688
function.xml-parser-create-ns.php                  14-Jun-2024 08:03                5668
function.xml-parser-create.php                     14-Jun-2024 08:03                5167
function.xml-parser-free.php                       14-Jun-2024 08:03                4298
function.xml-parser-get-option.php                 14-Jun-2024 08:03                6166
function.xml-parser-set-option.php                 14-Jun-2024 08:03                8217
function.xml-set-character-data-handler.php        14-Jun-2024 08:03                5890
function.xml-set-default-handler.php               14-Jun-2024 08:03                5810
function.xml-set-element-handler.php               14-Jun-2024 08:03                9385
function.xml-set-end-namespace-decl-handler.php    14-Jun-2024 08:03                6846
function.xml-set-external-entity-ref-handler.php   14-Jun-2024 08:03                8920
function.xml-set-notation-decl-handler.php         14-Jun-2024 08:03                7924
function.xml-set-object.php                        14-Jun-2024 08:03                9298
function.xml-set-processing-instruction-handler..> 14-Jun-2024 08:03                7037
function.xml-set-start-namespace-decl-handler.php  14-Jun-2024 08:03                7264
function.xml-set-unparsed-entity-decl-handler.php  14-Jun-2024 08:03                8820
function.xmlrpc-decode-request.php                 14-Jun-2024 08:03                2917
function.xmlrpc-decode.php                         14-Jun-2024 08:03                4306
function.xmlrpc-encode-request.php                 14-Jun-2024 08:03                8683
function.xmlrpc-encode.php                         14-Jun-2024 08:03                2497
function.xmlrpc-get-type.php                       14-Jun-2024 08:03                6335
function.xmlrpc-is-fault.php                       14-Jun-2024 08:03                4202
function.xmlrpc-parse-method-descriptions.php      14-Jun-2024 08:03                2698
function.xmlrpc-server-add-introspection-data.php  14-Jun-2024 08:03                2889
function.xmlrpc-server-call-method.php             14-Jun-2024 08:03                3313
function.xmlrpc-server-create.php                  14-Jun-2024 08:03                2402
function.xmlrpc-server-destroy.php                 14-Jun-2024 08:03                2612
function.xmlrpc-server-register-introspection-c..> 14-Jun-2024 08:03                2975
function.xmlrpc-server-register-method.php         14-Jun-2024 08:03                3024
function.xmlrpc-set-type.php                       14-Jun-2024 08:03                5880
function.yaml-emit-file.php                        14-Jun-2024 08:03                6810
function.yaml-emit.php                             14-Jun-2024 08:03               12297
function.yaml-parse-file.php                       14-Jun-2024 08:03                6144
function.yaml-parse-url.php                        14-Jun-2024 08:03                6391
function.yaml-parse.php                            14-Jun-2024 08:03                9950
function.yaz-addinfo.php                           14-Jun-2024 08:03                3607
function.yaz-ccl-conf.php                          14-Jun-2024 08:03                5963
function.yaz-ccl-parse.php                         14-Jun-2024 08:03                7143
function.yaz-close.php                             14-Jun-2024 08:03                3665
function.yaz-connect.php                           14-Jun-2024 08:03                9792
function.yaz-database.php                          14-Jun-2024 08:03                3662
function.yaz-element.php                           14-Jun-2024 08:03                4034
function.yaz-errno.php                             14-Jun-2024 08:03                3917
function.yaz-error.php                             14-Jun-2024 08:03                3565
function.yaz-es-result.php                         14-Jun-2024 08:03                3454
function.yaz-es.php                                14-Jun-2024 08:03                7573
function.yaz-get-option.php                        14-Jun-2024 08:03                3525
function.yaz-hits.php                              14-Jun-2024 08:03                5585
function.yaz-itemorder.php                         14-Jun-2024 08:03                7266
function.yaz-present.php                           14-Jun-2024 08:03                3089
function.yaz-range.php                             14-Jun-2024 08:03                3758
function.yaz-record.php                            14-Jun-2024 08:03               15491
function.yaz-scan-result.php                       14-Jun-2024 08:03                4056
function.yaz-scan.php                              14-Jun-2024 08:03                9776
function.yaz-schema.php                            14-Jun-2024 08:03                3545
function.yaz-search.php                            14-Jun-2024 08:03                9278
function.yaz-set-option.php                        14-Jun-2024 08:03                7359
function.yaz-sort.php                              14-Jun-2024 08:03                5853
function.yaz-syntax.php                            14-Jun-2024 08:03                3502
function.yaz-wait.php                              14-Jun-2024 08:03                4338
function.zend-thread-id.php                        14-Jun-2024 08:03                3973
function.zend-version.php                          14-Jun-2024 08:03                4192                             14-Jun-2024 08:03                4070                       14-Jun-2024 08:03                4366              14-Jun-2024 08:03                4647           14-Jun-2024 08:03                4765                    14-Jun-2024 08:03                4598                        14-Jun-2024 08:03                4467                        14-Jun-2024 08:03                6159                        14-Jun-2024 08:03                5289                              14-Jun-2024 08:03                4683                              14-Jun-2024 08:03                4861
function.zlib-decode.php                           14-Jun-2024 08:03                3565
function.zlib-encode.php                           14-Jun-2024 08:03                5513
function.zlib-get-coding-type.php                  14-Jun-2024 08:03                3044
function.zookeeper-dispatch.php                    14-Jun-2024 08:03                8383
functional.parallel.php                            14-Jun-2024 08:03                2602
functions.anonymous.php                            14-Jun-2024 08:03               24340
functions.arguments.php                            14-Jun-2024 08:03               44027
functions.arrow.php                                14-Jun-2024 08:03               10541
functions.first_class_callable_syntax.php          14-Jun-2024 08:03               11359
functions.internal.php                             14-Jun-2024 08:03                8138
functions.returning-values.php                     14-Jun-2024 08:03                6344
functions.user-defined.php                         14-Jun-2024 08:03                9711
functions.variable-functions.php                   14-Jun-2024 08:03               11455
gearman.configuration.php                          14-Jun-2024 08:03                1291
gearman.constants.php                              14-Jun-2024 08:03               24932
gearman.examples-reverse-bg.php                    14-Jun-2024 08:03               10863
gearman.examples-reverse-task.php                  14-Jun-2024 08:03               17491
gearman.examples-reverse.php                       14-Jun-2024 08:03               13108
gearman.examples.php                               14-Jun-2024 08:03                1559
gearman.installation.php                           14-Jun-2024 08:03                1790
gearman.requirements.php                           14-Jun-2024 08:03                1551
gearman.resources.php                              14-Jun-2024 08:03                1307
gearman.setup.php                                  14-Jun-2024 08:03                1672
gearmanclient.addoptions.php                       14-Jun-2024 08:03                3443
gearmanclient.addserver.php                        14-Jun-2024 08:03                5678
gearmanclient.addservers.php                       14-Jun-2024 08:03                5133
gearmanclient.addtask.php                          14-Jun-2024 08:03               15696
gearmanclient.addtaskbackground.php                14-Jun-2024 08:03               21583
gearmanclient.addtaskhigh.php                      14-Jun-2024 08:03               12162
gearmanclient.addtaskhighbackground.php            14-Jun-2024 08:03                6952
gearmanclient.addtasklow.php                       14-Jun-2024 08:03               12148
gearmanclient.addtasklowbackground.php             14-Jun-2024 08:03                6954
gearmanclient.addtaskstatus.php                    14-Jun-2024 08:03               10090
gearmanclient.clearcallbacks.php                   14-Jun-2024 08:03                4892
gearmanclient.clone.php                            14-Jun-2024 08:03                2744
gearmanclient.construct.php                        14-Jun-2024 08:03                2907
gearmanclient.context.php                          14-Jun-2024 08:03                3059                             14-Jun-2024 08:03                3367                               14-Jun-2024 08:03               22908
gearmanclient.dobackground.php                     14-Jun-2024 08:03               10070
gearmanclient.dohigh.php                           14-Jun-2024 08:03                5581
gearmanclient.dohighbackground.php                 14-Jun-2024 08:03                5232
gearmanclient.dojobhandle.php                      14-Jun-2024 08:03                3154
gearmanclient.dolow.php                            14-Jun-2024 08:03                5597
gearmanclient.dolowbackground.php                  14-Jun-2024 08:03                5256
gearmanclient.donormal.php                         14-Jun-2024 08:03               23433
gearmanclient.dostatus.php                         14-Jun-2024 08:03                8404
gearmanclient.echo.php                             14-Jun-2024 08:03                3121
gearmanclient.error.php                            14-Jun-2024 08:03                3249
gearmanclient.geterrno.php                         14-Jun-2024 08:03                2817
gearmanclient.jobstatus.php                        14-Jun-2024 08:03                8635                             14-Jun-2024 08:03                3196
gearmanclient.removeoptions.php                    14-Jun-2024 08:03                2732
gearmanclient.returncode.php                       14-Jun-2024 08:03                2378
gearmanclient.runtasks.php                         14-Jun-2024 08:03                3879
gearmanclient.setclientcallback.php                14-Jun-2024 08:03                5976
gearmanclient.setcompletecallback.php              14-Jun-2024 08:03                5841
gearmanclient.setcontext.php                       14-Jun-2024 08:03                3370
gearmanclient.setcreatedcallback.php               14-Jun-2024 08:03                5358
gearmanclient.setdata.php                          14-Jun-2024 08:03                3594
gearmanclient.setdatacallback.php                  14-Jun-2024 08:03                5324
gearmanclient.setexceptioncallback.php             14-Jun-2024 08:03                5218
gearmanclient.setfailcallback.php                  14-Jun-2024 08:03                5287
gearmanclient.setoptions.php                       14-Jun-2024 08:03                2747
gearmanclient.setstatuscallback.php                14-Jun-2024 08:03                5337
gearmanclient.settimeout.php                       14-Jun-2024 08:03                2835
gearmanclient.setwarningcallback.php               14-Jun-2024 08:03                5331
gearmanclient.setworkloadcallback.php              14-Jun-2024 08:03                5570
gearmanclient.timeout.php                          14-Jun-2024 08:03                2930
gearmanclient.wait.php                             14-Jun-2024 08:03                2874
gearmanjob.complete.php                            14-Jun-2024 08:03                3754
gearmanjob.construct.php                           14-Jun-2024 08:03                2415                                14-Jun-2024 08:03                3799
gearmanjob.exception.php                           14-Jun-2024 08:03                3935                                14-Jun-2024 08:03                3888
gearmanjob.functionname.php                        14-Jun-2024 08:03                3061
gearmanjob.handle.php                              14-Jun-2024 08:03                2945
gearmanjob.returncode.php                          14-Jun-2024 08:03                2725
gearmanjob.sendcomplete.php                        14-Jun-2024 08:03                3460
gearmanjob.senddata.php                            14-Jun-2024 08:03                3496
gearmanjob.sendexception.php                       14-Jun-2024 08:03                3621
gearmanjob.sendfail.php                            14-Jun-2024 08:03                3556
gearmanjob.sendstatus.php                          14-Jun-2024 08:03                4254
gearmanjob.sendwarning.php                         14-Jun-2024 08:03                3618
gearmanjob.setreturn.php                           14-Jun-2024 08:03                2642
gearmanjob.status.php                              14-Jun-2024 08:03                4559
gearmanjob.unique.php                              14-Jun-2024 08:03                3204
gearmanjob.warning.php                             14-Jun-2024 08:03                3924
gearmanjob.workload.php                            14-Jun-2024 08:03                2973
gearmanjob.workloadsize.php                        14-Jun-2024 08:03                2756
gearmantask.construct.php                          14-Jun-2024 08:03                2433
gearmantask.create.php                             14-Jun-2024 08:03                2880                               14-Jun-2024 08:03                2941
gearmantask.datasize.php                           14-Jun-2024 08:03                2967
gearmantask.function.php                           14-Jun-2024 08:03                2748
gearmantask.functionname.php                       14-Jun-2024 08:03                2683
gearmantask.isknown.php                            14-Jun-2024 08:03                2528
gearmantask.isrunning.php                          14-Jun-2024 08:03                2537
gearmantask.jobhandle.php                          14-Jun-2024 08:03                3107
gearmantask.recvdata.php                           14-Jun-2024 08:03                3679
gearmantask.returncode.php                         14-Jun-2024 08:03                2753
gearmantask.senddata.php                           14-Jun-2024 08:03                3493
gearmantask.sendworkload.php                       14-Jun-2024 08:03                3644
gearmantask.taskdenominator.php                    14-Jun-2024 08:03                3090
gearmantask.tasknumerator.php                      14-Jun-2024 08:03                3062
gearmantask.unique.php                             14-Jun-2024 08:03                3417
gearmantask.uuid.php                               14-Jun-2024 08:03                3618
gearmanworker.addfunction.php                      14-Jun-2024 08:03                8176
gearmanworker.addoptions.php                       14-Jun-2024 08:03                3488
gearmanworker.addserver.php                        14-Jun-2024 08:03                5347
gearmanworker.addservers.php                       14-Jun-2024 08:03                4874
gearmanworker.clone.php                            14-Jun-2024 08:03                2381
gearmanworker.construct.php                        14-Jun-2024 08:03                2893
gearmanworker.echo.php                             14-Jun-2024 08:03                3232
gearmanworker.error.php                            14-Jun-2024 08:03                3159
gearmanworker.geterrno.php                         14-Jun-2024 08:03                2733
gearmanworker.options.php                          14-Jun-2024 08:03                2756
gearmanworker.register.php                         14-Jun-2024 08:03                3940
gearmanworker.removeoptions.php                    14-Jun-2024 08:03                3530
gearmanworker.returncode.php                       14-Jun-2024 08:03                2950
gearmanworker.setid.php                            14-Jun-2024 08:03                4196
gearmanworker.setoptions.php                       14-Jun-2024 08:03                3684
gearmanworker.settimeout.php                       14-Jun-2024 08:03                8161
gearmanworker.timeout.php                          14-Jun-2024 08:03                2915
gearmanworker.unregister.php                       14-Jun-2024 08:03                3428
gearmanworker.unregisterall.php                    14-Jun-2024 08:03                3122
gearmanworker.wait.php                             14-Jun-2024 08:03                8123                             14-Jun-2024 08:03                5754
gender-gender.connect.php                          14-Jun-2024 08:03                2621
gender-gender.construct.php                        14-Jun-2024 08:03                2498                          14-Jun-2024 08:03                3929
gender-gender.get.php                              14-Jun-2024 08:03                2917
gender-gender.isnick.php                           14-Jun-2024 08:03                3489
gender-gender.similarnames.php                     14-Jun-2024 08:03                3046
gender.example.admin.php                           14-Jun-2024 08:03                8336
gender.examples.php                                14-Jun-2024 08:03                1412
gender.installation.php                            14-Jun-2024 08:03                2200
gender.setup.php                                   14-Jun-2024 08:03                1419
generator.current.php                              14-Jun-2024 08:03                2165
generator.getreturn.php                            14-Jun-2024 08:03                3923
generator.key.php                                  14-Jun-2024 08:03                3972                                 14-Jun-2024 08:03                2521
generator.rewind.php                               14-Jun-2024 08:03                2282
generator.send.php                                 14-Jun-2024 08:03                5618
generator.throw.php                                14-Jun-2024 08:03                5186
generator.valid.php                                14-Jun-2024 08:03                2376
generator.wakeup.php                               14-Jun-2024 08:03                2287
geoip.configuration.php                            14-Jun-2024 08:03                2604
geoip.constants.php                                14-Jun-2024 08:03                6378
geoip.installation.php                             14-Jun-2024 08:03                1926
geoip.requirements.php                             14-Jun-2024 08:03                1855
geoip.resources.php                                14-Jun-2024 08:03                1263
geoip.setup.php                                    14-Jun-2024 08:03                1633
gettext.configuration.php                          14-Jun-2024 08:03                1291
gettext.constants.php                              14-Jun-2024 08:03                1231
gettext.installation.php                           14-Jun-2024 08:03                1483
gettext.requirements.php                           14-Jun-2024 08:03                1445
gettext.resources.php                              14-Jun-2024 08:03                1277
gettext.setup.php                                  14-Jun-2024 08:03                1678
getting-started.php                                14-Jun-2024 08:03                2006
globiterator.construct.php                         14-Jun-2024 08:03                7809
globiterator.count.php                             14-Jun-2024 08:03                4529
gmagick.addimage.php                               14-Jun-2024 08:03                3020
gmagick.addnoiseimage.php                          14-Jun-2024 08:03                3050
gmagick.annotateimage.php                          14-Jun-2024 08:03                4557
gmagick.blurimage.php                              14-Jun-2024 08:03                3413
gmagick.borderimage.php                            14-Jun-2024 08:03                4022
gmagick.charcoalimage.php                          14-Jun-2024 08:03                3328
gmagick.chopimage.php                              14-Jun-2024 08:03                4054
gmagick.clear.php                                  14-Jun-2024 08:03                2705
gmagick.commentimage.php                           14-Jun-2024 08:03                2954
gmagick.compositeimage.php                         14-Jun-2024 08:03                4173
gmagick.configuration.php                          14-Jun-2024 08:03                1309
gmagick.constants.php                              14-Jun-2024 08:03              103895
gmagick.construct.php                              14-Jun-2024 08:03                2690
gmagick.cropimage.php                              14-Jun-2024 08:03                4178
gmagick.cropthumbnailimage.php                     14-Jun-2024 08:03                3424
gmagick.current.php                                14-Jun-2024 08:03                2614
gmagick.cyclecolormapimage.php                     14-Jun-2024 08:03                3155
gmagick.deconstructimages.php                      14-Jun-2024 08:03                2806
gmagick.despeckleimage.php                         14-Jun-2024 08:03                3553
gmagick.destroy.php                                14-Jun-2024 08:03                2842
gmagick.drawimage.php                              14-Jun-2024 08:03                3099
gmagick.edgeimage.php                              14-Jun-2024 08:03                3103
gmagick.embossimage.php                            14-Jun-2024 08:03                3597
gmagick.enhanceimage.php                           14-Jun-2024 08:03                2734
gmagick.equalizeimage.php                          14-Jun-2024 08:03                2675
gmagick.examples.php                               14-Jun-2024 08:03                3492
gmagick.flipimage.php                              14-Jun-2024 08:03                3002
gmagick.flopimage.php                              14-Jun-2024 08:03                3000
gmagick.frameimage.php                             14-Jun-2024 08:03                4830
gmagick.gammaimage.php                             14-Jun-2024 08:03                3276
gmagick.getcopyright.php                           14-Jun-2024 08:03                2757
gmagick.getfilename.php                            14-Jun-2024 08:03                2728
gmagick.getimagebackgroundcolor.php                14-Jun-2024 08:03                2825
gmagick.getimageblueprimary.php                    14-Jun-2024 08:03                3068
gmagick.getimagebordercolor.php                    14-Jun-2024 08:03                2841
gmagick.getimagechanneldepth.php                   14-Jun-2024 08:03                2929
gmagick.getimagecolors.php                         14-Jun-2024 08:03                2709
gmagick.getimagecolorspace.php                     14-Jun-2024 08:03                2700
gmagick.getimagecompose.php                        14-Jun-2024 08:03                2726
gmagick.getimagedelay.php                          14-Jun-2024 08:03                2632
gmagick.getimagedepth.php                          14-Jun-2024 08:03                2611
gmagick.getimagedispose.php                        14-Jun-2024 08:03                2678
gmagick.getimageextrema.php                        14-Jun-2024 08:03                2868
gmagick.getimagefilename.php                       14-Jun-2024 08:03                2828
gmagick.getimageformat.php                         14-Jun-2024 08:03                2814
gmagick.getimagegamma.php                          14-Jun-2024 08:03                2632
gmagick.getimagegreenprimary.php                   14-Jun-2024 08:03                2755
gmagick.getimageheight.php                         14-Jun-2024 08:03                2645
gmagick.getimagehistogram.php                      14-Jun-2024 08:03                2944
gmagick.getimageindex.php                          14-Jun-2024 08:03                2779
gmagick.getimageinterlacescheme.php                14-Jun-2024 08:03                2887
gmagick.getimageiterations.php                     14-Jun-2024 08:03                2773
gmagick.getimagematte.php                          14-Jun-2024 08:03                2989
gmagick.getimagemattecolor.php                     14-Jun-2024 08:03                2742
gmagick.getimageprofile.php                        14-Jun-2024 08:03                2914
gmagick.getimageredprimary.php                     14-Jun-2024 08:03                2989
gmagick.getimagerenderingintent.php                14-Jun-2024 08:03                2775
gmagick.getimageresolution.php                     14-Jun-2024 08:03                2758
gmagick.getimagescene.php                          14-Jun-2024 08:03                2611
gmagick.getimagesignature.php                      14-Jun-2024 08:03                2781
gmagick.getimagetype.php                           14-Jun-2024 08:03                2624
gmagick.getimageunits.php                          14-Jun-2024 08:03                2417
gmagick.getimagewhitepoint.php                     14-Jun-2024 08:03                2760
gmagick.getimagewidth.php                          14-Jun-2024 08:03                2608
gmagick.getpackagename.php                         14-Jun-2024 08:03                2733
gmagick.getquantumdepth.php                        14-Jun-2024 08:03                2906
gmagick.getreleasedate.php                         14-Jun-2024 08:03                2829
gmagick.getsamplingfactors.php                     14-Jun-2024 08:03                2776
gmagick.getsize.php                                14-Jun-2024 08:03                2861
gmagick.getversion.php                             14-Jun-2024 08:03                2716
gmagick.hasnextimage.php                           14-Jun-2024 08:03                2831
gmagick.haspreviousimage.php                       14-Jun-2024 08:03                2868
gmagick.implodeimage.php                           14-Jun-2024 08:03                3108
gmagick.installation.php                           14-Jun-2024 08:03                2157
gmagick.labelimage.php                             14-Jun-2024 08:03                2819
gmagick.levelimage.php                             14-Jun-2024 08:03                4974
gmagick.magnifyimage.php                           14-Jun-2024 08:03                2680
gmagick.mapimage.php                               14-Jun-2024 08:03                3391
gmagick.medianfilterimage.php                      14-Jun-2024 08:03                3152
gmagick.minifyimage.php                            14-Jun-2024 08:03                2683
gmagick.modulateimage.php                          14-Jun-2024 08:03                4130
gmagick.motionblurimage.php                        14-Jun-2024 08:03                4092
gmagick.newimage.php                               14-Jun-2024 08:03                4120
gmagick.nextimage.php                              14-Jun-2024 08:03                2875
gmagick.normalizeimage.php                         14-Jun-2024 08:03                3121
gmagick.oilpaintimage.php                          14-Jun-2024 08:03                3099
gmagick.previousimage.php                          14-Jun-2024 08:03                2874
gmagick.profileimage.php                           14-Jun-2024 08:03                3710
gmagick.quantizeimage.php                          14-Jun-2024 08:03                5851
gmagick.quantizeimages.php                         14-Jun-2024 08:03                5765
gmagick.queryfontmetrics.php                       14-Jun-2024 08:03                3067
gmagick.queryfonts.php                             14-Jun-2024 08:03                2825
gmagick.queryformats.php                           14-Jun-2024 08:03                3186
gmagick.radialblurimage.php                        14-Jun-2024 08:03                3332
gmagick.raiseimage.php                             14-Jun-2024 08:03                4505                                   14-Jun-2024 08:03                2830
gmagick.readimage.php                              14-Jun-2024 08:03                2881
gmagick.readimageblob.php                          14-Jun-2024 08:03                3319
gmagick.readimagefile.php                          14-Jun-2024 08:03                3190
gmagick.reducenoiseimage.php                       14-Jun-2024 08:03                3337
gmagick.removeimage.php                            14-Jun-2024 08:03                2677
gmagick.removeimageprofile.php                     14-Jun-2024 08:03                2972
gmagick.requirements.php                           14-Jun-2024 08:03                1777
gmagick.resampleimage.php                          14-Jun-2024 08:03                4159
gmagick.resizeimage.php                            14-Jun-2024 08:03                4478
gmagick.rollimage.php                              14-Jun-2024 08:03                3182
gmagick.rotateimage.php                            14-Jun-2024 08:03                3312
gmagick.scaleimage.php                             14-Jun-2024 08:03                3685
gmagick.separateimagechannel.php                   14-Jun-2024 08:03                3298
gmagick.setcompressionquality.php                  14-Jun-2024 08:03                4305
gmagick.setfilename.php                            14-Jun-2024 08:03                3066
gmagick.setimagebackgroundcolor.php                14-Jun-2024 08:03                3124
gmagick.setimageblueprimary.php                    14-Jun-2024 08:03                3421
gmagick.setimagebordercolor.php                    14-Jun-2024 08:03                3079
gmagick.setimagechanneldepth.php                   14-Jun-2024 08:03                3568
gmagick.setimagecolorspace.php                     14-Jun-2024 08:03                3228
gmagick.setimagecompose.php                        14-Jun-2024 08:03                2985
gmagick.setimagedelay.php                          14-Jun-2024 08:03                2973
gmagick.setimagedepth.php                          14-Jun-2024 08:03                2982
gmagick.setimagedispose.php                        14-Jun-2024 08:03                3027
gmagick.setimagefilename.php                       14-Jun-2024 08:03                3081
gmagick.setimageformat.php                         14-Jun-2024 08:03                3009
gmagick.setimagegamma.php                          14-Jun-2024 08:03                2954
gmagick.setimagegreenprimary.php                   14-Jun-2024 08:03                3433
gmagick.setimageindex.php                          14-Jun-2024 08:03                3116
gmagick.setimageinterlacescheme.php                14-Jun-2024 08:03                3289
gmagick.setimageiterations.php                     14-Jun-2024 08:03                3064
gmagick.setimageprofile.php                        14-Jun-2024 08:03                3513
gmagick.setimageredprimary.php                     14-Jun-2024 08:03                3376
gmagick.setimagerenderingintent.php                14-Jun-2024 08:03                3247
gmagick.setimageresolution.php                     14-Jun-2024 08:03                3320
gmagick.setimagescene.php                          14-Jun-2024 08:03                2958
gmagick.setimagetype.php                           14-Jun-2024 08:03                3077
gmagick.setimageunits.php                          14-Jun-2024 08:03                3172
gmagick.setimagewhitepoint.php                     14-Jun-2024 08:03                3425
gmagick.setsamplingfactors.php                     14-Jun-2024 08:03                3246
gmagick.setsize.php                                14-Jun-2024 08:03                3641
gmagick.setup.php                                  14-Jun-2024 08:03                1593
gmagick.shearimage.php                             14-Jun-2024 08:03                4128
gmagick.solarizeimage.php                          14-Jun-2024 08:03                3232
gmagick.spreadimage.php                            14-Jun-2024 08:03                3085
gmagick.stripimage.php                             14-Jun-2024 08:03                2686
gmagick.swirlimage.php                             14-Jun-2024 08:03                3137
gmagick.thumbnailimage.php                         14-Jun-2024 08:03                4063
gmagick.trimimage.php                              14-Jun-2024 08:03                3192
gmagick.write.php                                  14-Jun-2024 08:03                1752
gmagick.writeimage.php                             14-Jun-2024 08:03                3641
gmagickdraw.annotate.php                           14-Jun-2024 08:03                3283
gmagickdraw.arc.php                                14-Jun-2024 08:03                4423
gmagickdraw.bezier.php                             14-Jun-2024 08:03                2690
gmagickdraw.ellipse.php                            14-Jun-2024 08:03                4369
gmagickdraw.getfillcolor.php                       14-Jun-2024 08:03                2544
gmagickdraw.getfillopacity.php                     14-Jun-2024 08:03                2571
gmagickdraw.getfont.php                            14-Jun-2024 08:03                2590
gmagickdraw.getfontsize.php                        14-Jun-2024 08:03                2581
gmagickdraw.getfontstyle.php                       14-Jun-2024 08:03                2639
gmagickdraw.getfontweight.php                      14-Jun-2024 08:03                2535
gmagickdraw.getstrokecolor.php                     14-Jun-2024 08:03                2581
gmagickdraw.getstrokeopacity.php                   14-Jun-2024 08:03                2562
gmagickdraw.getstrokewidth.php                     14-Jun-2024 08:03                2556
gmagickdraw.gettextdecoration.php                  14-Jun-2024 08:03                2525
gmagickdraw.gettextencoding.php                    14-Jun-2024 08:03                2688
gmagickdraw.line.php                               14-Jun-2024 08:03                3799
gmagickdraw.point.php                              14-Jun-2024 08:03                2988
gmagickdraw.polygon.php                            14-Jun-2024 08:03                2790
gmagickdraw.polyline.php                           14-Jun-2024 08:03                2826
gmagickdraw.rectangle.php                          14-Jun-2024 08:03                3810
gmagickdraw.rotate.php                             14-Jun-2024 08:03                2684
gmagickdraw.roundrectangle.php                     14-Jun-2024 08:03                4501
gmagickdraw.scale.php                              14-Jun-2024 08:03                3057
gmagickdraw.setfillcolor.php                       14-Jun-2024 08:03                3038
gmagickdraw.setfillopacity.php                     14-Jun-2024 08:03                2929
gmagickdraw.setfont.php                            14-Jun-2024 08:03                2767
gmagickdraw.setfontsize.php                        14-Jun-2024 08:03                2846
gmagickdraw.setfontstyle.php                       14-Jun-2024 08:03                2945
gmagickdraw.setfontweight.php                      14-Jun-2024 08:03                2858
gmagickdraw.setstrokecolor.php                     14-Jun-2024 08:03                3073
gmagickdraw.setstrokeopacity.php                   14-Jun-2024 08:03                2885
gmagickdraw.setstrokewidth.php                     14-Jun-2024 08:03                2795
gmagickdraw.settextdecoration.php                  14-Jun-2024 08:03                2929
gmagickdraw.settextencoding.php                    14-Jun-2024 08:03                3261
gmagickpixel.construct.php                         14-Jun-2024 08:03                2629
gmagickpixel.getcolor.php                          14-Jun-2024 08:03                4402
gmagickpixel.getcolorcount.php                     14-Jun-2024 08:03                2618
gmagickpixel.getcolorvalue.php                     14-Jun-2024 08:03                3061
gmagickpixel.setcolor.php                          14-Jun-2024 08:03                3193
gmagickpixel.setcolorvalue.php                     14-Jun-2024 08:03                3412
gmp.configuration.php                              14-Jun-2024 08:03                1281
gmp.constants.php                                  14-Jun-2024 08:03                4596
gmp.construct.php                                  14-Jun-2024 08:03                4000
gmp.examples.php                                   14-Jun-2024 08:03                3094
gmp.installation.php                               14-Jun-2024 08:03                1384
gmp.requirements.php                               14-Jun-2024 08:03                1800
gmp.serialize.php                                  14-Jun-2024 08:03                2344
gmp.setup.php                                      14-Jun-2024 08:03                1558
gmp.unserialize.php                                14-Jun-2024 08:03                2655
gnupg.configuration.php                            14-Jun-2024 08:03                1275
gnupg.constants.php                                14-Jun-2024 08:03                9454
gnupg.examples-clearsign.php                       14-Jun-2024 08:03                6561
gnupg.examples.php                                 14-Jun-2024 08:03                1437
gnupg.installation.php                             14-Jun-2024 08:03                1769
gnupg.requirements.php                             14-Jun-2024 08:03                1317
gnupg.resources.php                                14-Jun-2024 08:03                1263
gnupg.setup.php                                    14-Jun-2024 08:03                1652
hash.configuration.php                             14-Jun-2024 08:03                1270
hash.constants.php                                 14-Jun-2024 08:03                1879
hash.installation.php                              14-Jun-2024 08:03                1776
hash.requirements.php                              14-Jun-2024 08:03                1275
hash.resources.php                                 14-Jun-2024 08:03                1401
hash.setup.php                                     14-Jun-2024 08:03                1630
hashcontext.construct.php                          14-Jun-2024 08:03                1971
hashcontext.serialize.php                          14-Jun-2024 08:03                2473
hashcontext.unserialize.php                        14-Jun-2024 08:03                2778
history.php                                        14-Jun-2024 08:03                2405
history.php.books.php                              14-Jun-2024 08:03                2769
history.php.php                                    14-Jun-2024 08:03               12305
history.php.publications.php                       14-Jun-2024 08:03                1912
history.php.related.php                            14-Jun-2024 08:03                6825
hrtime-performancecounter.getfrequency.php         14-Jun-2024 08:03                2821
hrtime-performancecounter.getticks.php             14-Jun-2024 08:03                2655
hrtime-performancecounter.gettickssince.php        14-Jun-2024 08:03                2975
hrtime-stopwatch.getelapsedticks.php               14-Jun-2024 08:03                2596
hrtime-stopwatch.getelapsedtime.php                14-Jun-2024 08:03                3001
hrtime-stopwatch.getlastelapsedticks.php           14-Jun-2024 08:03                2655
hrtime-stopwatch.getlastelapsedtime.php            14-Jun-2024 08:03                3009
hrtime-stopwatch.isrunning.php                     14-Jun-2024 08:03                2524
hrtime-stopwatch.start.php                         14-Jun-2024 08:03                2460
hrtime-stopwatch.stop.php                          14-Jun-2024 08:03                2312
hrtime.example.basic.php                           14-Jun-2024 08:03                5530
hrtime.examples.php                                14-Jun-2024 08:03                1405
hrtime.installation.php                            14-Jun-2024 08:03                2183
hrtime.setup.php                                   14-Jun-2024 08:03                1416
ibase.configuration.php                            14-Jun-2024 08:03                8417
ibase.constants.php                                14-Jun-2024 08:03               21923
ibase.installation.php                             14-Jun-2024 08:03                3649
ibase.requirements.php                             14-Jun-2024 08:03                1250
ibase.resources.php                                14-Jun-2024 08:03                1263
ibase.setup.php                                    14-Jun-2024 08:03                1672
ibm-db2.configuration.php                          14-Jun-2024 08:03               22991
ibm-db2.constants.php                              14-Jun-2024 08:03                9474
ibm-db2.installation.php                           14-Jun-2024 08:03                3975
ibm-db2.requirements.php                           14-Jun-2024 08:03                3374
ibm-db2.resources.php                              14-Jun-2024 08:03                1375
ibm-db2.setup.php                                  14-Jun-2024 08:03                1685
iconv.configuration.php                            14-Jun-2024 08:03                5149
iconv.constants.php                                14-Jun-2024 08:03                3794
iconv.installation.php                             14-Jun-2024 08:03                1707
iconv.requirements.php                             14-Jun-2024 08:03                1501
iconv.resources.php                                14-Jun-2024 08:03                1263
iconv.setup.php                                    14-Jun-2024 08:03                1658
igbinary.configuration.php                         14-Jun-2024 08:03                3650
igbinary.installation.php                          14-Jun-2024 08:03                2207
igbinary.requirements.php                          14-Jun-2024 08:03                1271
igbinary.setup.php                                 14-Jun-2024 08:03                1603
image.configuration.php                            14-Jun-2024 08:03                3557
image.constants.php                                14-Jun-2024 08:03               55693
image.examples-png.php                             14-Jun-2024 08:03                4836
image.examples-watermark.php                       14-Jun-2024 08:03                6099
image.examples.merged-watermark.php                14-Jun-2024 08:03                8891
image.examples.php                                 14-Jun-2024 08:03                1739
image.installation.php                             14-Jun-2024 08:03                6713
image.requirements.php                             14-Jun-2024 08:03                4669
image.resources.php                                14-Jun-2024 08:03                2140
image.setup.php                                    14-Jun-2024 08:03                1654
imagick.adaptiveblurimage.php                      14-Jun-2024 08:03                7144
imagick.adaptiveresizeimage.php                    14-Jun-2024 08:03                9678
imagick.adaptivesharpenimage.php                   14-Jun-2024 08:03                6623
imagick.adaptivethresholdimage.php                 14-Jun-2024 08:03                6309
imagick.addimage.php                               14-Jun-2024 08:03                3114
imagick.addnoiseimage.php                          14-Jun-2024 08:03                5678
imagick.affinetransformimage.php                   14-Jun-2024 08:03                6689
imagick.animateimages.php                          14-Jun-2024 08:03                3261
imagick.annotateimage.php                          14-Jun-2024 08:03                8909
imagick.appendimages.php                           14-Jun-2024 08:03                6992
imagick.autolevelimage.php                         14-Jun-2024 08:03                4505
imagick.averageimages.php                          14-Jun-2024 08:03                2921
imagick.blackthresholdimage.php                    14-Jun-2024 08:03                5628
imagick.blueshiftimage.php                         14-Jun-2024 08:03                4550
imagick.blurimage.php                              14-Jun-2024 08:03                6059
imagick.borderimage.php                            14-Jun-2024 08:03                6462
imagick.brightnesscontrastimage.php                14-Jun-2024 08:03                5710
imagick.charcoalimage.php                          14-Jun-2024 08:03                5049
imagick.chopimage.php                              14-Jun-2024 08:03                7243
imagick.clampimage.php                             14-Jun-2024 08:03                2788
imagick.clear.php                                  14-Jun-2024 08:03                2347
imagick.clipimage.php                              14-Jun-2024 08:03                2674
imagick.clipimagepath.php                          14-Jun-2024 08:03                3208
imagick.clippathimage.php                          14-Jun-2024 08:03                3689
imagick.clone.php                                  14-Jun-2024 08:03                4272
imagick.clutimage.php                              14-Jun-2024 08:03                6325
imagick.coalesceimages.php                         14-Jun-2024 08:03                3021
imagick.colorfloodfillimage.php                    14-Jun-2024 08:03                6013
imagick.colorizeimage.php                          14-Jun-2024 08:03                7145
imagick.colormatriximage.php                       14-Jun-2024 08:03                7673
imagick.combineimages.php                          14-Jun-2024 08:03                3517
imagick.commentimage.php                           14-Jun-2024 08:03                5184
imagick.compareimagechannels.php                   14-Jun-2024 08:03                4125
imagick.compareimagelayers.php                     14-Jun-2024 08:03                5782
imagick.compareimages.php                          14-Jun-2024 08:03                5810
imagick.compositeimage.php                         14-Jun-2024 08:03                8220
imagick.configuration.php                          14-Jun-2024 08:03                4748
imagick.constants.php                              14-Jun-2024 08:03              159841
imagick.construct.php                              14-Jun-2024 08:03                2790
imagick.contrastimage.php                          14-Jun-2024 08:03                5195
imagick.contraststretchimage.php                   14-Jun-2024 08:03                4095
imagick.convolveimage.php                          14-Jun-2024 08:03                6114
imagick.count.php                                  14-Jun-2024 08:03                2755
imagick.cropimage.php                              14-Jun-2024 08:03                6335
imagick.cropthumbnailimage.php                     14-Jun-2024 08:03                3678
imagick.current.php                                14-Jun-2024 08:03                2633
imagick.cyclecolormapimage.php                     14-Jun-2024 08:03                3187
imagick.decipherimage.php                          14-Jun-2024 08:03                3289
imagick.deconstructimages.php                      14-Jun-2024 08:03                2814
imagick.deleteimageartifact.php                    14-Jun-2024 08:03                3937
imagick.deleteimageproperty.php                    14-Jun-2024 08:03                2697
imagick.deskewimage.php                            14-Jun-2024 08:03               11160
imagick.despeckleimage.php                         14-Jun-2024 08:03                4412
imagick.destroy.php                                14-Jun-2024 08:03                2481
imagick.displayimage.php                           14-Jun-2024 08:03                2942
imagick.displayimages.php                          14-Jun-2024 08:03                2981
imagick.distortimage.php                           14-Jun-2024 08:03               12295
imagick.drawimage.php                              14-Jun-2024 08:03                2701
imagick.edgeimage.php                              14-Jun-2024 08:03                4863
imagick.embossimage.php                            14-Jun-2024 08:03                5562
imagick.encipherimage.php                          14-Jun-2024 08:03                3368
imagick.enhanceimage.php                           14-Jun-2024 08:03                4385
imagick.equalizeimage.php                          14-Jun-2024 08:03                4363
imagick.evaluateimage.php                          14-Jun-2024 08:03                6184
imagick.examples-1.php                             14-Jun-2024 08:03               30860
imagick.examples.php                               14-Jun-2024 08:03                1435
imagick.exportimagepixels.php                      14-Jun-2024 08:03                8251
imagick.extentimage.php                            14-Jun-2024 08:03                5713
imagick.filter.php                                 14-Jun-2024 08:03                7710
imagick.flattenimages.php                          14-Jun-2024 08:03                3028
imagick.flipimage.php                              14-Jun-2024 08:03                4705
imagick.floodfillpaintimage.php                    14-Jun-2024 08:03               11915
imagick.flopimage.php                              14-Jun-2024 08:03                4738
imagick.forwardfouriertransformimage.php           14-Jun-2024 08:03               12137
imagick.frameimage.php                             14-Jun-2024 08:03                8637
imagick.functionimage.php                          14-Jun-2024 08:03               14017
imagick.fximage.php                                14-Jun-2024 08:03                6291
imagick.gammaimage.php                             14-Jun-2024 08:03                5925
imagick.gaussianblurimage.php                      14-Jun-2024 08:03                6483
imagick.getcolorspace.php                          14-Jun-2024 08:03                2566
imagick.getcompression.php                         14-Jun-2024 08:03                2321
imagick.getcompressionquality.php                  14-Jun-2024 08:03                2408
imagick.getcopyright.php                           14-Jun-2024 08:03                2388
imagick.getfilename.php                            14-Jun-2024 08:03                2590
imagick.getfont.php                                14-Jun-2024 08:03                3323
imagick.getformat.php                              14-Jun-2024 08:03                2562
imagick.getgravity.php                             14-Jun-2024 08:03                2549
imagick.gethomeurl.php                             14-Jun-2024 08:03                2305
imagick.getimage.php                               14-Jun-2024 08:03                2537
imagick.getimagealphachannel.php                   14-Jun-2024 08:03                3658
imagick.getimageartifact.php                       14-Jun-2024 08:03                3836
imagick.getimageattribute.php                      14-Jun-2024 08:03                2876
imagick.getimagebackgroundcolor.php                14-Jun-2024 08:03                2741
imagick.getimageblob.php                           14-Jun-2024 08:03                2993
imagick.getimageblueprimary.php                    14-Jun-2024 08:03                3079
imagick.getimagebordercolor.php                    14-Jun-2024 08:03                2803
imagick.getimagechanneldepth.php                   14-Jun-2024 08:03                3325
imagick.getimagechanneldistortion.php              14-Jun-2024 08:03                4267
imagick.getimagechanneldistortions.php             14-Jun-2024 08:03                4751
imagick.getimagechannelextrema.php                 14-Jun-2024 08:03                3859
imagick.getimagechannelkurtosis.php                14-Jun-2024 08:03                3838
imagick.getimagechannelmean.php                    14-Jun-2024 08:03                3466
imagick.getimagechannelrange.php                   14-Jun-2024 08:03                3724
imagick.getimagechannelstatistics.php              14-Jun-2024 08:03                2695
imagick.getimageclipmask.php                       14-Jun-2024 08:03                3196
imagick.getimagecolormapcolor.php                  14-Jun-2024 08:03                3130
imagick.getimagecolors.php                         14-Jun-2024 08:03                2487
imagick.getimagecolorspace.php                     14-Jun-2024 08:03                2498
imagick.getimagecompose.php                        14-Jun-2024 08:03                2487
imagick.getimagecompression.php                    14-Jun-2024 08:03                2415
imagick.getimagecompressionquality.php             14-Jun-2024 08:03                2526
imagick.getimagedelay.php                          14-Jun-2024 08:03                2735
imagick.getimagedepth.php                          14-Jun-2024 08:03                2306
imagick.getimagedispose.php                        14-Jun-2024 08:03                2643
imagick.getimagedistortion.php                     14-Jun-2024 08:03                3411
imagick.getimageextrema.php                        14-Jun-2024 08:03                3061
imagick.getimagefilename.php                       14-Jun-2024 08:03                2730
imagick.getimageformat.php                         14-Jun-2024 08:03                2677
imagick.getimagegamma.php                          14-Jun-2024 08:03                2610
imagick.getimagegeometry.php                       14-Jun-2024 08:03                4379
imagick.getimagegravity.php                        14-Jun-2024 08:03                2897
imagick.getimagegreenprimary.php                   14-Jun-2024 08:03                3006
imagick.getimageheight.php                         14-Jun-2024 08:03                2641
imagick.getimagehistogram.php                      14-Jun-2024 08:03               17590
imagick.getimageindex.php                          14-Jun-2024 08:03                3142
imagick.getimageinterlacescheme.php                14-Jun-2024 08:03                2635
imagick.getimageinterpolatemethod.php              14-Jun-2024 08:03                2916
imagick.getimageiterations.php                     14-Jun-2024 08:03                2684
imagick.getimagelength.php                         14-Jun-2024 08:03                3456
imagick.getimagematte.php                          14-Jun-2024 08:03                3000
imagick.getimagemattecolor.php                     14-Jun-2024 08:03                2988
imagick.getimagemimetype.php                       14-Jun-2024 08:03                2331
imagick.getimageorientation.php                    14-Jun-2024 08:03                2817
imagick.getimagepage.php                           14-Jun-2024 08:03                3123
imagick.getimagepixelcolor.php                     14-Jun-2024 08:03                3378
imagick.getimageprofile.php                        14-Jun-2024 08:03                2971
imagick.getimageprofiles.php                       14-Jun-2024 08:03                3729
imagick.getimageproperties.php                     14-Jun-2024 08:03                6019
imagick.getimageproperty.php                       14-Jun-2024 08:03                5185
imagick.getimageredprimary.php                     14-Jun-2024 08:03                2962
imagick.getimageregion.php                         14-Jun-2024 08:03                4175
imagick.getimagerenderingintent.php                14-Jun-2024 08:03                2808
imagick.getimageresolution.php                     14-Jun-2024 08:03                2711
imagick.getimagesblob.php                          14-Jun-2024 08:03                2839
imagick.getimagescene.php                          14-Jun-2024 08:03                2603
imagick.getimagesignature.php                      14-Jun-2024 08:03                2683
imagick.getimagesize.php                           14-Jun-2024 08:03                2805
imagick.getimagetickspersecond.php                 14-Jun-2024 08:03                2733
imagick.getimagetotalinkdensity.php                14-Jun-2024 08:03                2608
imagick.getimagetype.php                           14-Jun-2024 08:03                5027
imagick.getimageunits.php                          14-Jun-2024 08:03                2670
imagick.getimagevirtualpixelmethod.php             14-Jun-2024 08:03                2817
imagick.getimagewhitepoint.php                     14-Jun-2024 08:03                2876
imagick.getimagewidth.php                          14-Jun-2024 08:03                2618
imagick.getinterlacescheme.php                     14-Jun-2024 08:03                2770
imagick.getiteratorindex.php                       14-Jun-2024 08:03                6321
imagick.getnumberimages.php                        14-Jun-2024 08:03                2671
imagick.getoption.php                              14-Jun-2024 08:03                3072
imagick.getpackagename.php                         14-Jun-2024 08:03                2637
imagick.getpage.php                                14-Jun-2024 08:03                3075
imagick.getpixeliterator.php                       14-Jun-2024 08:03                6163
imagick.getpixelregioniterator.php                 14-Jun-2024 08:03                7391
imagick.getpointsize.php                           14-Jun-2024 08:03                2900
imagick.getquantum.php                             14-Jun-2024 08:03                2355
imagick.getquantumdepth.php                        14-Jun-2024 08:03                2954
imagick.getquantumrange.php                        14-Jun-2024 08:03                3052
imagick.getregistry.php                            14-Jun-2024 08:03                2564
imagick.getreleasedate.php                         14-Jun-2024 08:03                2722
imagick.getresource.php                            14-Jun-2024 08:03                3098
imagick.getresourcelimit.php                       14-Jun-2024 08:03                3534
imagick.getsamplingfactors.php                     14-Jun-2024 08:03                2774
imagick.getsize.php                                14-Jun-2024 08:03                6177
imagick.getsizeoffset.php                          14-Jun-2024 08:03                2764
imagick.getversion.php                             14-Jun-2024 08:03                2711
imagick.haldclutimage.php                          14-Jun-2024 08:03                6365
imagick.hasnextimage.php                           14-Jun-2024 08:03                2639
imagick.haspreviousimage.php                       14-Jun-2024 08:03                2711
imagick.identifyformat.php                         14-Jun-2024 08:03                4517
imagick.identifyimage.php                          14-Jun-2024 08:03                4234
imagick.implodeimage.php                           14-Jun-2024 08:03                4795
imagick.importimagepixels.php                      14-Jun-2024 08:03               11892
imagick.installation.php                           14-Jun-2024 08:03                3359
imagick.inversefouriertransformimage.php           14-Jun-2024 08:03                3566
imagick.labelimage.php                             14-Jun-2024 08:03                2660
imagick.levelimage.php                             14-Jun-2024 08:03                7974
imagick.linearstretchimage.php                     14-Jun-2024 08:03                5772
imagick.liquidrescaleimage.php                     14-Jun-2024 08:03                4755
imagick.listregistry.php                           14-Jun-2024 08:03                2414
imagick.magnifyimage.php                           14-Jun-2024 08:03                4371
imagick.mapimage.php                               14-Jun-2024 08:03                3403
imagick.mattefloodfillimage.php                    14-Jun-2024 08:03                6046
imagick.medianfilterimage.php                      14-Jun-2024 08:03                5312
imagick.mergeimagelayers.php                       14-Jun-2024 08:03                6736
imagick.minifyimage.php                            14-Jun-2024 08:03                2544
imagick.modulateimage.php                          14-Jun-2024 08:03                5714
imagick.montageimage.php                           14-Jun-2024 08:03                4704
imagick.morphimages.php                            14-Jun-2024 08:03                2999
imagick.morphology.php                             14-Jun-2024 08:03               66605
imagick.mosaicimages.php                           14-Jun-2024 08:03                2827
imagick.motionblurimage.php                        14-Jun-2024 08:03                6926
imagick.negateimage.php                            14-Jun-2024 08:03                5834
imagick.newimage.php                               14-Jun-2024 08:03                6648
imagick.newpseudoimage.php                         14-Jun-2024 08:03                6032
imagick.nextimage.php                              14-Jun-2024 08:03                2377
imagick.normalizeimage.php                         14-Jun-2024 08:03                6496
imagick.oilpaintimage.php                          14-Jun-2024 08:03                4645
imagick.opaquepaintimage.php                       14-Jun-2024 08:03                5373
imagick.optimizeimagelayers.php                    14-Jun-2024 08:03                5593
imagick.orderedposterizeimage.php                  14-Jun-2024 08:03                7023
imagick.paintfloodfillimage.php                    14-Jun-2024 08:03                6325
imagick.paintopaqueimage.php                       14-Jun-2024 08:03                5714
imagick.painttransparentimage.php                  14-Jun-2024 08:03                4891
imagick.pingimage.php                              14-Jun-2024 08:03                2780
imagick.pingimageblob.php                          14-Jun-2024 08:03                6102
imagick.pingimagefile.php                          14-Jun-2024 08:03                5953
imagick.polaroidimage.php                          14-Jun-2024 08:03                4835
imagick.posterizeimage.php                         14-Jun-2024 08:03                5683
imagick.previewimages.php                          14-Jun-2024 08:03                3298
imagick.previousimage.php                          14-Jun-2024 08:03                2461
imagick.profileimage.php                           14-Jun-2024 08:03                3530
imagick.quantizeimage.php                          14-Jun-2024 08:03                6847
imagick.quantizeimages.php                         14-Jun-2024 08:03                4181
imagick.queryfontmetrics.php                       14-Jun-2024 08:03                5838
imagick.queryfonts.php                             14-Jun-2024 08:03                4919
imagick.queryformats.php                           14-Jun-2024 08:03                7256
imagick.radialblurimage.php                        14-Jun-2024 08:03                5619
imagick.raiseimage.php                             14-Jun-2024 08:03                6540
imagick.randomthresholdimage.php                   14-Jun-2024 08:03                6580
imagick.readimage.php                              14-Jun-2024 08:03                2618
imagick.readimageblob.php                          14-Jun-2024 08:03                5593
imagick.readimagefile.php                          14-Jun-2024 08:03                3383
imagick.readimages.php                             14-Jun-2024 08:03                2652
imagick.recolorimage.php                           14-Jun-2024 08:03                6553
imagick.reducenoiseimage.php                       14-Jun-2024 08:03                5498
imagick.remapimage.php                             14-Jun-2024 08:03                3703
imagick.removeimage.php                            14-Jun-2024 08:03                2645
imagick.removeimageprofile.php                     14-Jun-2024 08:03                2942
imagick.render.php                                 14-Jun-2024 08:03                2365
imagick.requirements.php                           14-Jun-2024 08:03                1653
imagick.resampleimage.php                          14-Jun-2024 08:03                5696
imagick.resetimagepage.php                         14-Jun-2024 08:03                3002
imagick.resizeimage.php                            14-Jun-2024 08:03               11574
imagick.resources.php                              14-Jun-2024 08:03                1277
imagick.rollimage.php                              14-Jun-2024 08:03                4881
imagick.rotateimage.php                            14-Jun-2024 08:03                5947
imagick.rotationalblurimage.php                    14-Jun-2024 08:03                5841
imagick.roundcorners.php                           14-Jun-2024 08:03                6877
imagick.sampleimage.php                            14-Jun-2024 08:03                3128
imagick.scaleimage.php                             14-Jun-2024 08:03                7305
imagick.segmentimage.php                           14-Jun-2024 08:03                6936
imagick.selectiveblurimage.php                     14-Jun-2024 08:03                6704
imagick.separateimagechannel.php                   14-Jun-2024 08:03                5617
imagick.sepiatoneimage.php                         14-Jun-2024 08:03                5037
imagick.setbackgroundcolor.php                     14-Jun-2024 08:03                3434
imagick.setcolorspace.php                          14-Jun-2024 08:03                3223
imagick.setcompression.php                         14-Jun-2024 08:03                2829
imagick.setcompressionquality.php                  14-Jun-2024 08:03                7027
imagick.setfilename.php                            14-Jun-2024 08:03                2712
imagick.setfirstiterator.php                       14-Jun-2024 08:03                2449
imagick.setfont.php                                14-Jun-2024 08:03                5845
imagick.setformat.php                              14-Jun-2024 08:03                2606
imagick.setgravity.php                             14-Jun-2024 08:03                2843
imagick.setimage.php                               14-Jun-2024 08:03                4987
imagick.setimagealphachannel.php                   14-Jun-2024 08:03                3873
imagick.setimageartifact.php                       14-Jun-2024 08:03                7592
imagick.setimageattribute.php                      14-Jun-2024 08:03                3230
imagick.setimagebackgroundcolor.php                14-Jun-2024 08:03                3791
imagick.setimagebias.php                           14-Jun-2024 08:03                6990
imagick.setimagebiasquantum.php                    14-Jun-2024 08:03                2951
imagick.setimageblueprimary.php                    14-Jun-2024 08:03                3287
imagick.setimagebordercolor.php                    14-Jun-2024 08:03                3764
imagick.setimagechanneldepth.php                   14-Jun-2024 08:03                3310
imagick.setimageclipmask.php                       14-Jun-2024 08:03                8944
imagick.setimagecolormapcolor.php                  14-Jun-2024 08:03                3345
imagick.setimagecolorspace.php                     14-Jun-2024 08:03                3487
imagick.setimagecompose.php                        14-Jun-2024 08:03                3267
imagick.setimagecompression.php                    14-Jun-2024 08:03                3114
imagick.setimagecompressionquality.php             14-Jun-2024 08:03                5089
imagick.setimagedelay.php                          14-Jun-2024 08:03                6366
imagick.setimagedepth.php                          14-Jun-2024 08:03                2939
imagick.setimagedispose.php                        14-Jun-2024 08:03                2963
imagick.setimageextent.php                         14-Jun-2024 08:03                3265
imagick.setimagefilename.php                       14-Jun-2024 08:03                3031
imagick.setimageformat.php                         14-Jun-2024 08:03                2842
imagick.setimagegamma.php                          14-Jun-2024 08:03                2923
imagick.setimagegravity.php                        14-Jun-2024 08:03                3057
imagick.setimagegreenprimary.php                   14-Jun-2024 08:03                3278
imagick.setimageindex.php                          14-Jun-2024 08:03                3550
imagick.setimageinterlacescheme.php                14-Jun-2024 08:03                3129
imagick.setimageinterpolatemethod.php              14-Jun-2024 08:03                2914
imagick.setimageiterations.php                     14-Jun-2024 08:03                5186
imagick.setimagematte.php                          14-Jun-2024 08:03                3010
imagick.setimagemattecolor.php                     14-Jun-2024 08:03                3979
imagick.setimageopacity.php                        14-Jun-2024 08:03                5252
imagick.setimageorientation.php                    14-Jun-2024 08:03                4738
imagick.setimagepage.php                           14-Jun-2024 08:03                3891
imagick.setimageprofile.php                        14-Jun-2024 08:03                3613
imagick.setimageproperty.php                       14-Jun-2024 08:03                5381
imagick.setimageredprimary.php                     14-Jun-2024 08:03                3280
imagick.setimagerenderingintent.php                14-Jun-2024 08:03                3093
imagick.setimageresolution.php                     14-Jun-2024 08:03                5179
imagick.setimagescene.php                          14-Jun-2024 08:03                2955
imagick.setimagetickspersecond.php                 14-Jun-2024 08:03                8034
imagick.setimagetype.php                           14-Jun-2024 08:03                2649
imagick.setimageunits.php                          14-Jun-2024 08:03                2701
imagick.setimagevirtualpixelmethod.php             14-Jun-2024 08:03                3008
imagick.setimagewhitepoint.php                     14-Jun-2024 08:03                3290
imagick.setinterlacescheme.php                     14-Jun-2024 08:03                2739
imagick.setiteratorindex.php                       14-Jun-2024 08:03                6379
imagick.setlastiterator.php                        14-Jun-2024 08:03                2467
imagick.setoption.php                              14-Jun-2024 08:03               11635
imagick.setpage.php                                14-Jun-2024 08:03                3546
imagick.setpointsize.php                           14-Jun-2024 08:03                5503
imagick.setprogressmonitor.php                     14-Jun-2024 08:03               10285
imagick.setregistry.php                            14-Jun-2024 08:03                3109
imagick.setresolution.php                          14-Jun-2024 08:03                3888
imagick.setresourcelimit.php                       14-Jun-2024 08:03                3811
imagick.setsamplingfactors.php                     14-Jun-2024 08:03                6879
imagick.setsize.php                                14-Jun-2024 08:03                2984
imagick.setsizeoffset.php                          14-Jun-2024 08:03                3431
imagick.settype.php                                14-Jun-2024 08:03                2597
imagick.setup.php                                  14-Jun-2024 08:03                1677
imagick.shadeimage.php                             14-Jun-2024 08:03                5623
imagick.shadowimage.php                            14-Jun-2024 08:03                5515
imagick.sharpenimage.php                           14-Jun-2024 08:03                5923
imagick.shaveimage.php                             14-Jun-2024 08:03                4840
imagick.shearimage.php                             14-Jun-2024 08:03                6648
imagick.sigmoidalcontrastimage.php                 14-Jun-2024 08:03                8551
imagick.sketchimage.php                            14-Jun-2024 08:03                6055
imagick.smushimages.php                            14-Jun-2024 08:03                5834
imagick.solarizeimage.php                          14-Jun-2024 08:03                4994
imagick.sparsecolorimage.php                       14-Jun-2024 08:03               27040
imagick.spliceimage.php                            14-Jun-2024 08:03                5879
imagick.spreadimage.php                            14-Jun-2024 08:03                5038
imagick.statisticimage.php                         14-Jun-2024 08:03                6779
imagick.steganoimage.php                           14-Jun-2024 08:03                3163
imagick.stereoimage.php                            14-Jun-2024 08:03                2991
imagick.stripimage.php                             14-Jun-2024 08:03                2696
imagick.subimagematch.php                          14-Jun-2024 08:03                7548
imagick.swirlimage.php                             14-Jun-2024 08:03                4947
imagick.textureimage.php                           14-Jun-2024 08:03                6319
imagick.thresholdimage.php                         14-Jun-2024 08:03                5365
imagick.thumbnailimage.php                         14-Jun-2024 08:03                7881
imagick.tintimage.php                              14-Jun-2024 08:03                8068
imagick.tostring.php                               14-Jun-2024 08:03                3021
imagick.transformimage.php                         14-Jun-2024 08:03                6228
imagick.transformimagecolorspace.php               14-Jun-2024 08:03                5788
imagick.transparentpaintimage.php                  14-Jun-2024 08:03                7429
imagick.transposeimage.php                         14-Jun-2024 08:03                4707
imagick.transverseimage.php                        14-Jun-2024 08:03                4702
imagick.trimimage.php                              14-Jun-2024 08:03                6049
imagick.uniqueimagecolors.php                      14-Jun-2024 08:03                5619
imagick.unsharpmaskimage.php                       14-Jun-2024 08:03                6923
imagick.valid.php                                  14-Jun-2024 08:03                2341
imagick.vignetteimage.php                          14-Jun-2024 08:03                6731
imagick.waveimage.php                              14-Jun-2024 08:03                6505
imagick.whitethresholdimage.php                    14-Jun-2024 08:03                5293
imagick.writeimage.php                             14-Jun-2024 08:03                3238
imagick.writeimagefile.php                         14-Jun-2024 08:03                4000
imagick.writeimages.php                            14-Jun-2024 08:03                2954
imagick.writeimagesfile.php                        14-Jun-2024 08:03                4091
imagickdraw.affine.php                             14-Jun-2024 08:03               17023
imagickdraw.annotation.php                         14-Jun-2024 08:03                3408
imagickdraw.arc.php                                14-Jun-2024 08:03                9842
imagickdraw.bezier.php                             14-Jun-2024 08:03               16981                             14-Jun-2024 08:03                9114
imagickdraw.clear.php                              14-Jun-2024 08:03                2432
imagickdraw.clone.php                              14-Jun-2024 08:03                2481
imagickdraw.color.php                              14-Jun-2024 08:03                3635
imagickdraw.comment.php                            14-Jun-2024 08:03                2767
imagickdraw.composite.php                          14-Jun-2024 08:03               11987
imagickdraw.construct.php                          14-Jun-2024 08:03                2303
imagickdraw.destroy.php                            14-Jun-2024 08:03                2478
imagickdraw.ellipse.php                            14-Jun-2024 08:03               12304
imagickdraw.getclippath.php                        14-Jun-2024 08:03                2456
imagickdraw.getcliprule.php                        14-Jun-2024 08:03                2513
imagickdraw.getclipunits.php                       14-Jun-2024 08:03                2442
imagickdraw.getfillcolor.php                       14-Jun-2024 08:03                2474
imagickdraw.getfillopacity.php                     14-Jun-2024 08:03                2381
imagickdraw.getfillrule.php                        14-Jun-2024 08:03                2494
imagickdraw.getfont.php                            14-Jun-2024 08:03                2427
imagickdraw.getfontfamily.php                      14-Jun-2024 08:03                2507
imagickdraw.getfontsize.php                        14-Jun-2024 08:03                2456
imagickdraw.getfontstretch.php                     14-Jun-2024 08:03                2422
imagickdraw.getfontstyle.php                       14-Jun-2024 08:03                2620
imagickdraw.getfontweight.php                      14-Jun-2024 08:03                2439
imagickdraw.getgravity.php                         14-Jun-2024 08:03                2584
imagickdraw.getstrokeantialias.php                 14-Jun-2024 08:03                2871
imagickdraw.getstrokecolor.php                     14-Jun-2024 08:03                2836
imagickdraw.getstrokedasharray.php                 14-Jun-2024 08:03                2520
imagickdraw.getstrokedashoffset.php                14-Jun-2024 08:03                2505
imagickdraw.getstrokelinecap.php                   14-Jun-2024 08:03                2649
imagickdraw.getstrokelinejoin.php                  14-Jun-2024 08:03                2722
imagickdraw.getstrokemiterlimit.php                14-Jun-2024 08:03                2900
imagickdraw.getstrokeopacity.php                   14-Jun-2024 08:03                2559
imagickdraw.getstrokewidth.php                     14-Jun-2024 08:03                2479
imagickdraw.gettextalignment.php                   14-Jun-2024 08:03                2559
imagickdraw.gettextantialias.php                   14-Jun-2024 08:03                2732
imagickdraw.gettextdecoration.php                  14-Jun-2024 08:03                2607
imagickdraw.gettextencoding.php                    14-Jun-2024 08:03                2647
imagickdraw.gettextinterlinespacing.php            14-Jun-2024 08:03                2508
imagickdraw.gettextinterwordspacing.php            14-Jun-2024 08:03                2532
imagickdraw.gettextkerning.php                     14-Jun-2024 08:03                2413
imagickdraw.gettextundercolor.php                  14-Jun-2024 08:03                2551
imagickdraw.getvectorgraphics.php                  14-Jun-2024 08:03                2617
imagickdraw.line.php                               14-Jun-2024 08:03                8432
imagickdraw.matte.php                              14-Jun-2024 08:03                8410
imagickdraw.pathclose.php                          14-Jun-2024 08:03                2533
imagickdraw.pathcurvetoabsolute.php                14-Jun-2024 08:03                5315
imagickdraw.pathcurvetoquadraticbezierabsolute.php 14-Jun-2024 08:03               11468
imagickdraw.pathcurvetoquadraticbezierrelative.php 14-Jun-2024 08:03                4610
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 14-Jun-2024 08:03               10893
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 14-Jun-2024 08:03               11159
imagickdraw.pathcurvetorelative.php                14-Jun-2024 08:03                5325
imagickdraw.pathcurvetosmoothabsolute.php          14-Jun-2024 08:03                5024
imagickdraw.pathcurvetosmoothrelative.php          14-Jun-2024 08:03                5033
imagickdraw.pathellipticarcabsolute.php            14-Jun-2024 08:03                6134
imagickdraw.pathellipticarcrelative.php            14-Jun-2024 08:03                6123
imagickdraw.pathfinish.php                         14-Jun-2024 08:03                2343
imagickdraw.pathlinetoabsolute.php                 14-Jun-2024 08:03                3352
imagickdraw.pathlinetohorizontalabsolute.php       14-Jun-2024 08:03                3196
imagickdraw.pathlinetohorizontalrelative.php       14-Jun-2024 08:03                3199
imagickdraw.pathlinetorelative.php                 14-Jun-2024 08:03                3393
imagickdraw.pathlinetoverticalabsolute.php         14-Jun-2024 08:03                3163
imagickdraw.pathlinetoverticalrelative.php         14-Jun-2024 08:03                3171
imagickdraw.pathmovetoabsolute.php                 14-Jun-2024 08:03                3392
imagickdraw.pathmovetorelative.php                 14-Jun-2024 08:03                3360
imagickdraw.pathstart.php                          14-Jun-2024 08:03               12097
imagickdraw.point.php                              14-Jun-2024 08:03                6978
imagickdraw.polygon.php                            14-Jun-2024 08:03                9095
imagickdraw.polyline.php                           14-Jun-2024 08:03                9152
imagickdraw.pop.php                                14-Jun-2024 08:03                2784
imagickdraw.popclippath.php                        14-Jun-2024 08:03                2318
imagickdraw.popdefs.php                            14-Jun-2024 08:03                7791
imagickdraw.poppattern.php                         14-Jun-2024 08:03                2503
imagickdraw.push.php                               14-Jun-2024 08:03                8553
imagickdraw.pushclippath.php                       14-Jun-2024 08:03                3081
imagickdraw.pushdefs.php                           14-Jun-2024 08:03                2657
imagickdraw.pushpattern.php                        14-Jun-2024 08:03               14692
imagickdraw.rectangle.php                          14-Jun-2024 08:03                8572
imagickdraw.render.php                             14-Jun-2024 08:03                2543
imagickdraw.resetvectorgraphics.php                14-Jun-2024 08:03                2475
imagickdraw.rotate.php                             14-Jun-2024 08:03                7807
imagickdraw.roundrectangle.php                     14-Jun-2024 08:03                9558
imagickdraw.scale.php                              14-Jun-2024 08:03                8208
imagickdraw.setclippath.php                        14-Jun-2024 08:03                8446
imagickdraw.setcliprule.php                        14-Jun-2024 08:03                9534
imagickdraw.setclipunits.php                       14-Jun-2024 08:03                8924
imagickdraw.setfillalpha.php                       14-Jun-2024 08:03                7859
imagickdraw.setfillcolor.php                       14-Jun-2024 08:03                7841
imagickdraw.setfillopacity.php                     14-Jun-2024 08:03                7884
imagickdraw.setfillpatternurl.php                  14-Jun-2024 08:03                3406
imagickdraw.setfillrule.php                        14-Jun-2024 08:03               13035
imagickdraw.setfont.php                            14-Jun-2024 08:03                9298
imagickdraw.setfontfamily.php                      14-Jun-2024 08:03                9936
imagickdraw.setfontsize.php                        14-Jun-2024 08:03                8319
imagickdraw.setfontstretch.php                     14-Jun-2024 08:03                9793
imagickdraw.setfontstyle.php                       14-Jun-2024 08:03                9088
imagickdraw.setfontweight.php                      14-Jun-2024 08:03                9206
imagickdraw.setgravity.php                         14-Jun-2024 08:03               10658
imagickdraw.setresolution.php                      14-Jun-2024 08:03                2959
imagickdraw.setstrokealpha.php                     14-Jun-2024 08:03                8508
imagickdraw.setstrokeantialias.php                 14-Jun-2024 08:03                9089
imagickdraw.setstrokecolor.php                     14-Jun-2024 08:03                8569
imagickdraw.setstrokedasharray.php                 14-Jun-2024 08:03               13555
imagickdraw.setstrokedashoffset.php                14-Jun-2024 08:03                9955
imagickdraw.setstrokelinecap.php                   14-Jun-2024 08:03                8589
imagickdraw.setstrokelinejoin.php                  14-Jun-2024 08:03               11539
imagickdraw.setstrokemiterlimit.php                14-Jun-2024 08:03               11400
imagickdraw.setstrokeopacity.php                   14-Jun-2024 08:03               10313
imagickdraw.setstrokepatternurl.php                14-Jun-2024 08:03                3053
imagickdraw.setstrokewidth.php                     14-Jun-2024 08:03                8528
imagickdraw.settextalignment.php                   14-Jun-2024 08:03                9527
imagickdraw.settextantialias.php                   14-Jun-2024 08:03                8935
imagickdraw.settextdecoration.php                  14-Jun-2024 08:03                7549
imagickdraw.settextencoding.php                    14-Jun-2024 08:03                3277
imagickdraw.settextinterlinespacing.php            14-Jun-2024 08:03                3048
imagickdraw.settextinterwordspacing.php            14-Jun-2024 08:03                2859
imagickdraw.settextkerning.php                     14-Jun-2024 08:03                2942
imagickdraw.settextundercolor.php                  14-Jun-2024 08:03                7861
imagickdraw.setvectorgraphics.php                  14-Jun-2024 08:03                9049
imagickdraw.setviewbox.php                         14-Jun-2024 08:03               10455
imagickdraw.skewx.php                              14-Jun-2024 08:03                8206
imagickdraw.skewy.php                              14-Jun-2024 08:03                8217
imagickdraw.translate.php                          14-Jun-2024 08:03                8501
imagickkernel.addkernel.php                        14-Jun-2024 08:03                7064
imagickkernel.addunitykernel.php                   14-Jun-2024 08:03               13721
imagickkernel.frombuiltin.php                      14-Jun-2024 08:03               26269
imagickkernel.frommatrix.php                       14-Jun-2024 08:03               23201
imagickkernel.getmatrix.php                        14-Jun-2024 08:03                7129
imagickkernel.scale.php                            14-Jun-2024 08:03               13231
imagickkernel.separate.php                         14-Jun-2024 08:03                9757
imagickpixel.clear.php                             14-Jun-2024 08:03                2484
imagickpixel.construct.php                         14-Jun-2024 08:03               12346
imagickpixel.destroy.php                           14-Jun-2024 08:03                2559
imagickpixel.getcolor.php                          14-Jun-2024 08:03                8393
imagickpixel.getcolorasstring.php                  14-Jun-2024 08:03                5134
imagickpixel.getcolorcount.php                     14-Jun-2024 08:03                5133
imagickpixel.getcolorquantum.php                   14-Jun-2024 08:03                2959
imagickpixel.getcolorvalue.php                     14-Jun-2024 08:03                8992
imagickpixel.getcolorvaluequantum.php              14-Jun-2024 08:03                6145
imagickpixel.gethsl.php                            14-Jun-2024 08:03                4814
imagickpixel.getindex.php                          14-Jun-2024 08:03                2325
imagickpixel.ispixelsimilar.php                    14-Jun-2024 08:03                3691
imagickpixel.ispixelsimilarquantum.php             14-Jun-2024 08:03                3269
imagickpixel.issimilar.php                         14-Jun-2024 08:03               16670
imagickpixel.setcolor.php                          14-Jun-2024 08:03                7785
imagickpixel.setcolorcount.php                     14-Jun-2024 08:03                2724
imagickpixel.setcolorvalue.php                     14-Jun-2024 08:03                5257
imagickpixel.setcolorvaluequantum.php              14-Jun-2024 08:03                8520
imagickpixel.sethsl.php                            14-Jun-2024 08:03                7759
imagickpixel.setindex.php                          14-Jun-2024 08:03                2653
imagickpixeliterator.clear.php                     14-Jun-2024 08:03                6393
imagickpixeliterator.construct.php                 14-Jun-2024 08:03                6258
imagickpixeliterator.destroy.php                   14-Jun-2024 08:03                2567
imagickpixeliterator.getcurrentiteratorrow.php     14-Jun-2024 08:03                2723
imagickpixeliterator.getiteratorrow.php            14-Jun-2024 08:03                2744
imagickpixeliterator.getnextiteratorrow.php        14-Jun-2024 08:03                7004
imagickpixeliterator.getpreviousiteratorrow.php    14-Jun-2024 08:03                2905
imagickpixeliterator.newpixeliterator.php          14-Jun-2024 08:03                2900
imagickpixeliterator.newpixelregioniterator.php    14-Jun-2024 08:03                4582
imagickpixeliterator.resetiterator.php             14-Jun-2024 08:03                8880
imagickpixeliterator.setiteratorfirstrow.php       14-Jun-2024 08:03                2711
imagickpixeliterator.setiteratorlastrow.php        14-Jun-2024 08:03                2706
imagickpixeliterator.setiteratorrow.php            14-Jun-2024 08:03                7238
imagickpixeliterator.synciterator.php              14-Jun-2024 08:03                2543
imap.configuration.php                             14-Jun-2024 08:03                3433
imap.constants.php                                 14-Jun-2024 08:03               25677
imap.installation.php                              14-Jun-2024 08:03                2933
imap.requirements.php                              14-Jun-2024 08:03                3189
imap.resources.php                                 14-Jun-2024 08:03                1487
imap.setup.php                                     14-Jun-2024 08:03                1646
index.php                                          14-Jun-2024 08:03               16190
indexes.examples.php                               14-Jun-2024 08:03              764121
indexes.functions.php                              14-Jun-2024 08:03             1255994
indexes.php                                        14-Jun-2024 08:03                1505
infiniteiterator.construct.php                     14-Jun-2024 08:03                5183                          14-Jun-2024 08:03                3280
info.configuration.php                             14-Jun-2024 08:03               13996
info.constants.php                                 14-Jun-2024 08:03               24661
info.installation.php                              14-Jun-2024 08:03                1298
info.requirements.php                              14-Jun-2024 08:03                1243
info.resources.php                                 14-Jun-2024 08:03                1256
info.setup.php                                     14-Jun-2024 08:03                1648
ini.core.php                                       14-Jun-2024 08:03               77599
ini.list.php                                       14-Jun-2024 08:03              103866
ini.php                                            14-Jun-2024 08:03                1631
ini.sections.php                                   14-Jun-2024 08:03                4259
inotify.configuration.php                          14-Jun-2024 08:03                1300
inotify.constants.php                              14-Jun-2024 08:03               10930
inotify.install.php                                14-Jun-2024 08:03                1962
inotify.requirements.php                           14-Jun-2024 08:03                1285
inotify.resources.php                              14-Jun-2024 08:03                1405
inotify.setup.php                                  14-Jun-2024 08:03                1678                            14-Jun-2024 08:03                4660                     14-Jun-2024 08:03                3040                              14-Jun-2024 08:03                1467                                  14-Jun-2024 08:03                1757
install.fpm.configuration.php                      14-Jun-2024 08:03               36591
install.fpm.install.php                            14-Jun-2024 08:03                3232
install.fpm.php                                    14-Jun-2024 08:03                3766
install.general.php                                14-Jun-2024 08:03                4562
install.macosx.bundled.php                         14-Jun-2024 08:03               11000
install.macosx.compile.php                         14-Jun-2024 08:03                1437
install.macosx.packages.php                        14-Jun-2024 08:03                3211
install.macosx.php                                 14-Jun-2024 08:03                2049
install.pecl.downloads.php                         14-Jun-2024 08:03                3846
install.pecl.intro.php                             14-Jun-2024 08:03                3327
install.pecl.pear.php                              14-Jun-2024 08:03                3124
install.pecl.php                                   14-Jun-2024 08:03                2070
install.pecl.php-config.php                        14-Jun-2024 08:03                4316
install.pecl.phpize.php                            14-Jun-2024 08:03                3339
install.pecl.static.php                            14-Jun-2024 08:03                3600                           14-Jun-2024 08:03               10071
install.php                                        14-Jun-2024 08:03                5958
install.problems.bugs.php                          14-Jun-2024 08:03                2236
install.problems.faq.php                           14-Jun-2024 08:03                1363
install.problems.php                               14-Jun-2024 08:03                1623                       14-Jun-2024 08:03                2380
install.unix.apache2.php                           14-Jun-2024 08:03               14075
install.unix.commandline.php                       14-Jun-2024 08:03                4011
install.unix.debian.php                            14-Jun-2024 08:03                7149
install.unix.lighttpd-14.php                       14-Jun-2024 08:03                6239
install.unix.litespeed.php                         14-Jun-2024 08:03                9038
install.unix.nginx.php                             14-Jun-2024 08:03                8815
install.unix.openbsd.php                           14-Jun-2024 08:03                6091
install.unix.php                                   14-Jun-2024 08:03                8374
install.unix.solaris.php                           14-Jun-2024 08:03                4016                        14-Jun-2024 08:03                7033                       14-Jun-2024 08:03                1727                    14-Jun-2024 08:03                8215                         14-Jun-2024 08:03                5690                           14-Jun-2024 08:03                1684                                14-Jun-2024 08:03                3351                    14-Jun-2024 08:03                5368                   14-Jun-2024 08:03                2438                          14-Jun-2024 08:03                1947                14-Jun-2024 08:03                1880
internaliterator.construct.php                     14-Jun-2024 08:03                2030
internaliterator.current.php                       14-Jun-2024 08:03                2347
internaliterator.key.php                           14-Jun-2024 08:03                2336                          14-Jun-2024 08:03                2334
internaliterator.rewind.php                        14-Jun-2024 08:03                2362
internaliterator.valid.php                         14-Jun-2024 08:03                2333
intl.configuration.php                             14-Jun-2024 08:03                5792
intl.constants.php                                 14-Jun-2024 08:03               33577
intl.examples.basic.php                            14-Jun-2024 08:03                4394
intl.examples.php                                  14-Jun-2024 08:03                1442
intl.installation.php                              14-Jun-2024 08:03                1901
intl.requirements.php                              14-Jun-2024 08:03                1414
intl.resources.php                                 14-Jun-2024 08:03                1256
intl.setup.php                                     14-Jun-2024 08:03                1648
intlbreakiterator.construct.php                    14-Jun-2024 08:03                4219
intlbreakiterator.createcharacterinstance.php      14-Jun-2024 08:03                3397
intlbreakiterator.createcodepointinstance.php      14-Jun-2024 08:03                2850
intlbreakiterator.createlineinstance.php           14-Jun-2024 08:03                3342
intlbreakiterator.createsentenceinstance.php       14-Jun-2024 08:03                3366
intlbreakiterator.createtitleinstance.php          14-Jun-2024 08:03                3314
intlbreakiterator.createwordinstance.php           14-Jun-2024 08:03                3301
intlbreakiterator.current.php                      14-Jun-2024 08:03                2553
intlbreakiterator.first.php                        14-Jun-2024 08:03                2523
intlbreakiterator.following.php                    14-Jun-2024 08:03                2817
intlbreakiterator.geterrorcode.php                 14-Jun-2024 08:03                3097
intlbreakiterator.geterrormessage.php              14-Jun-2024 08:03                3141
intlbreakiterator.getlocale.php                    14-Jun-2024 08:03                2932
intlbreakiterator.getpartsiterator.php             14-Jun-2024 08:03                3847
intlbreakiterator.gettext.php                      14-Jun-2024 08:03                2655
intlbreakiterator.isboundary.php                   14-Jun-2024 08:03                2785
intlbreakiterator.last.php                         14-Jun-2024 08:03                2545                         14-Jun-2024 08:03                2958
intlbreakiterator.preceding.php                    14-Jun-2024 08:03                2811
intlbreakiterator.previous.php                     14-Jun-2024 08:03                2586
intlbreakiterator.settext.php                      14-Jun-2024 08:03                3705
intlcalendar.add.php                               14-Jun-2024 08:03                9082
intlcalendar.after.php                             14-Jun-2024 08:03                7047
intlcalendar.before.php                            14-Jun-2024 08:03                4390
intlcalendar.clear.php                             14-Jun-2024 08:03               19384
intlcalendar.construct.php                         14-Jun-2024 08:03                2423
intlcalendar.createinstance.php                    14-Jun-2024 08:03               13915
intlcalendar.equals.php                            14-Jun-2024 08:03               11131
intlcalendar.fielddifference.php                   14-Jun-2024 08:03               11609
intlcalendar.fromdatetime.php                      14-Jun-2024 08:03                8082
intlcalendar.get.php                               14-Jun-2024 08:03                8950
intlcalendar.getactualmaximum.php                  14-Jun-2024 08:03                8814
intlcalendar.getactualminimum.php                  14-Jun-2024 08:03                5993
intlcalendar.getavailablelocales.php               14-Jun-2024 08:03                4495
intlcalendar.getdayofweektype.php                  14-Jun-2024 08:03               10718
intlcalendar.geterrorcode.php                      14-Jun-2024 08:03                9166
intlcalendar.geterrormessage.php                   14-Jun-2024 08:03                6228
intlcalendar.getfirstdayofweek.php                 14-Jun-2024 08:03                8814
intlcalendar.getgreatestminimum.php                14-Jun-2024 08:03                4878
intlcalendar.getkeywordvaluesforlocale.php         14-Jun-2024 08:03                7565
intlcalendar.getleastmaximum.php                   14-Jun-2024 08:03                8461
intlcalendar.getlocale.php                         14-Jun-2024 08:03                6398
intlcalendar.getmaximum.php                        14-Jun-2024 08:03                5526
intlcalendar.getminimaldaysinfirstweek.php         14-Jun-2024 08:03                9106
intlcalendar.getminimum.php                        14-Jun-2024 08:03                4822
intlcalendar.getnow.php                            14-Jun-2024 08:03                5413
intlcalendar.getrepeatedwalltimeoption.php         14-Jun-2024 08:03               10383
intlcalendar.getskippedwalltimeoption.php          14-Jun-2024 08:03               12722
intlcalendar.gettime.php                           14-Jun-2024 08:03                6693
intlcalendar.gettimezone.php                       14-Jun-2024 08:03                7702
intlcalendar.gettype.php                           14-Jun-2024 08:03                5898
intlcalendar.getweekendtransition.php              14-Jun-2024 08:03                5470
intlcalendar.indaylighttime.php                    14-Jun-2024 08:03                8845
intlcalendar.isequivalentto.php                    14-Jun-2024 08:03                8551
intlcalendar.islenient.php                         14-Jun-2024 08:03                8447
intlcalendar.isset.php                             14-Jun-2024 08:03                4918
intlcalendar.isweekend.php                         14-Jun-2024 08:03                9091
intlcalendar.roll.php                              14-Jun-2024 08:03                9613
intlcalendar.set.php                               14-Jun-2024 08:03               16184
intlcalendar.setdate.php                           14-Jun-2024 08:03                4912
intlcalendar.setdatetime.php                       14-Jun-2024 08:03                6835
intlcalendar.setfirstdayofweek.php                 14-Jun-2024 08:03                9093
intlcalendar.setlenient.php                        14-Jun-2024 08:03                5152
intlcalendar.setminimaldaysinfirstweek.php         14-Jun-2024 08:03                5480
intlcalendar.setrepeatedwalltimeoption.php         14-Jun-2024 08:03                6618
intlcalendar.setskippedwalltimeoption.php          14-Jun-2024 08:03                7485
intlcalendar.settime.php                           14-Jun-2024 08:03                8887
intlcalendar.settimezone.php                       14-Jun-2024 08:03               11521
intlcalendar.todatetime.php                        14-Jun-2024 08:03                7366
intlchar.charage.php                               14-Jun-2024 08:03                5905
intlchar.chardigitvalue.php                        14-Jun-2024 08:03                5566
intlchar.chardirection.php                         14-Jun-2024 08:03               10721
intlchar.charfromname.php                          14-Jun-2024 08:03                7320
intlchar.charmirror.php                            14-Jun-2024 08:03                6599
intlchar.charname.php                              14-Jun-2024 08:03                7677
intlchar.chartype.php                              14-Jun-2024 08:03               11614
intlchar.chr.php                                   14-Jun-2024 08:03                5713
intlchar.digit.php                                 14-Jun-2024 08:03                8465
intlchar.enumcharnames.php                         14-Jun-2024 08:03                9153
intlchar.enumchartypes.php                         14-Jun-2024 08:03                5894
intlchar.foldcase.php                              14-Jun-2024 08:03                4099
intlchar.fordigit.php                              14-Jun-2024 08:03                7147
intlchar.getbidipairedbracket.php                  14-Jun-2024 08:03                6359
intlchar.getblockcode.php                          14-Jun-2024 08:03                5627
intlchar.getcombiningclass.php                     14-Jun-2024 08:03                4971
intlchar.getfc-nfkc-closure.php                    14-Jun-2024 08:03                4992
intlchar.getintpropertymaxvalue.php                14-Jun-2024 08:03                6433
intlchar.getintpropertyminvalue.php                14-Jun-2024 08:03                6426
intlchar.getintpropertyvalue.php                   14-Jun-2024 08:03                8108
intlchar.getnumericvalue.php                       14-Jun-2024 08:03                5677
intlchar.getpropertyenum.php                       14-Jun-2024 08:03                6776
intlchar.getpropertyname.php                       14-Jun-2024 08:03                9131
intlchar.getpropertyvalueenum.php                  14-Jun-2024 08:03                8031
intlchar.getpropertyvaluename.php                  14-Jun-2024 08:03               10946
intlchar.getunicodeversion.php                     14-Jun-2024 08:03                4024
intlchar.hasbinaryproperty.php                     14-Jun-2024 08:03                9069
intlchar.isalnum.php                               14-Jun-2024 08:03                6023
intlchar.isalpha.php                               14-Jun-2024 08:03                5909
intlchar.isbase.php                                14-Jun-2024 08:03                6193
intlchar.isblank.php                               14-Jun-2024 08:03                6861
intlchar.iscntrl.php                               14-Jun-2024 08:03                7002
intlchar.isdefined.php                             14-Jun-2024 08:03                6870
intlchar.isdigit.php                               14-Jun-2024 08:03                6222
intlchar.isgraph.php                               14-Jun-2024 08:03                6139
intlchar.isidignorable.php                         14-Jun-2024 08:03                6402
intlchar.isidpart.php                              14-Jun-2024 08:03                7043
intlchar.isidstart.php                             14-Jun-2024 08:03                6474
intlchar.isisocontrol.php                          14-Jun-2024 08:03                5681
intlchar.isjavaidpart.php                          14-Jun-2024 08:03                6966
intlchar.isjavaidstart.php                         14-Jun-2024 08:03                6696
intlchar.isjavaspacechar.php                       14-Jun-2024 08:03                6929
intlchar.islower.php                               14-Jun-2024 08:03                7377
intlchar.ismirrored.php                            14-Jun-2024 08:03                5805
intlchar.isprint.php                               14-Jun-2024 08:03                6294
intlchar.ispunct.php                               14-Jun-2024 08:03                5898
intlchar.isspace.php                               14-Jun-2024 08:03                6734
intlchar.istitle.php                               14-Jun-2024 08:03                7571
intlchar.isualphabetic.php                         14-Jun-2024 08:03                6018
intlchar.isulowercase.php                          14-Jun-2024 08:03                7048
intlchar.isupper.php                               14-Jun-2024 08:03                7375
intlchar.isuuppercase.php                          14-Jun-2024 08:03                7086
intlchar.isuwhitespace.php                         14-Jun-2024 08:03                7508
intlchar.iswhitespace.php                          14-Jun-2024 08:03                7403
intlchar.isxdigit.php                              14-Jun-2024 08:03                7298
intlchar.ord.php                                   14-Jun-2024 08:03                5545
intlchar.tolower.php                               14-Jun-2024 08:03                7791
intlchar.totitle.php                               14-Jun-2024 08:03                7918
intlchar.toupper.php                               14-Jun-2024 08:03                7683
intlcodepointbreakiterator.getlastcodepoint.php    14-Jun-2024 08:03                2796
intldateformatter.create.php                       14-Jun-2024 08:03               29910
intldateformatter.format.php                       14-Jun-2024 08:03               27136
intldateformatter.formatobject.php                 14-Jun-2024 08:03               14935
intldateformatter.getcalendar.php                  14-Jun-2024 08:03               11152
intldateformatter.getcalendarobject.php            14-Jun-2024 08:03                7870
intldateformatter.getdatetype.php                  14-Jun-2024 08:03               12005
intldateformatter.geterrorcode.php                 14-Jun-2024 08:03                8704
intldateformatter.geterrormessage.php              14-Jun-2024 08:03                8698
intldateformatter.getlocale.php                    14-Jun-2024 08:03               12578
intldateformatter.getpattern.php                   14-Jun-2024 08:03               10611
intldateformatter.gettimetype.php                  14-Jun-2024 08:03               11885
intldateformatter.gettimezone.php                  14-Jun-2024 08:03                8790
intldateformatter.gettimezoneid.php                14-Jun-2024 08:03                9095
intldateformatter.islenient.php                    14-Jun-2024 08:03               14763
intldateformatter.localtime.php                    14-Jun-2024 08:03               11029
intldateformatter.parse.php                        14-Jun-2024 08:03               12791
intldateformatter.setcalendar.php                  14-Jun-2024 08:03               14775
intldateformatter.setlenient.php                   14-Jun-2024 08:03               15914
intldateformatter.setpattern.php                   14-Jun-2024 08:03               11961
intldateformatter.settimezone.php                  14-Jun-2024 08:03               12915
intldatepatterngenerator.create.php                14-Jun-2024 08:03                4434
intldatepatterngenerator.getbestpattern.php        14-Jun-2024 08:03                6949
intlgregoriancalendar.construct.php                14-Jun-2024 08:03                5710
intlgregoriancalendar.createfromdate.php           14-Jun-2024 08:03                7448
intlgregoriancalendar.createfromdatetime.php       14-Jun-2024 08:03                9157
intlgregoriancalendar.getgregorianchange.php       14-Jun-2024 08:03                2758
intlgregoriancalendar.isleapyear.php               14-Jun-2024 08:03                3117
intlgregoriancalendar.setgregorianchange.php       14-Jun-2024 08:03                3161
intliterator.current.php                           14-Jun-2024 08:03                2422
intliterator.key.php                               14-Jun-2024 08:03                2387                              14-Jun-2024 08:03                2403
intliterator.rewind.php                            14-Jun-2024 08:03                2435
intliterator.valid.php                             14-Jun-2024 08:03                2407
intlpartsiterator.getbreakiterator.php             14-Jun-2024 08:03                2654
intlrulebasedbreakiterator.construct.php           14-Jun-2024 08:03                3267
intlrulebasedbreakiterator.getbinaryrules.php      14-Jun-2024 08:03                2891
intlrulebasedbreakiterator.getrules.php            14-Jun-2024 08:03                2858
intlrulebasedbreakiterator.getrulestatus.php       14-Jun-2024 08:03                2841
intlrulebasedbreakiterator.getrulestatusvec.php    14-Jun-2024 08:03                2972
intltimezone.construct.php                         14-Jun-2024 08:03                2018
intltimezone.countequivalentids.php                14-Jun-2024 08:03                3757
intltimezone.createdefault.php                     14-Jun-2024 08:03                3083
intltimezone.createenumeration.php                 14-Jun-2024 08:03                4826
intltimezone.createtimezone.php                    14-Jun-2024 08:03                3725
intltimezone.createtimezoneidenumeration.php       14-Jun-2024 08:03                5899
intltimezone.fromdatetimezone.php                  14-Jun-2024 08:03                3840
intltimezone.getcanonicalid.php                    14-Jun-2024 08:03                4519
intltimezone.getdisplayname.php                    14-Jun-2024 08:03                5657
intltimezone.getdstsavings.php                     14-Jun-2024 08:03                3213
intltimezone.getequivalentid.php                   14-Jun-2024 08:03                4180
intltimezone.geterrorcode.php                      14-Jun-2024 08:03                3406
intltimezone.geterrormessage.php                   14-Jun-2024 08:03                3434
intltimezone.getgmt.php                            14-Jun-2024 08:03                2926
intltimezone.getid.php                             14-Jun-2024 08:03                3283
intltimezone.getidforwindowsid.php                 14-Jun-2024 08:03                5898
intltimezone.getoffset.php                         14-Jun-2024 08:03                5188
intltimezone.getrawoffset.php                      14-Jun-2024 08:03                3170
intltimezone.getregion.php                         14-Jun-2024 08:03                3740
intltimezone.gettzdataversion.php                  14-Jun-2024 08:03                3310
intltimezone.getunknown.php                        14-Jun-2024 08:03                3185
intltimezone.getwindowsid.php                      14-Jun-2024 08:03                4479
intltimezone.hassamerules.php                      14-Jun-2024 08:03                3571
intltimezone.todatetimezone.php                    14-Jun-2024 08:03                3503
intltimezone.usedaylighttime.php                   14-Jun-2024 08:03                3192
intro-whatcando.php                                14-Jun-2024 08:03                8382
intro-whatis.php                                   14-Jun-2024 08:03                4264
intro.apache.php                                   14-Jun-2024 08:03                1221
intro.apcu.php                                     14-Jun-2024 08:03                2038
intro.array.php                                    14-Jun-2024 08:03                2134
intro.bc.php                                       14-Jun-2024 08:03                4760
intro.bzip2.php                                    14-Jun-2024 08:03                1239
intro.calendar.php                                 14-Jun-2024 08:03                2091
intro.classobj.php                                 14-Jun-2024 08:03                1871
intro.cmark.php                                    14-Jun-2024 08:03                7361                                      14-Jun-2024 08:03                3394
intro.componere.php                                14-Jun-2024 08:03                6687
intro.ctype.php                                    14-Jun-2024 08:03                4236
intro.cubrid.php                                   14-Jun-2024 08:03                1536
intro.curl.php                                     14-Jun-2024 08:03                1743
intro.datetime.php                                 14-Jun-2024 08:03                3041
intro.dba.php                                      14-Jun-2024 08:03                1594
intro.dbase.php                                    14-Jun-2024 08:03                7640
intro.dio.php                                      14-Jun-2024 08:03                1795
intro.dom.php                                      14-Jun-2024 08:03                1751
intro.ds.php                                       14-Jun-2024 08:03                1444
intro.eio.php                                      14-Jun-2024 08:03               14917
intro.enchant.php                                  14-Jun-2024 08:03                2681
intro.errorfunc.php                                14-Jun-2024 08:03                2072
intro.ev.php                                       14-Jun-2024 08:03                2524
intro.event.php                                    14-Jun-2024 08:03                2105
intro.exec.php                                     14-Jun-2024 08:03                1884
intro.exif.php                                     14-Jun-2024 08:03                1533
intro.expect.php                                   14-Jun-2024 08:03                1481
intro.fann.php                                     14-Jun-2024 08:03                1427
intro.fdf.php                                      14-Jun-2024 08:03                4066
intro.ffi.php                                      14-Jun-2024 08:03                3205
intro.fileinfo.php                                 14-Jun-2024 08:03                1512
intro.filesystem.php                               14-Jun-2024 08:03                1554
intro.filter.php                                   14-Jun-2024 08:03                2962
intro.fpm.php                                      14-Jun-2024 08:03                1428
intro.ftp.php                                      14-Jun-2024 08:03                1826
intro.funchand.php                                 14-Jun-2024 08:03                1252
intro.gearman.php                                  14-Jun-2024 08:03                1790
intro.gender.php                                   14-Jun-2024 08:03                1383
intro.geoip.php                                    14-Jun-2024 08:03                1639
intro.gettext.php                                  14-Jun-2024 08:03                1584
intro.gmagick.php                                  14-Jun-2024 08:03                1813
intro.gmp.php                                      14-Jun-2024 08:03                3646
intro.gnupg.php                                    14-Jun-2024 08:03                1241
intro.hash.php                                     14-Jun-2024 08:03                1275
intro.hrtime.php                                   14-Jun-2024 08:03                1774
intro.ibase.php                                    14-Jun-2024 08:03                3475                                  14-Jun-2024 08:03                1319
intro.iconv.php                                    14-Jun-2024 08:03                1883
intro.igbinary.php                                 14-Jun-2024 08:03                1925
intro.image.php                                    14-Jun-2024 08:03                7313
intro.imagick.php                                  14-Jun-2024 08:03                1922
intro.imap.php                                     14-Jun-2024 08:03                1786                                     14-Jun-2024 08:03                1537
intro.inotify.php                                  14-Jun-2024 08:03                2409
intro.intl.php                                     14-Jun-2024 08:03                5514
intro.json.php                                     14-Jun-2024 08:03                1729
intro.ldap.php                                     14-Jun-2024 08:03                4525
intro.libxml.php                                   14-Jun-2024 08:03                1814
intro.lua.php                                      14-Jun-2024 08:03                1305
intro.luasandbox.php                               14-Jun-2024 08:03                2380
intro.lzf.php                                      14-Jun-2024 08:03                1497
intro.mail.php                                     14-Jun-2024 08:03                1237
intro.mailparse.php                                14-Jun-2024 08:03                1973
intro.math.php                                     14-Jun-2024 08:03                2073
intro.mbstring.php                                 14-Jun-2024 08:03                2504
intro.mcrypt.php                                   14-Jun-2024 08:03                2391
intro.memcache.php                                 14-Jun-2024 08:03                1939
intro.memcached.php                                14-Jun-2024 08:03                1997
intro.mhash.php                                    14-Jun-2024 08:03                3031
intro.misc.php                                     14-Jun-2024 08:03                1205
intro.mqseries.php                                 14-Jun-2024 08:03                1802
intro.mysql-xdevapi.php                            14-Jun-2024 08:03                1952
intro.mysql.php                                    14-Jun-2024 08:03                1986
intro.mysqli.php                                   14-Jun-2024 08:03                2329
intro.mysqlnd.php                                  14-Jun-2024 08:03                2133                                  14-Jun-2024 08:03                1184
intro.oauth.php                                    14-Jun-2024 08:03                1415
intro.oci8.php                                     14-Jun-2024 08:03                1582
intro.opcache.php                                  14-Jun-2024 08:03                1637
intro.openal.php                                   14-Jun-2024 08:03                1295
intro.openssl.php                                  14-Jun-2024 08:03                1639
intro.outcontrol.php                               14-Jun-2024 08:03                1949
intro.parallel.php                                 14-Jun-2024 08:03                6904
intro.parle.php                                    14-Jun-2024 08:03                3454
intro.password.php                                 14-Jun-2024 08:03                1533
intro.pcntl.php                                    14-Jun-2024 08:03                2801
intro.pcre.php                                     14-Jun-2024 08:03                2842
intro.pdo.php                                      14-Jun-2024 08:03                2352
intro.pgsql.php                                    14-Jun-2024 08:03                1587
intro.phar.php                                     14-Jun-2024 08:03               10912
intro.phpdbg.php                                   14-Jun-2024 08:03                6056
intro.posix.php                                    14-Jun-2024 08:03                1770                                       14-Jun-2024 08:03                1909
intro.pspell.php                                   14-Jun-2024 08:03                1242
intro.pthreads.php                                 14-Jun-2024 08:03               10262
intro.quickhash.php                                14-Jun-2024 08:03                1282
intro.radius.php                                   14-Jun-2024 08:03                2326
intro.random.php                                   14-Jun-2024 08:03                1124
intro.rar.php                                      14-Jun-2024 08:03                1596
intro.readline.php                                 14-Jun-2024 08:03                2188
intro.recode.php                                   14-Jun-2024 08:03                2337
intro.reflection.php                               14-Jun-2024 08:03                1936
intro.rnp.php                                      14-Jun-2024 08:03                1295
intro.rpminfo.php                                  14-Jun-2024 08:03                1412
intro.rrd.php                                      14-Jun-2024 08:03                1594
intro.runkit7.php                                  14-Jun-2024 08:03                1494
intro.scoutapm.php                                 14-Jun-2024 08:03                1502
intro.seaslog.php                                  14-Jun-2024 08:03                3948
intro.sem.php                                      14-Jun-2024 08:03                3564
intro.session.php                                  14-Jun-2024 08:03                5205
intro.shmop.php                                    14-Jun-2024 08:03                1346
intro.simdjson.php                                 14-Jun-2024 08:03                1244
intro.simplexml.php                                14-Jun-2024 08:03                1355
intro.snmp.php                                     14-Jun-2024 08:03                1752
intro.soap.php                                     14-Jun-2024 08:03                1505
intro.sockets.php                                  14-Jun-2024 08:03                2727
intro.sodium.php                                   14-Jun-2024 08:03                1428
intro.solr.php                                     14-Jun-2024 08:03                1922
intro.spl.php                                      14-Jun-2024 08:03                1699
intro.sqlite3.php                                  14-Jun-2024 08:03                1183
intro.sqlsrv.php                                   14-Jun-2024 08:03                2255
intro.ssdeep.php                                   14-Jun-2024 08:03                1899
intro.ssh2.php                                     14-Jun-2024 08:03                1393
intro.stats.php                                    14-Jun-2024 08:03                1526
intro.stomp.php                                    14-Jun-2024 08:03                1371                                   14-Jun-2024 08:03                4696
intro.strings.php                                  14-Jun-2024 08:03                1836
intro.svm.php                                      14-Jun-2024 08:03                1296
intro.svn.php                                      14-Jun-2024 08:03                1868
intro.swoole.php                                   14-Jun-2024 08:03                1675
intro.sync.php                                     14-Jun-2024 08:03                2686
intro.taint.php                                    14-Jun-2024 08:03                4378
intro.tcpwrap.php                                  14-Jun-2024 08:03                1296
intro.tidy.php                                     14-Jun-2024 08:03                1412
intro.tokenizer.php                                14-Jun-2024 08:03                1566
intro.trader.php                                   14-Jun-2024 08:03                2712
intro.ui.php                                       14-Jun-2024 08:03                1240
intro.uodbc.php                                    14-Jun-2024 08:03                2916
intro.uopz.php                                     14-Jun-2024 08:03                2511
intro.url.php                                      14-Jun-2024 08:03                1168
intro.v8js.php                                     14-Jun-2024 08:03                1251
intro.var.php                                      14-Jun-2024 08:03                1361
intro.var_representation.php                       14-Jun-2024 08:03                1444
intro.varnish.php                                  14-Jun-2024 08:03                1346
intro.wddx.php                                     14-Jun-2024 08:03                2399
intro.win32service.php                             14-Jun-2024 08:03                1470
intro.wincache.php                                 14-Jun-2024 08:03                5610
intro.wkhtmltox.php                                14-Jun-2024 08:03                1319
intro.xattr.php                                    14-Jun-2024 08:03                1221
intro.xdiff.php                                    14-Jun-2024 08:03                2837
intro.xhprof.php                                   14-Jun-2024 08:03                3087
intro.xlswriter.php                                14-Jun-2024 08:03                1230
intro.xml.php                                      14-Jun-2024 08:03                2526
intro.xmldiff.php                                  14-Jun-2024 08:03                1512
intro.xmlreader.php                                14-Jun-2024 08:03                1631
intro.xmlrpc.php                                   14-Jun-2024 08:03                1958
intro.xmlwriter.php                                14-Jun-2024 08:03                1538
intro.xsl.php                                      14-Jun-2024 08:03                1373
intro.yac.php                                      14-Jun-2024 08:03                1247
intro.yaconf.php                                   14-Jun-2024 08:03                2727
intro.yaf.php                                      14-Jun-2024 08:03                1591
intro.yaml.php                                     14-Jun-2024 08:03                1468
intro.yar.php                                      14-Jun-2024 08:03                1305
intro.yaz.php                                      14-Jun-2024 08:03                2644                                      14-Jun-2024 08:03                1260
intro.zlib.php                                     14-Jun-2024 08:03                1765
intro.zmq.php                                      14-Jun-2024 08:03                1430
intro.zookeeper.php                                14-Jun-2024 08:03                1513
introduction.php                                   14-Jun-2024 08:03                1503
iterator.current.php                               14-Jun-2024 08:03                2204
iterator.key.php                                   14-Jun-2024 08:03                2645                                  14-Jun-2024 08:03                2480
iterator.rewind.php                                14-Jun-2024 08:03                2664
iterator.valid.php                                 14-Jun-2024 08:03                2824
iteratoraggregate.getiterator.php                  14-Jun-2024 08:03                2921
iteratoriterator.construct.php                     14-Jun-2024 08:03                3545
iteratoriterator.current.php                       14-Jun-2024 08:03                2787
iteratoriterator.getinneriterator.php              14-Jun-2024 08:03                3272
iteratoriterator.key.php                           14-Jun-2024 08:03                2722                          14-Jun-2024 08:03                2915
iteratoriterator.rewind.php                        14-Jun-2024 08:03                2934
iteratoriterator.valid.php                         14-Jun-2024 08:03                3125
json.configuration.php                             14-Jun-2024 08:03                1270
json.constants.php                                 14-Jun-2024 08:03               17827
json.installation.php                              14-Jun-2024 08:03                1992
json.requirements.php                              14-Jun-2024 08:03                1273
json.resources.php                                 14-Jun-2024 08:03                1256
json.setup.php                                     14-Jun-2024 08:03                1614
jsonserializable.jsonserialize.php                 14-Jun-2024 08:03               12632
langref.php                                        14-Jun-2024 08:03               22239
language.attributes.classes.php                    14-Jun-2024 08:03                6916
language.attributes.overview.php                   14-Jun-2024 08:03               10728
language.attributes.php                            14-Jun-2024 08:03                1824
language.attributes.reflection.php                 14-Jun-2024 08:03                8555
language.attributes.syntax.php                     14-Jun-2024 08:03                6373
language.basic-syntax.comments.php                 14-Jun-2024 08:03                4152
language.basic-syntax.instruction-separation.php   14-Jun-2024 08:03                4457
language.basic-syntax.php                          14-Jun-2024 08:03                1747
language.basic-syntax.phpmode.php                  14-Jun-2024 08:03                4826
language.basic-syntax.phptags.php                  14-Jun-2024 08:03                5059
language.constants.magic.php                       14-Jun-2024 08:03                5688
language.constants.php                             14-Jun-2024 08:03                6448
language.constants.predefined.php                  14-Jun-2024 08:03                1546
language.constants.syntax.php                      14-Jun-2024 08:03               10849
language.control-structures.php                    14-Jun-2024 08:03                2803
language.enumerations.backed.php                   14-Jun-2024 08:03               10778
language.enumerations.basics.php                   14-Jun-2024 08:03                8759
language.enumerations.constants.php                14-Jun-2024 08:03                2554
language.enumerations.examples.php                 14-Jun-2024 08:03                7520
language.enumerations.expressions.php              14-Jun-2024 08:03                7032
language.enumerations.listing.php                  14-Jun-2024 08:03                2328
language.enumerations.methods.php                  14-Jun-2024 08:03               13913
language.enumerations.object-differences.inheri..> 14-Jun-2024 08:03                6253
language.enumerations.object-differences.php       14-Jun-2024 08:03                5259
language.enumerations.overview.php                 14-Jun-2024 08:03                2715
language.enumerations.php                          14-Jun-2024 08:03                2719
language.enumerations.serialization.php            14-Jun-2024 08:03                5133
language.enumerations.static-methods.php           14-Jun-2024 08:03                3433
language.enumerations.traits.php                   14-Jun-2024 08:03                4488
language.errors.basics.php                         14-Jun-2024 08:03                5601
language.errors.php                                14-Jun-2024 08:03                1984
language.errors.php7.php                           14-Jun-2024 08:03                6027
language.exceptions.extending.php                  14-Jun-2024 08:03               19873
language.exceptions.php                            14-Jun-2024 08:03               28451
language.expressions.php                           14-Jun-2024 08:03               16761
language.fibers.php                                14-Jun-2024 08:03                6773
language.functions.php                             14-Jun-2024 08:03                2056
language.generators.comparison.php                 14-Jun-2024 08:03                9089
language.generators.overview.php                   14-Jun-2024 08:03                9626
language.generators.php                            14-Jun-2024 08:03                1738
language.generators.syntax.php                     14-Jun-2024 08:03               24535
language.namespaces.basics.php                     14-Jun-2024 08:03               11266
language.namespaces.definition.php                 14-Jun-2024 08:03                4534
language.namespaces.definitionmultiple.php         14-Jun-2024 08:03                9280
language.namespaces.dynamic.php                    14-Jun-2024 08:03                8341
language.namespaces.fallback.php                   14-Jun-2024 08:03                6149
language.namespaces.faq.php                        14-Jun-2024 08:03               32900                     14-Jun-2024 08:03                2832
language.namespaces.importing.php                  14-Jun-2024 08:03               15231
language.namespaces.nested.php                     14-Jun-2024 08:03                2961
language.namespaces.nsconstants.php                14-Jun-2024 08:03                8973
language.namespaces.php                            14-Jun-2024 08:03                2477
language.namespaces.rationale.php                  14-Jun-2024 08:03                6665
language.namespaces.rules.php                      14-Jun-2024 08:03               12710
language.oop5.abstract.php                         14-Jun-2024 08:03               10982
language.oop5.anonymous.php                        14-Jun-2024 08:03               10627
language.oop5.autoload.php                         14-Jun-2024 08:03                6886
language.oop5.basic.php                            14-Jun-2024 08:03               50506
language.oop5.changelog.php                        14-Jun-2024 08:03               14401
language.oop5.cloning.php                          14-Jun-2024 08:03                9081
language.oop5.constants.php                        14-Jun-2024 08:03                9259
language.oop5.decon.php                            14-Jun-2024 08:03               29624                            14-Jun-2024 08:03                6202
language.oop5.inheritance.php                      14-Jun-2024 08:03               13525
language.oop5.interfaces.php                       14-Jun-2024 08:03               23638
language.oop5.iterations.php                       14-Jun-2024 08:03                5883
language.oop5.late-static-bindings.php             14-Jun-2024 08:03               15095
language.oop5.magic.php                            14-Jun-2024 08:03               41894
language.oop5.object-comparison.php                14-Jun-2024 08:03                8967
language.oop5.overloading.php                      14-Jun-2024 08:03               24806
language.oop5.paamayim-nekudotayim.php             14-Jun-2024 08:03                8870
language.oop5.php                                  14-Jun-2024 08:03                3541                       14-Jun-2024 08:03               27905
language.oop5.references.php                       14-Jun-2024 08:03                5926
language.oop5.serialization.php                    14-Jun-2024 08:03                7511
language.oop5.static.php                           14-Jun-2024 08:03                9507
language.oop5.traits.php                           14-Jun-2024 08:03               35312
language.oop5.variance.php                         14-Jun-2024 08:03               16122
language.oop5.visibility.php                       14-Jun-2024 08:03               24907
language.operators.arithmetic.php                  14-Jun-2024 08:03                6134
language.operators.array.php                       14-Jun-2024 08:03                9056
language.operators.assignment.php                  14-Jun-2024 08:03               11825
language.operators.bitwise.php                     14-Jun-2024 08:03               44393
language.operators.comparison.php                  14-Jun-2024 08:03               42609
language.operators.errorcontrol.php                14-Jun-2024 08:03                6252
language.operators.execution.php                   14-Jun-2024 08:03                3570
language.operators.increment.php                   14-Jun-2024 08:03               14409
language.operators.logical.php                     14-Jun-2024 08:03                7773
language.operators.php                             14-Jun-2024 08:03                4020
language.operators.precedence.php                  14-Jun-2024 08:03               20106
language.operators.string.php                      14-Jun-2024 08:03                3315
language.operators.type.php                        14-Jun-2024 08:03               18527
language.references.arent.php                      14-Jun-2024 08:03                3387
language.references.pass.php                       14-Jun-2024 08:03                6908
language.references.php                            14-Jun-2024 08:03                2150
language.references.return.php                     14-Jun-2024 08:03                7299                       14-Jun-2024 08:03                2694
language.references.unset.php                      14-Jun-2024 08:03                2403
language.references.whatare.php                    14-Jun-2024 08:03                2358
language.references.whatdo.php                     14-Jun-2024 08:03               18966
language.types.array.php                           14-Jun-2024 08:03               99165
language.types.boolean.php                         14-Jun-2024 08:03                9786
language.types.callable.php                        14-Jun-2024 08:03               12533
language.types.declarations.php                    14-Jun-2024 08:03               44173
language.types.enumerations.php                    14-Jun-2024 08:03                3788
language.types.float.php                           14-Jun-2024 08:03               10168
language.types.integer.php                         14-Jun-2024 08:03               20916
language.types.intro.php                           14-Jun-2024 08:03                8470
language.types.iterable.php                        14-Jun-2024 08:03                3182
language.types.mixed.php                           14-Jun-2024 08:03                1799
language.types.never.php                           14-Jun-2024 08:03                2060
language.types.null.php                            14-Jun-2024 08:03                3704
language.types.numeric-strings.php                 14-Jun-2024 08:03               11590
language.types.object.php                          14-Jun-2024 08:03                5469
language.types.php                                 14-Jun-2024 08:03                2977
language.types.relative-class-types.php            14-Jun-2024 08:03                2255
language.types.resource.php                        14-Jun-2024 08:03                3130
language.types.string.php                          14-Jun-2024 08:03               84658
language.types.type-juggling.php                   14-Jun-2024 08:03               27650
language.types.type-system.php                     14-Jun-2024 08:03                8753
language.types.value.php                           14-Jun-2024 08:03                2327
language.types.void.php                            14-Jun-2024 08:03                2044
language.variables.basics.php                      14-Jun-2024 08:03               14258
language.variables.external.php                    14-Jun-2024 08:03               18012
language.variables.php                             14-Jun-2024 08:03                1801
language.variables.predefined.php                  14-Jun-2024 08:03                3068
language.variables.scope.php                       14-Jun-2024 08:03               28743
language.variables.superglobals.php                14-Jun-2024 08:03                4477
language.variables.variable.php                    14-Jun-2024 08:03               10443
ldap.configuration.php                             14-Jun-2024 08:03                2538
ldap.constants.php                                 14-Jun-2024 08:03               34133
ldap.controls.php                                  14-Jun-2024 08:03                9934
ldap.examples-basic.php                            14-Jun-2024 08:03                8275
ldap.examples-controls.php                         14-Jun-2024 08:03               16166
ldap.examples.php                                  14-Jun-2024 08:03                1449
ldap.installation.php                              14-Jun-2024 08:03                3037
ldap.requirements.php                              14-Jun-2024 08:03                1575
ldap.resources.php                                 14-Jun-2024 08:03                1532
ldap.setup.php                                     14-Jun-2024 08:03                1647
ldap.using.php                                     14-Jun-2024 08:03                2317
libxml.configuration.php                           14-Jun-2024 08:03                1322
libxml.constants.php                               14-Jun-2024 08:03               14088
libxml.installation.php                            14-Jun-2024 08:03                2125
libxml.installation_old.php                        14-Jun-2024 08:03                2839
libxml.requirements.php                            14-Jun-2024 08:03                1414
libxml.resources.php                               14-Jun-2024 08:03                1270
libxml.setup.php                                   14-Jun-2024 08:03                1793
limititerator.construct.php                        14-Jun-2024 08:03                7443
limititerator.current.php                          14-Jun-2024 08:03                3742
limititerator.getposition.php                      14-Jun-2024 08:03                5823
limititerator.key.php                              14-Jun-2024 08:03                3779                             14-Jun-2024 08:03                3493
limititerator.rewind.php                           14-Jun-2024 08:03                3643                             14-Jun-2024 08:03                4306
limititerator.valid.php                            14-Jun-2024 08:03                3707
locale.acceptfromhttp.php                          14-Jun-2024 08:03                6445
locale.canonicalize.php                            14-Jun-2024 08:03                3254
locale.composelocale.php                           14-Jun-2024 08:03               13765
locale.filtermatches.php                           14-Jun-2024 08:03                9523
locale.getallvariants.php                          14-Jun-2024 08:03                6823
locale.getdefault.php                              14-Jun-2024 08:03                6126
locale.getdisplaylanguage.php                      14-Jun-2024 08:03                9927
locale.getdisplayname.php                          14-Jun-2024 08:03                9913
locale.getdisplayregion.php                        14-Jun-2024 08:03                9793
locale.getdisplayscript.php                        14-Jun-2024 08:03                9800
locale.getdisplayvariant.php                       14-Jun-2024 08:03                9843
locale.getkeywords.php                             14-Jun-2024 08:03                7381
locale.getprimarylanguage.php                      14-Jun-2024 08:03                6215
locale.getregion.php                               14-Jun-2024 08:03                6185
locale.getscript.php                               14-Jun-2024 08:03                5841
locale.lookup.php                                  14-Jun-2024 08:03               10443
locale.parselocale.php                             14-Jun-2024 08:03                7575
locale.setdefault.php                              14-Jun-2024 08:03                5494
lua.assign.php                                     14-Jun-2024 08:03                4706                                       14-Jun-2024 08:03                7669
lua.configuration.php                              14-Jun-2024 08:03                1263
lua.construct.php                                  14-Jun-2024 08:03                2471
lua.eval.php                                       14-Jun-2024 08:03                3890
lua.getversion.php                                 14-Jun-2024 08:03                2352
lua.include.php                                    14-Jun-2024 08:03                2814
lua.installation.php                               14-Jun-2024 08:03                2250
lua.registercallback.php                           14-Jun-2024 08:03                4683
lua.requirements.php                               14-Jun-2024 08:03                1340
lua.resources.php                                  14-Jun-2024 08:03                1237
lua.setup.php                                      14-Jun-2024 08:03                1601
luaclosure.invoke.php                              14-Jun-2024 08:03                4187
luasandbox.callfunction.php                        14-Jun-2024 08:03                5095
luasandbox.configuration.php                       14-Jun-2024 08:03                1312
luasandbox.disableprofiler.php                     14-Jun-2024 08:03                2922
luasandbox.enableprofiler.php                      14-Jun-2024 08:03                3540
luasandbox.examples-basic.php                      14-Jun-2024 08:03                6650
luasandbox.examples.php                            14-Jun-2024 08:03                1495
luasandbox.getcpuusage.php                         14-Jun-2024 08:03                3660
luasandbox.getmemoryusage.php                      14-Jun-2024 08:03                3240
luasandbox.getpeakmemoryusage.php                  14-Jun-2024 08:03                3290
luasandbox.getprofilerfunctionreport.php           14-Jun-2024 08:03                6037
luasandbox.getversioninfo.php                      14-Jun-2024 08:03                3153
luasandbox.installation.php                        14-Jun-2024 08:03                2316
luasandbox.loadbinary.php                          14-Jun-2024 08:03                3669
luasandbox.loadstring.php                          14-Jun-2024 08:03                5664
luasandbox.pauseusagetimer.php                     14-Jun-2024 08:03                9467
luasandbox.registerlibrary.php                     14-Jun-2024 08:03                6680
luasandbox.requirements.php                        14-Jun-2024 08:03                1797
luasandbox.resources.php                           14-Jun-2024 08:03                1302
luasandbox.setcpulimit.php                         14-Jun-2024 08:03                6193
luasandbox.setmemorylimit.php                      14-Jun-2024 08:03                5598
luasandbox.setup.php                               14-Jun-2024 08:03                1692
luasandbox.unpauseusagetimer.php                   14-Jun-2024 08:03                3218
luasandbox.wrapphpfunction.php                     14-Jun-2024 08:03                4407                        14-Jun-2024 08:03                8072
luasandboxfunction.construct.php                   14-Jun-2024 08:03                2730
luasandboxfunction.dump.php                        14-Jun-2024 08:03                2494
lzf.configuration.php                              14-Jun-2024 08:03                1263
lzf.constants.php                                  14-Jun-2024 08:03                1195
lzf.installation.php                               14-Jun-2024 08:03                2832
lzf.requirements.php                               14-Jun-2024 08:03                1236
lzf.resources.php                                  14-Jun-2024 08:03                1249
lzf.setup.php                                      14-Jun-2024 08:03                1625
mail.configuration.php                             14-Jun-2024 08:03                8556
mail.constants.php                                 14-Jun-2024 08:03                1204
mail.installation.php                              14-Jun-2024 08:03                1298
mail.requirements.php                              14-Jun-2024 08:03                2040
mail.resources.php                                 14-Jun-2024 08:03                1256
mail.setup.php                                     14-Jun-2024 08:03                1640
mailparse.configuration.php                        14-Jun-2024 08:03                2657
mailparse.constants.php                            14-Jun-2024 08:03                2425
mailparse.installation.php                         14-Jun-2024 08:03                2782
mailparse.requirements.php                         14-Jun-2024 08:03                1278
mailparse.resources.php                            14-Jun-2024 08:03                1623
mailparse.setup.php                                14-Jun-2024 08:03                1702
manual.php                                         14-Jun-2024 08:03                1298
math.configuration.php                             14-Jun-2024 08:03                1270
math.constants.php                                 14-Jun-2024 08:03                7332
math.installation.php                              14-Jun-2024 08:03                1298
math.requirements.php                              14-Jun-2024 08:03                1243
math.resources.php                                 14-Jun-2024 08:03                1256
math.setup.php                                     14-Jun-2024 08:03                1630
mbstring.configuration.php                         14-Jun-2024 08:03               17036
mbstring.constants.php                             14-Jun-2024 08:03                7255
mbstring.encodings.php                             14-Jun-2024 08:03               16279
mbstring.http.php                                  14-Jun-2024 08:03                5341
mbstring.installation.php                          14-Jun-2024 08:03                3518
mbstring.ja-basic.php                              14-Jun-2024 08:03                4177
mbstring.overload.php                              14-Jun-2024 08:03                7574
mbstring.php4.req.php                              14-Jun-2024 08:03                4351
mbstring.requirements.php                          14-Jun-2024 08:03                1271
mbstring.resources.php                             14-Jun-2024 08:03                1284
mbstring.setup.php                                 14-Jun-2024 08:03                1736
mbstring.supported-encodings.php                   14-Jun-2024 08:03                8434
mcrypt.ciphers.php                                 14-Jun-2024 08:03                6669
mcrypt.configuration.php                           14-Jun-2024 08:03                3860
mcrypt.constants.php                               14-Jun-2024 08:03                6824
mcrypt.installation.php                            14-Jun-2024 08:03                1989
mcrypt.requirements.php                            14-Jun-2024 08:03                2754
mcrypt.resources.php                               14-Jun-2024 08:03                1382
mcrypt.setup.php                                   14-Jun-2024 08:03                1672
memcache.add.php                                   14-Jun-2024 08:03                7389
memcache.addserver.php                             14-Jun-2024 08:03               14824
memcache.close.php                                 14-Jun-2024 08:03                5369
memcache.connect.php                               14-Jun-2024 08:03                7976
memcache.constants.php                             14-Jun-2024 08:03                5125
memcache.decrement.php                             14-Jun-2024 08:03                7628
memcache.delete.php                                14-Jun-2024 08:03                6819
memcache.examples-overview.php                     14-Jun-2024 08:03                6642
memcache.examples.php                              14-Jun-2024 08:03                1457
memcache.flush.php                                 14-Jun-2024 08:03                4795
memcache.get.php                                   14-Jun-2024 08:03                9233
memcache.getextendedstats.php                      14-Jun-2024 08:03                8789
memcache.getserverstatus.php                       14-Jun-2024 08:03                6341
memcache.getstats.php                              14-Jun-2024 08:03                5373
memcache.getversion.php                            14-Jun-2024 08:03                5263
memcache.increment.php                             14-Jun-2024 08:03                7417
memcache.ini.php                                   14-Jun-2024 08:03               11258
memcache.installation.php                          14-Jun-2024 08:03                2370
memcache.pconnect.php                              14-Jun-2024 08:03                6516
memcache.replace.php                               14-Jun-2024 08:03                7769
memcache.requirements.php                          14-Jun-2024 08:03                1432
memcache.resources.php                             14-Jun-2024 08:03                1423
memcache.set.php                                   14-Jun-2024 08:03               10265
memcache.setcompressthreshold.php                  14-Jun-2024 08:03                6215
memcache.setserverparams.php                       14-Jun-2024 08:03               11691
memcache.setup.php                                 14-Jun-2024 08:03                1687
memcached.add.php                                  14-Jun-2024 08:03                4842
memcached.addbykey.php                             14-Jun-2024 08:03                5828
memcached.addserver.php                            14-Jun-2024 08:03                8011
memcached.addservers.php                           14-Jun-2024 08:03                5561
memcached.append.php                               14-Jun-2024 08:03                7623
memcached.appendbykey.php                          14-Jun-2024 08:03                5441
memcached.callbacks.php                            14-Jun-2024 08:03                1628               14-Jun-2024 08:03                4772
memcached.callbacks.result.php                     14-Jun-2024 08:03                5094
memcached.cas.php                                  14-Jun-2024 08:03                9793
memcached.casbykey.php                             14-Jun-2024 08:03                6121
memcached.configuration.php                        14-Jun-2024 08:03               28409
memcached.constants.php                            14-Jun-2024 08:03               31475
memcached.construct.php                            14-Jun-2024 08:03                5823
memcached.decrement.php                            14-Jun-2024 08:03                9507
memcached.decrementbykey.php                       14-Jun-2024 08:03                6436
memcached.delete.php                               14-Jun-2024 08:03                5818
memcached.deletebykey.php                          14-Jun-2024 08:03                5883
memcached.deletemulti.php                          14-Jun-2024 08:03                5052
memcached.deletemultibykey.php                     14-Jun-2024 08:03                6146
memcached.expiration.php                           14-Jun-2024 08:03                2131
memcached.fetch.php                                14-Jun-2024 08:03                6856
memcached.fetchall.php                             14-Jun-2024 08:03                6585
memcached.flush.php                                14-Jun-2024 08:03                4891
memcached.get.php                                  14-Jun-2024 08:03               10740
memcached.getallkeys.php                           14-Jun-2024 08:03                3253
memcached.getbykey.php                             14-Jun-2024 08:03                6880
memcached.getdelayed.php                           14-Jun-2024 08:03                9086
memcached.getdelayedbykey.php                      14-Jun-2024 08:03                6040
memcached.getmulti.php                             14-Jun-2024 08:03               21125
memcached.getmultibykey.php                        14-Jun-2024 08:03                5936
memcached.getoption.php                            14-Jun-2024 08:03                5245
memcached.getresultcode.php                        14-Jun-2024 08:03                4342
memcached.getresultmessage.php                     14-Jun-2024 08:03                4776
memcached.getserverbykey.php                       14-Jun-2024 08:03                7212
memcached.getserverlist.php                        14-Jun-2024 08:03                4700
memcached.getstats.php                             14-Jun-2024 08:03                5852
memcached.getversion.php                           14-Jun-2024 08:03                4092
memcached.increment.php                            14-Jun-2024 08:03                8849
memcached.incrementbykey.php                       14-Jun-2024 08:03                6361
memcached.installation.php                         14-Jun-2024 08:03                3017
memcached.ispersistent.php                         14-Jun-2024 08:03                3141
memcached.ispristine.php                           14-Jun-2024 08:03                3043
memcached.prepend.php                              14-Jun-2024 08:03                7626
memcached.prependbykey.php                         14-Jun-2024 08:03                5442
memcached.quit.php                                 14-Jun-2024 08:03                2546
memcached.replace.php                              14-Jun-2024 08:03                4937
memcached.replacebykey.php                         14-Jun-2024 08:03                6028
memcached.requirements.php                         14-Jun-2024 08:03                1651
memcached.resetserverlist.php                      14-Jun-2024 08:03                3241
memcached.resources.php                            14-Jun-2024 08:03                1291
memcached.sessions.php                             14-Jun-2024 08:03                2635
memcached.set.php                                  14-Jun-2024 08:03                9477
memcached.setbykey.php                             14-Jun-2024 08:03                7289
memcached.setmulti.php                             14-Jun-2024 08:03                6466
memcached.setmultibykey.php                        14-Jun-2024 08:03                5248
memcached.setoption.php                            14-Jun-2024 08:03                7667
memcached.setoptions.php                           14-Jun-2024 08:03                7115
memcached.setsaslauthdata.php                      14-Jun-2024 08:03                3773
memcached.setup.php                                14-Jun-2024 08:03                1702
memcached.touch.php                                14-Jun-2024 08:03                3962
memcached.touchbykey.php                           14-Jun-2024 08:03                4962
messageformatter.create.php                        14-Jun-2024 08:03               11358
messageformatter.format.php                        14-Jun-2024 08:03               10050
messageformatter.formatmessage.php                 14-Jun-2024 08:03               14706
messageformatter.geterrorcode.php                  14-Jun-2024 08:03                4222
messageformatter.geterrormessage.php               14-Jun-2024 08:03                7990
messageformatter.getlocale.php                     14-Jun-2024 08:03                5756
messageformatter.getpattern.php                    14-Jun-2024 08:03               10454
messageformatter.parse.php                         14-Jun-2024 08:03                9995
messageformatter.parsemessage.php                  14-Jun-2024 08:03               10223
messageformatter.setpattern.php                    14-Jun-2024 08:03               10929
mhash.configuration.php                            14-Jun-2024 08:03                1277
mhash.constants.php                                14-Jun-2024 08:03                7225
mhash.examples.php                                 14-Jun-2024 08:03                3366
mhash.installation.php                             14-Jun-2024 08:03                1787
mhash.requirements.php                             14-Jun-2024 08:03                1403
mhash.resources.php                                14-Jun-2024 08:03                1263
mhash.setup.php                                    14-Jun-2024 08:03                1651
migration56.changed-functions.php                  14-Jun-2024 08:03                7151
migration56.constants.php                          14-Jun-2024 08:03                6837
migration56.deprecated.php                         14-Jun-2024 08:03                6549
migration56.extensions.php                         14-Jun-2024 08:03                4639
migration56.incompatible.php                       14-Jun-2024 08:03                9368                       14-Jun-2024 08:03               30418                      14-Jun-2024 08:03                7611
migration56.openssl.php                            14-Jun-2024 08:03               28096
migration56.php                                    14-Jun-2024 08:03                2702
migration70.changed-functions.php                  14-Jun-2024 08:03                5731
migration70.classes.php                            14-Jun-2024 08:03                3971
migration70.constants.php                          14-Jun-2024 08:03                9559
migration70.deprecated.php                         14-Jun-2024 08:03                6078
migration70.incompatible.php                       14-Jun-2024 08:03               65911                       14-Jun-2024 08:03               43295                      14-Jun-2024 08:03                7431
migration70.other-changes.php                      14-Jun-2024 08:03                3762
migration70.php                                    14-Jun-2024 08:03                3073
migration70.removed-exts-sapis.php                 14-Jun-2024 08:03                3218
migration70.sapi-changes.php                       14-Jun-2024 08:03                2145
migration71.changed-functions.php                  14-Jun-2024 08:03                8014
migration71.constants.php                          14-Jun-2024 08:03                8862
migration71.deprecated.php                         14-Jun-2024 08:03                2444
migration71.incompatible.php                       14-Jun-2024 08:03               34778                       14-Jun-2024 08:03               28712                      14-Jun-2024 08:03                5135
migration71.other-changes.php                      14-Jun-2024 08:03                9511
migration71.php                                    14-Jun-2024 08:03                2707                    14-Jun-2024 08:03                7937
migration72.constants.php                          14-Jun-2024 08:03               32115
migration72.deprecated.php                         14-Jun-2024 08:03               11372
migration72.incompatible.php                       14-Jun-2024 08:03               20928                       14-Jun-2024 08:03               20001                      14-Jun-2024 08:03               24483
migration72.other-changes.php                      14-Jun-2024 08:03                6302
migration72.php                                    14-Jun-2024 08:03                2590
migration73.constants.php                          14-Jun-2024 08:03               26287
migration73.deprecated.php                         14-Jun-2024 08:03                9253
migration73.incompatible.php                       14-Jun-2024 08:03               20199                       14-Jun-2024 08:03               18099                      14-Jun-2024 08:03                7523
migration73.other-changes.php                      14-Jun-2024 08:03               17430
migration73.php                                    14-Jun-2024 08:03                2702                    14-Jun-2024 08:03                2026
migration74.constants.php                          14-Jun-2024 08:03                7862
migration74.deprecated.php                         14-Jun-2024 08:03               16626
migration74.incompatible.php                       14-Jun-2024 08:03               19955                        14-Jun-2024 08:03                1577                       14-Jun-2024 08:03               23370                      14-Jun-2024 08:03                3788
migration74.other-changes.php                      14-Jun-2024 08:03               22742
migration74.php                                    14-Jun-2024 08:03                2919
migration74.removed-extensions.php                 14-Jun-2024 08:03                2027                    14-Jun-2024 08:03                4068
migration80.deprecated.php                         14-Jun-2024 08:03               19366
migration80.incompatible.php                       14-Jun-2024 08:03              105253                       14-Jun-2024 08:03               32591
migration80.other-changes.php                      14-Jun-2024 08:03               15162
migration80.php                                    14-Jun-2024 08:03                2485
migration81.constants.php                          14-Jun-2024 08:03                8309
migration81.deprecated.php                         14-Jun-2024 08:03               19075
migration81.incompatible.php                       14-Jun-2024 08:03               23170                        14-Jun-2024 08:03                2177                       14-Jun-2024 08:03               23920                      14-Jun-2024 08:03                8517
migration81.other-changes.php                      14-Jun-2024 08:03                9872
migration81.php                                    14-Jun-2024 08:03                2647
migration82.constants.php                          14-Jun-2024 08:03               22282
migration82.deprecated.php                         14-Jun-2024 08:03                6274
migration82.incompatible.php                       14-Jun-2024 08:03               10329                       14-Jun-2024 08:03                7910                      14-Jun-2024 08:03                4376
migration82.other-changes.php                      14-Jun-2024 08:03               26630
migration82.php                                    14-Jun-2024 08:03                2837                    14-Jun-2024 08:03                2493
migration83.constants.php                          14-Jun-2024 08:03               15547
migration83.deprecated.php                         14-Jun-2024 08:03                7752
migration83.incompatible.php                       14-Jun-2024 08:03               14742                        14-Jun-2024 08:03                3429                       14-Jun-2024 08:03                7289                      14-Jun-2024 08:03                7347
migration83.other-changes.php                      14-Jun-2024 08:03               32041
migration83.php                                    14-Jun-2024 08:03                2802                    14-Jun-2024 08:03                1427
misc.configuration.php                             14-Jun-2024 08:03                6293
misc.constants.php                                 14-Jun-2024 08:03                2643
misc.installation.php                              14-Jun-2024 08:03                1298
misc.requirements.php                              14-Jun-2024 08:03                1243
misc.resources.php                                 14-Jun-2024 08:03                1256
misc.setup.php                                     14-Jun-2024 08:03                1623
mongodb-bson-binary.construct.php                  14-Jun-2024 08:03                8165
mongodb-bson-binary.getdata.php                    14-Jun-2024 08:03                4462
mongodb-bson-binary.gettype.php                    14-Jun-2024 08:03                4434
mongodb-bson-binary.jsonserialize.php              14-Jun-2024 08:03                5510
mongodb-bson-binary.serialize.php                  14-Jun-2024 08:03                3565
mongodb-bson-binary.tostring.php                   14-Jun-2024 08:03                4280
mongodb-bson-binary.unserialize.php                14-Jun-2024 08:03                4464
mongodb-bson-binaryinterface.getdata.php           14-Jun-2024 08:03                2907
mongodb-bson-binaryinterface.gettype.php           14-Jun-2024 08:03                2896
mongodb-bson-binaryinterface.tostring.php          14-Jun-2024 08:03                3386
mongodb-bson-dbpointer.construct.php               14-Jun-2024 08:03                2748
mongodb-bson-dbpointer.jsonserialize.php           14-Jun-2024 08:03                5579
mongodb-bson-dbpointer.serialize.php               14-Jun-2024 08:03                3647
mongodb-bson-dbpointer.tostring.php                14-Jun-2024 08:03                2739
mongodb-bson-dbpointer.unserialize.php             14-Jun-2024 08:03                3902
mongodb-bson-decimal128.construct.php              14-Jun-2024 08:03                5832
mongodb-bson-decimal128.jsonserialize.php          14-Jun-2024 08:03                5600
mongodb-bson-decimal128.serialize.php              14-Jun-2024 08:03                3672
mongodb-bson-decimal128.tostring.php               14-Jun-2024 08:03                4670
mongodb-bson-decimal128.unserialize.php            14-Jun-2024 08:03                4557
mongodb-bson-decimal128interface.tostring.php      14-Jun-2024 08:03                3134
mongodb-bson-document.construct.php                14-Jun-2024 08:03                3330
mongodb-bson-document.frombson.php                 14-Jun-2024 08:03                4074
mongodb-bson-document.fromjson.php                 14-Jun-2024 08:03                4596
mongodb-bson-document.fromphp.php                  14-Jun-2024 08:03                4318
mongodb-bson-document.get.php                      14-Jun-2024 08:03                4281
mongodb-bson-document.getiterator.php              14-Jun-2024 08:03                3555
mongodb-bson-document.has.php                      14-Jun-2024 08:03                3813
mongodb-bson-document.offsetexists.php             14-Jun-2024 08:03                3569
mongodb-bson-document.offsetget.php                14-Jun-2024 08:03                4362
mongodb-bson-document.offsetset.php                14-Jun-2024 08:03                3645
mongodb-bson-document.offsetunset.php              14-Jun-2024 08:03                3254
mongodb-bson-document.serialize.php                14-Jun-2024 08:03                3620
mongodb-bson-document.tocanonicalextendedjson.php  14-Jun-2024 08:03               12781
mongodb-bson-document.tophp.php                    14-Jun-2024 08:03                5664
mongodb-bson-document.torelaxedextendedjson.php    14-Jun-2024 08:03               12498
mongodb-bson-document.tostring.php                 14-Jun-2024 08:03                2809
mongodb-bson-document.unserialize.php              14-Jun-2024 08:03                4430
mongodb-bson-int64.construct.php                   14-Jun-2024 08:03                4913
mongodb-bson-int64.jsonserialize.php               14-Jun-2024 08:03                5275
mongodb-bson-int64.serialize.php                   14-Jun-2024 08:03                3547
mongodb-bson-int64.tostring.php                    14-Jun-2024 08:03                3982
mongodb-bson-int64.unserialize.php                 14-Jun-2024 08:03                4434
mongodb-bson-iterator.construct.php                14-Jun-2024 08:03                3418
mongodb-bson-iterator.current.php                  14-Jun-2024 08:03                3662
mongodb-bson-iterator.key.php                      14-Jun-2024 08:03                3665                     14-Jun-2024 08:03                2474
mongodb-bson-iterator.rewind.php                   14-Jun-2024 08:03                2512
mongodb-bson-iterator.valid.php                    14-Jun-2024 08:03                2886
mongodb-bson-javascript.construct.php              14-Jun-2024 08:03                7314
mongodb-bson-javascript.getcode.php                14-Jun-2024 08:03                4418
mongodb-bson-javascript.getscope.php               14-Jun-2024 08:03                5424
mongodb-bson-javascript.jsonserialize.php          14-Jun-2024 08:03                5596
mongodb-bson-javascript.serialize.php              14-Jun-2024 08:03                3672
mongodb-bson-javascript.tostring.php               14-Jun-2024 08:03                4244
mongodb-bson-javascript.unserialize.php            14-Jun-2024 08:03                4549
mongodb-bson-javascriptinterface.getcode.php       14-Jun-2024 08:03                2977
mongodb-bson-javascriptinterface.getscope.php      14-Jun-2024 08:03                3166
mongodb-bson-javascriptinterface.tostring.php      14-Jun-2024 08:03                3449
mongodb-bson-maxkey.construct.php                  14-Jun-2024 08:03                3690
mongodb-bson-maxkey.jsonserialize.php              14-Jun-2024 08:03                5516
mongodb-bson-maxkey.serialize.php                  14-Jun-2024 08:03                3576
mongodb-bson-maxkey.unserialize.php                14-Jun-2024 08:03                3835
mongodb-bson-minkey.construct.php                  14-Jun-2024 08:03                3690
mongodb-bson-minkey.jsonserialize.php              14-Jun-2024 08:03                5516
mongodb-bson-minkey.serialize.php                  14-Jun-2024 08:03                3576
mongodb-bson-minkey.unserialize.php                14-Jun-2024 08:03                3839
mongodb-bson-objectid.construct.php                14-Jun-2024 08:03                5379
mongodb-bson-objectid.gettimestamp.php             14-Jun-2024 08:03                5634
mongodb-bson-objectid.jsonserialize.php            14-Jun-2024 08:03                5562
mongodb-bson-objectid.serialize.php                14-Jun-2024 08:03                3622
mongodb-bson-objectid.tostring.php                 14-Jun-2024 08:03                4272
mongodb-bson-objectid.unserialize.php              14-Jun-2024 08:03                4501
mongodb-bson-objectidinterface.gettimestamp.php    14-Jun-2024 08:03                3060
mongodb-bson-objectidinterface.tostring.php        14-Jun-2024 08:03                3050
mongodb-bson-packedarray.construct.php             14-Jun-2024 08:03                2950
mongodb-bson-packedarray.fromphp.php               14-Jun-2024 08:03                3999
mongodb-bson-packedarray.get.php                   14-Jun-2024 08:03                4329
mongodb-bson-packedarray.getiterator.php           14-Jun-2024 08:03                3609
mongodb-bson-packedarray.has.php                   14-Jun-2024 08:03                3867
mongodb-bson-packedarray.offsetexists.php          14-Jun-2024 08:03                3625
mongodb-bson-packedarray.offsetget.php             14-Jun-2024 08:03                4528
mongodb-bson-packedarray.offsetset.php             14-Jun-2024 08:03                3699
mongodb-bson-packedarray.offsetunset.php           14-Jun-2024 08:03                3308
mongodb-bson-packedarray.serialize.php             14-Jun-2024 08:03                3652
mongodb-bson-packedarray.tophp.php                 14-Jun-2024 08:03                4690
mongodb-bson-packedarray.tostring.php              14-Jun-2024 08:03                2825
mongodb-bson-packedarray.unserialize.php           14-Jun-2024 08:03                4486
mongodb-bson-persistable.bsonserialize.php         14-Jun-2024 08:03                6274
mongodb-bson-regex.construct.php                   14-Jun-2024 08:03                7136
mongodb-bson-regex.getflags.php                    14-Jun-2024 08:03                4574
mongodb-bson-regex.getpattern.php                  14-Jun-2024 08:03                4399
mongodb-bson-regex.jsonserialize.php               14-Jun-2024 08:03                5495
mongodb-bson-regex.serialize.php                   14-Jun-2024 08:03                3547
mongodb-bson-regex.tostring.php                    14-Jun-2024 08:03                3969
mongodb-bson-regex.unserialize.php                 14-Jun-2024 08:03                4440
mongodb-bson-regexinterface.getflags.php           14-Jun-2024 08:03                2899
mongodb-bson-regexinterface.getpattern.php         14-Jun-2024 08:03                2925
mongodb-bson-regexinterface.tostring.php           14-Jun-2024 08:03                3091
mongodb-bson-serializable.bsonserialize.php        14-Jun-2024 08:03               17156
mongodb-bson-symbol.construct.php                  14-Jun-2024 08:03                2688
mongodb-bson-symbol.jsonserialize.php              14-Jun-2024 08:03                5516
mongodb-bson-symbol.serialize.php                  14-Jun-2024 08:03                3572
mongodb-bson-symbol.tostring.php                   14-Jun-2024 08:03                2781
mongodb-bson-symbol.unserialize.php                14-Jun-2024 08:03                3841
mongodb-bson-timestamp.construct.php               14-Jun-2024 08:03                4914
mongodb-bson-timestamp.getincrement.php            14-Jun-2024 08:03                4523
mongodb-bson-timestamp.gettimestamp.php            14-Jun-2024 08:03                4476
mongodb-bson-timestamp.jsonserialize.php           14-Jun-2024 08:03                5583
mongodb-bson-timestamp.serialize.php               14-Jun-2024 08:03                3647
mongodb-bson-timestamp.tostring.php                14-Jun-2024 08:03                4072
mongodb-bson-timestamp.unserialize.php             14-Jun-2024 08:03                4536
mongodb-bson-timestampinterface.getincrement.php   14-Jun-2024 08:03                3512
mongodb-bson-timestampinterface.gettimestamp.php   14-Jun-2024 08:03                3495
mongodb-bson-timestampinterface.tostring.php       14-Jun-2024 08:03                3135
mongodb-bson-undefined.construct.php               14-Jun-2024 08:03                2748
mongodb-bson-undefined.jsonserialize.php           14-Jun-2024 08:03                5579
mongodb-bson-undefined.serialize.php               14-Jun-2024 08:03                3647
mongodb-bson-undefined.tostring.php                14-Jun-2024 08:03                2739
mongodb-bson-undefined.unserialize.php             14-Jun-2024 08:03                3903
mongodb-bson-unserializable.bsonunserialize.php    14-Jun-2024 08:03                7284
mongodb-bson-utcdatetime.construct.php             14-Jun-2024 08:03                8235
mongodb-bson-utcdatetime.jsonserialize.php         14-Jun-2024 08:03                5621
mongodb-bson-utcdatetime.serialize.php             14-Jun-2024 08:03                3699
mongodb-bson-utcdatetime.todatetime.php            14-Jun-2024 08:03                5886
mongodb-bson-utcdatetime.tostring.php              14-Jun-2024 08:03                4091
mongodb-bson-utcdatetime.unserialize.php           14-Jun-2024 08:03                4568
mongodb-bson-utcdatetimeinterface.todatetime.php   14-Jun-2024 08:03                3338
mongodb-bson-utcdatetimeinterface.tostring.php     14-Jun-2024 08:03                3149
mongodb-driver-bulkwrite.construct.php             14-Jun-2024 08:03               18722
mongodb-driver-bulkwrite.count.php                 14-Jun-2024 08:03                6974
mongodb-driver-bulkwrite.delete.php                14-Jun-2024 08:03               12292
mongodb-driver-bulkwrite.insert.php                14-Jun-2024 08:03                9641
mongodb-driver-bulkwrite.update.php                14-Jun-2024 08:03               15902
mongodb-driver-clientencryption.addkeyaltname.php  14-Jun-2024 08:03                5336
mongodb-driver-clientencryption.construct.php      14-Jun-2024 08:03               11335
mongodb-driver-clientencryption.createdatakey.php  14-Jun-2024 08:03               10927
mongodb-driver-clientencryption.decrypt.php        14-Jun-2024 08:03                4226
mongodb-driver-clientencryption.deletekey.php      14-Jun-2024 08:03                4080
mongodb-driver-clientencryption.encrypt.php        14-Jun-2024 08:03               14463
mongodb-driver-clientencryption.encryptexpressi..> 14-Jun-2024 08:03               16172
mongodb-driver-clientencryption.getkey.php         14-Jun-2024 08:03                4213
mongodb-driver-clientencryption.getkeybyaltname..> 14-Jun-2024 08:03                4806
mongodb-driver-clientencryption.getkeys.php        14-Jun-2024 08:03                3652
mongodb-driver-clientencryption.removekeyaltnam..> 14-Jun-2024 08:03                5401
mongodb-driver-clientencryption.rewrapmanydatak..> 14-Jun-2024 08:03               12220
mongodb-driver-command.construct.php               14-Jun-2024 08:03               14552
mongodb-driver-commandexception.getresultdocume..> 14-Jun-2024 08:03                3328
mongodb-driver-cursor.construct.php                14-Jun-2024 08:03                3514
mongodb-driver-cursor.current.php                  14-Jun-2024 08:03                3168
mongodb-driver-cursor.getid.php                    14-Jun-2024 08:03                7747
mongodb-driver-cursor.getserver.php                14-Jun-2024 08:03                7540
mongodb-driver-cursor.isdead.php                   14-Jun-2024 08:03               10928
mongodb-driver-cursor.key.php                      14-Jun-2024 08:03                2729                     14-Jun-2024 08:03                3315
mongodb-driver-cursor.rewind.php                   14-Jun-2024 08:03                3769
mongodb-driver-cursor.settypemap.php               14-Jun-2024 08:03                8148
mongodb-driver-cursor.toarray.php                  14-Jun-2024 08:03                7803
mongodb-driver-cursor.valid.php                    14-Jun-2024 08:03                2911
mongodb-driver-cursorid.construct.php              14-Jun-2024 08:03                2902
mongodb-driver-cursorid.serialize.php              14-Jun-2024 08:03                3638
mongodb-driver-cursorid.tostring.php               14-Jun-2024 08:03                7134
mongodb-driver-cursorid.unserialize.php            14-Jun-2024 08:03                4492
mongodb-driver-cursorinterface.getid.php           14-Jun-2024 08:03                4075
mongodb-driver-cursorinterface.getserver.php       14-Jun-2024 08:03                4158
mongodb-driver-cursorinterface.isdead.php          14-Jun-2024 08:03                4160
mongodb-driver-cursorinterface.settypemap.php      14-Jun-2024 08:03                4184
mongodb-driver-cursorinterface.toarray.php         14-Jun-2024 08:03                4028
mongodb-driver-manager.addsubscriber.php           14-Jun-2024 08:03                5595
mongodb-driver-manager.construct.php               14-Jun-2024 08:03               80227
mongodb-driver-manager.createclientencryption.php  14-Jun-2024 08:03               12699
mongodb-driver-manager.executebulkwrite.php        14-Jun-2024 08:03               22883
mongodb-driver-manager.executecommand.php          14-Jun-2024 08:03               24603
mongodb-driver-manager.executequery.php            14-Jun-2024 08:03               16214
mongodb-driver-manager.executereadcommand.php      14-Jun-2024 08:03                9779
mongodb-driver-manager.executereadwritecommand.php 14-Jun-2024 08:03               10880
mongodb-driver-manager.executewritecommand.php     14-Jun-2024 08:03               11002
mongodb-driver-manager.getencryptedfieldsmap.php   14-Jun-2024 08:03                3947
mongodb-driver-manager.getreadconcern.php          14-Jun-2024 08:03                5945
mongodb-driver-manager.getreadpreference.php       14-Jun-2024 08:03                6540
mongodb-driver-manager.getservers.php              14-Jun-2024 08:03                7967
mongodb-driver-manager.getwriteconcern.php         14-Jun-2024 08:03                5998
mongodb-driver-manager.removesubscriber.php        14-Jun-2024 08:03                4988
mongodb-driver-manager.selectserver.php            14-Jun-2024 08:03                6992
mongodb-driver-manager.startsession.php            14-Jun-2024 08:03               12393> 14-Jun-2024 08:03                3747> 14-Jun-2024 08:03                3674> 14-Jun-2024 08:03                3846> 14-Jun-2024 08:03                3675> 14-Jun-2024 08:03                4876> 14-Jun-2024 08:03                4066> 14-Jun-2024 08:03                4305> 14-Jun-2024 08:03                4228> 14-Jun-2024 08:03                4071> 14-Jun-2024 08:03                3855
mongodb-driver-monitoring-commandstartedevent.g..> 14-Jun-2024 08:03                4073
mongodb-driver-monitoring-commandstartedevent.g..> 14-Jun-2024 08:03                3783
mongodb-driver-monitoring-commandstartedevent.g..> 14-Jun-2024 08:03                3685
mongodb-driver-monitoring-commandstartedevent.g..> 14-Jun-2024 08:03                5185
mongodb-driver-monitoring-commandstartedevent.g..> 14-Jun-2024 08:03                4766
mongodb-driver-monitoring-commandstartedevent.g..> 14-Jun-2024 08:03                4519
mongodb-driver-monitoring-commandstartedevent.g..> 14-Jun-2024 08:03                4091
mongodb-driver-monitoring-commandstartedevent.g..> 14-Jun-2024 08:03                3875> 14-Jun-2024 08:03                4944> 14-Jun-2024 08:03                5012> 14-Jun-2024 08:03                5010
mongodb-driver-monitoring-commandsucceededevent..> 14-Jun-2024 08:03                3804
mongodb-driver-monitoring-commandsucceededevent..> 14-Jun-2024 08:03                3731
mongodb-driver-monitoring-commandsucceededevent..> 14-Jun-2024 08:03                3915
mongodb-driver-monitoring-commandsucceededevent..> 14-Jun-2024 08:03                4963
mongodb-driver-monitoring-commandsucceededevent..> 14-Jun-2024 08:03                4123
mongodb-driver-monitoring-commandsucceededevent..> 14-Jun-2024 08:03                4368
mongodb-driver-monitoring-commandsucceededevent..> 14-Jun-2024 08:03                4769
mongodb-driver-monitoring-commandsucceededevent..> 14-Jun-2024 08:03                4131
mongodb-driver-monitoring-commandsucceededevent..> 14-Jun-2024 08:03                3901
mongodb-driver-monitoring-logsubscriber.log.php    14-Jun-2024 08:03                4682
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Jun-2024 08:03                4831
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Jun-2024 08:03                4805
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Jun-2024 08:03                5367
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Jun-2024 08:03                5430
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Jun-2024 08:03                5440
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Jun-2024 08:03                4835
mongodb-driver-monitoring-sdamsubscriber.topolo..> 14-Jun-2024 08:03                4906
mongodb-driver-monitoring-sdamsubscriber.topolo..> 14-Jun-2024 08:03                4847
mongodb-driver-monitoring-sdamsubscriber.topolo..> 14-Jun-2024 08:03                4830> 14-Jun-2024 08:03                3220> 14-Jun-2024 08:03                3536> 14-Jun-2024 08:03                3288> 14-Jun-2024 08:03                3613> 14-Jun-2024 08:03                3336
mongodb-driver-monitoring-serverclosedevent.get..> 14-Jun-2024 08:03                3182
mongodb-driver-monitoring-serverclosedevent.get..> 14-Jun-2024 08:03                3232
mongodb-driver-monitoring-serverclosedevent.get..> 14-Jun-2024 08:03                3292
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Jun-2024 08:03                3668
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Jun-2024 08:03                3520
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Jun-2024 08:03                3357
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Jun-2024 08:03                3386
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Jun-2024 08:03                3741
mongodb-driver-monitoring-serverheartbeatstarte..> 14-Jun-2024 08:03                3362
mongodb-driver-monitoring-serverheartbeatstarte..> 14-Jun-2024 08:03                3404
mongodb-driver-monitoring-serverheartbeatstarte..> 14-Jun-2024 08:03                3761
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Jun-2024 08:03                3720
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Jun-2024 08:03                3429
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Jun-2024 08:03                3438
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Jun-2024 08:03                4260
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Jun-2024 08:03                3777> 14-Jun-2024 08:03                3200> 14-Jun-2024 08:03                3250> 14-Jun-2024 08:03                3324
mongodb-driver-monitoring-topologychangedevent...> 14-Jun-2024 08:03                3605
mongodb-driver-monitoring-topologychangedevent...> 14-Jun-2024 08:03                3683
mongodb-driver-monitoring-topologychangedevent...> 14-Jun-2024 08:03                3344
mongodb-driver-monitoring-topologyclosedevent.g..> 14-Jun-2024 08:03                3289
mongodb-driver-monitoring-topologyopeningevent...> 14-Jun-2024 08:03                3299
mongodb-driver-query.construct.php                 14-Jun-2024 08:03               33134
mongodb-driver-readconcern.bsonserialize.php       14-Jun-2024 08:03                6855
mongodb-driver-readconcern.construct.php           14-Jun-2024 08:03                5746
mongodb-driver-readconcern.getlevel.php            14-Jun-2024 08:03                5832
mongodb-driver-readconcern.isdefault.php           14-Jun-2024 08:03                8106
mongodb-driver-readconcern.serialize.php           14-Jun-2024 08:03                3715
mongodb-driver-readconcern.unserialize.php         14-Jun-2024 08:03                4543
mongodb-driver-readpreference.bsonserialize.php    14-Jun-2024 08:03               10499
mongodb-driver-readpreference.construct.php        14-Jun-2024 08:03               19677
mongodb-driver-readpreference.gethedge.php         14-Jun-2024 08:03                3459
mongodb-driver-readpreference.getmaxstalenessse..> 14-Jun-2024 08:03                8204
mongodb-driver-readpreference.getmode.php          14-Jun-2024 08:03                7528
mongodb-driver-readpreference.getmodestring.php    14-Jun-2024 08:03                7734
mongodb-driver-readpreference.gettagsets.php       14-Jun-2024 08:03                8089
mongodb-driver-readpreference.serialize.php        14-Jun-2024 08:03                3792
mongodb-driver-readpreference.unserialize.php      14-Jun-2024 08:03                4622
mongodb-driver-runtimeexception.haserrorlabel.php  14-Jun-2024 08:03                4420
mongodb-driver-server.construct.php                14-Jun-2024 08:03                3478
mongodb-driver-server.executebulkwrite.php         14-Jun-2024 08:03               11384
mongodb-driver-server.executecommand.php           14-Jun-2024 08:03               13319
mongodb-driver-server.executequery.php             14-Jun-2024 08:03                8778
mongodb-driver-server.executereadcommand.php       14-Jun-2024 08:03               10484
mongodb-driver-server.executereadwritecommand.php  14-Jun-2024 08:03               11501
mongodb-driver-server.executewritecommand.php      14-Jun-2024 08:03               11589
mongodb-driver-server.gethost.php                  14-Jun-2024 08:03                5520
mongodb-driver-server.getinfo.php                  14-Jun-2024 08:03               10808
mongodb-driver-server.getlatency.php               14-Jun-2024 08:03                7297
mongodb-driver-server.getport.php                  14-Jun-2024 08:03                5538
mongodb-driver-server.getserverdescription.php     14-Jun-2024 08:03                3460
mongodb-driver-server.gettags.php                  14-Jun-2024 08:03                3828
mongodb-driver-server.gettype.php                  14-Jun-2024 08:03                3813
mongodb-driver-server.isarbiter.php                14-Jun-2024 08:03                3681
mongodb-driver-server.ishidden.php                 14-Jun-2024 08:03                3675
mongodb-driver-server.ispassive.php                14-Jun-2024 08:03                3772
mongodb-driver-server.isprimary.php                14-Jun-2024 08:03                3688
mongodb-driver-server.issecondary.php              14-Jun-2024 08:03                3723
mongodb-driver-serverapi.bsonserialize.php         14-Jun-2024 08:03                3369
mongodb-driver-serverapi.construct.php             14-Jun-2024 08:03                5258
mongodb-driver-serverapi.serialize.php             14-Jun-2024 08:03                3668
mongodb-driver-serverapi.unserialize.php           14-Jun-2024 08:03                4510
mongodb-driver-serverdescription.gethellorespon..> 14-Jun-2024 08:03                5239
mongodb-driver-serverdescription.gethost.php       14-Jun-2024 08:03                3486
mongodb-driver-serverdescription.getlastupdatet..> 14-Jun-2024 08:03                3635
mongodb-driver-serverdescription.getport.php       14-Jun-2024 08:03                3539
mongodb-driver-serverdescription.getroundtripti..> 14-Jun-2024 08:03                3936
mongodb-driver-serverdescription.gettype.php       14-Jun-2024 08:03                3878
mongodb-driver-session.aborttransaction.php        14-Jun-2024 08:03                4249
mongodb-driver-session.advanceclustertime.php      14-Jun-2024 08:03                4918
mongodb-driver-session.advanceoperationtime.php    14-Jun-2024 08:03                4858
mongodb-driver-session.committransaction.php       14-Jun-2024 08:03                5613
mongodb-driver-session.construct.php               14-Jun-2024 08:03                2945
mongodb-driver-session.endsession.php              14-Jun-2024 08:03                4381
mongodb-driver-session.getclustertime.php          14-Jun-2024 08:03                4010
mongodb-driver-session.getlogicalsessionid.php     14-Jun-2024 08:03                3170
mongodb-driver-session.getoperationtime.php        14-Jun-2024 08:03                4090
mongodb-driver-session.getserver.php               14-Jun-2024 08:03                3985
mongodb-driver-session.gettransactionoptions.php   14-Jun-2024 08:03                3865
mongodb-driver-session.gettransactionstate.php     14-Jun-2024 08:03                3769
mongodb-driver-session.isdirty.php                 14-Jun-2024 08:03                3055
mongodb-driver-session.isintransaction.php         14-Jun-2024 08:03                3831
mongodb-driver-session.starttransaction.php        14-Jun-2024 08:03                8887
mongodb-driver-topologydescription.getservers.php  14-Jun-2024 08:03                3497
mongodb-driver-topologydescription.gettype.php     14-Jun-2024 08:03                3545
mongodb-driver-topologydescription.hasreadables..> 14-Jun-2024 08:03                3984
mongodb-driver-topologydescription.haswritables..> 14-Jun-2024 08:03                3265
mongodb-driver-writeconcern.bsonserialize.php      14-Jun-2024 08:03                7300
mongodb-driver-writeconcern.construct.php          14-Jun-2024 08:03               11086
mongodb-driver-writeconcern.getjournal.php         14-Jun-2024 08:03                6018
mongodb-driver-writeconcern.getw.php               14-Jun-2024 08:03                5308
mongodb-driver-writeconcern.getwtimeout.php        14-Jun-2024 08:03                5930
mongodb-driver-writeconcern.isdefault.php          14-Jun-2024 08:03                7893
mongodb-driver-writeconcern.serialize.php          14-Jun-2024 08:03                3740
mongodb-driver-writeconcern.unserialize.php        14-Jun-2024 08:03                4582
mongodb-driver-writeconcernerror.getcode.php       14-Jun-2024 08:03                6369
mongodb-driver-writeconcernerror.getinfo.php       14-Jun-2024 08:03                6720
mongodb-driver-writeconcernerror.getmessage.php    14-Jun-2024 08:03                6458
mongodb-driver-writeerror.getcode.php              14-Jun-2024 08:03                5712
mongodb-driver-writeerror.getindex.php             14-Jun-2024 08:03                6237
mongodb-driver-writeerror.getinfo.php              14-Jun-2024 08:03                3206
mongodb-driver-writeerror.getmessage.php           14-Jun-2024 08:03                5847
mongodb-driver-writeexception.getwriteresult.php   14-Jun-2024 08:03                8087
mongodb-driver-writeresult.getdeletedcount.php     14-Jun-2024 08:03                8245
mongodb-driver-writeresult.getinsertedcount.php    14-Jun-2024 08:03                8360
mongodb-driver-writeresult.getmatchedcount.php     14-Jun-2024 08:03                8989
mongodb-driver-writeresult.getmodifiedcount.php    14-Jun-2024 08:03                9305
mongodb-driver-writeresult.getserver.php           14-Jun-2024 08:03                6609
mongodb-driver-writeresult.getupsertedcount.php    14-Jun-2024 08:03                8410
mongodb-driver-writeresult.getupsertedids.php      14-Jun-2024 08:03                8905
mongodb-driver-writeresult.getwriteconcernerror..> 14-Jun-2024 08:03                7249
mongodb-driver-writeresult.getwriteerrors.php      14-Jun-2024 08:03               13185
mongodb-driver-writeresult.isacknowledged.php      14-Jun-2024 08:03                8306
mongodb.architecture.php                           14-Jun-2024 08:03                1982
mongodb.configuration.php                          14-Jun-2024 08:03                4095
mongodb.connection-handling.php                    14-Jun-2024 08:03                8795
mongodb.constants.php                              14-Jun-2024 08:03                2216
mongodb.exceptions.php                             14-Jun-2024 08:03                5268
mongodb.exceptions.tree.php                        14-Jun-2024 08:03                5633
mongodb.installation.homebrew.php                  14-Jun-2024 08:03                2047
mongodb.installation.manual.php                    14-Jun-2024 08:03                6197
mongodb.installation.pecl.php                      14-Jun-2024 08:03                5152
mongodb.installation.php                           14-Jun-2024 08:03                1854                   14-Jun-2024 08:03                4434
mongodb.monitoring.php                             14-Jun-2024 08:03               19485
mongodb.overview.php                               14-Jun-2024 08:03                4679
mongodb.persistence.deserialization.php            14-Jun-2024 08:03               22025
mongodb.persistence.php                            14-Jun-2024 08:03                1830
mongodb.persistence.serialization.php              14-Jun-2024 08:03               20134