Index of /php/manual/zh/


../
feeds/                                             17-Jul-2024 20:07                   -
images/                                            17-Jul-2024 20:07                   -
styles/                                            17-Jul-2024 20:07                   -
toc/                                               17-Jul-2024 20:07                   -
about.formats.php                                  17-Jul-2024 20:07                4244
about.generate.php                                 17-Jul-2024 20:07                2723
about.howtohelp.php                                17-Jul-2024 20:07                2962
about.more.php                                     17-Jul-2024 20:07                1782
about.notes.php                                    17-Jul-2024 20:07                2237
about.php                                          17-Jul-2024 20:07                1880
about.phpversions.php                              17-Jul-2024 20:07                3029
about.prototypes.php                               17-Jul-2024 20:07                7303
about.translations.php                             17-Jul-2024 20:07                2976
aliases.php                                        17-Jul-2024 20:07               29512
allowdynamicproperties.construct.php               17-Jul-2024 20:07                2225
apache.configuration.php                           17-Jul-2024 20:07                4977
apache.installation.php                            17-Jul-2024 20:07                1226
apache.resources.php                               17-Jul-2024 20:07                1178
apache.setup.php                                   17-Jul-2024 20:07                1510
apcu.configuration.php                             17-Jul-2024 20:07               15608
apcu.constants.php                                 17-Jul-2024 20:07                7343
apcu.installation.php                              17-Jul-2024 20:07                3165
apcu.resources.php                                 17-Jul-2024 20:07                1172
apcu.setup.php                                     17-Jul-2024 20:07                1470
apcuiterator.construct.php                         17-Jul-2024 20:07                7099
apcuiterator.current.php                           17-Jul-2024 20:07                2967
apcuiterator.gettotalcount.php                     17-Jul-2024 20:07                3104
apcuiterator.gettotalhits.php                      17-Jul-2024 20:07                3240
apcuiterator.gettotalsize.php                      17-Jul-2024 20:07                2996
apcuiterator.key.php                               17-Jul-2024 20:07                2761
apcuiterator.next.php                              17-Jul-2024 20:07                3039
apcuiterator.rewind.php                            17-Jul-2024 20:07                2688
apcuiterator.valid.php                             17-Jul-2024 20:07                2907
appendices.php                                     17-Jul-2024 20:07               11795
appenditerator.append.php                          17-Jul-2024 20:07                5445
appenditerator.construct.php                       17-Jul-2024 20:07               10129
appenditerator.current.php                         17-Jul-2024 20:07                3428
appenditerator.getarrayiterator.php                17-Jul-2024 20:07                3062
appenditerator.getiteratorindex.php                17-Jul-2024 20:07                6625
appenditerator.key.php                             17-Jul-2024 20:07                7853
appenditerator.next.php                            17-Jul-2024 20:07                3327
appenditerator.rewind.php                          17-Jul-2024 20:07                3317
appenditerator.valid.php                           17-Jul-2024 20:07                3323
array.constants.php                                17-Jul-2024 20:07               11459
array.resources.php                                17-Jul-2024 20:07                1169
array.setup.php                                    17-Jul-2024 20:07                1361
array.sorting.php                                  17-Jul-2024 20:07                6833
arrayaccess.offsetexists.php                       17-Jul-2024 20:07                9089
arrayaccess.offsetget.php                          17-Jul-2024 20:07                4680
arrayaccess.offsetset.php                          17-Jul-2024 20:07                5075
arrayaccess.offsetunset.php                        17-Jul-2024 20:07                2838
arrayiterator.append.php                           17-Jul-2024 20:07                3474
arrayiterator.asort.php                            17-Jul-2024 20:07                7038
arrayiterator.construct.php                        17-Jul-2024 20:07                3742
arrayiterator.count.php                            17-Jul-2024 20:07                3184
arrayiterator.current.php                          17-Jul-2024 20:07                5177
arrayiterator.getarraycopy.php                     17-Jul-2024 20:07                3031
arrayiterator.getflags.php                         17-Jul-2024 20:07                3058
arrayiterator.key.php                              17-Jul-2024 20:07                3998
arrayiterator.ksort.php                            17-Jul-2024 20:07                7017
arrayiterator.natcasesort.php                      17-Jul-2024 20:07                4669
arrayiterator.natsort.php                          17-Jul-2024 20:07                4577
arrayiterator.next.php                             17-Jul-2024 20:07                4604
arrayiterator.offsetexists.php                     17-Jul-2024 20:07                3285
arrayiterator.offsetget.php                        17-Jul-2024 20:07                3313
arrayiterator.offsetset.php                        17-Jul-2024 20:07                3573
arrayiterator.offsetunset.php                      17-Jul-2024 20:07                3747
arrayiterator.rewind.php                           17-Jul-2024 20:07                4603
arrayiterator.seek.php                             17-Jul-2024 20:07                2572
arrayiterator.serialize.php                        17-Jul-2024 20:07                2826
arrayiterator.setflags.php                         17-Jul-2024 20:07                4112
arrayiterator.uasort.php                           17-Jul-2024 20:07                6229
arrayiterator.uksort.php                           17-Jul-2024 20:07                6148
arrayiterator.unserialize.php                      17-Jul-2024 20:07                3076
arrayiterator.valid.php                            17-Jul-2024 20:07                4678
arrayobject.append.php                             17-Jul-2024 20:07                5438
arrayobject.asort.php                              17-Jul-2024 20:07                9926
arrayobject.construct.php                          17-Jul-2024 20:07                6254
arrayobject.count.php                              17-Jul-2024 20:07                5351
arrayobject.exchangearray.php                      17-Jul-2024 20:07                6487
arrayobject.getarraycopy.php                       17-Jul-2024 20:07                5267
arrayobject.getflags.php                           17-Jul-2024 20:07                6088
arrayobject.getiterator.php                        17-Jul-2024 20:07                5261
arrayobject.getiteratorclass.php                   17-Jul-2024 20:07                6549
arrayobject.ksort.php                              17-Jul-2024 20:07                9611
arrayobject.natcasesort.php                        17-Jul-2024 20:07                8145
arrayobject.natsort.php                            17-Jul-2024 20:07                7856
arrayobject.offsetexists.php                       17-Jul-2024 20:07                4953
arrayobject.offsetget.php                          17-Jul-2024 20:07                5154
arrayobject.offsetset.php                          17-Jul-2024 20:07                6749
arrayobject.offsetunset.php                        17-Jul-2024 20:07                4251
arrayobject.serialize.php                          17-Jul-2024 20:07                5013
arrayobject.setflags.php                           17-Jul-2024 20:07                6692
arrayobject.setiteratorclass.php                   17-Jul-2024 20:07                5837
arrayobject.uasort.php                             17-Jul-2024 20:07               10730
arrayobject.uksort.php                             17-Jul-2024 20:07               10162
arrayobject.unserialize.php                        17-Jul-2024 20:07                3484
attribute.construct.php                            17-Jul-2024 20:07                2338
backedenum.from.php                                17-Jul-2024 20:07                6042
backedenum.tryfrom.php                             17-Jul-2024 20:07                6460
bc.configuration.php                               17-Jul-2024 20:07                2402
bc.installation.php                                17-Jul-2024 20:07                1365
bc.resources.php                                   17-Jul-2024 20:07                1153
bc.setup.php                                       17-Jul-2024 20:07                1472
book.apache.php                                    17-Jul-2024 20:07                3008
book.apcu.php                                      17-Jul-2024 20:07                4248
book.array.php                                     17-Jul-2024 20:07               10710
book.bc.php                                        17-Jul-2024 20:07                2661
book.bson.php                                      17-Jul-2024 20:07               25658
book.bzip2.php                                     17-Jul-2024 20:07                2731
book.calendar.php                                  17-Jul-2024 20:07                3629
book.classobj.php                                  17-Jul-2024 20:07                3914
book.cmark.php                                     17-Jul-2024 20:07                8735
book.com.php                                       17-Jul-2024 20:07                7964
book.componere.php                                 17-Jul-2024 20:07                6138
book.ctype.php                                     17-Jul-2024 20:07                2784
book.cubrid.php                                    17-Jul-2024 20:07               13795
book.curl.php                                      17-Jul-2024 20:07                6723
book.datetime.php                                  17-Jul-2024 20:07               16515
book.dba.php                                       17-Jul-2024 20:07                3362
book.dbase.php                                     17-Jul-2024 20:07                3060
book.dio.php                                       17-Jul-2024 20:07                2701
book.dir.php                                       17-Jul-2024 20:07                2766
book.dom.php                                       17-Jul-2024 20:07               20828
book.ds.php                                        17-Jul-2024 20:07               25027
book.eio.php                                       17-Jul-2024 20:07                7804
book.enchant.php                                   17-Jul-2024 20:07                5194
book.errorfunc.php                                 17-Jul-2024 20:07                3232
book.ev.php                                        17-Jul-2024 20:07               13186
book.event.php                                     17-Jul-2024 20:07               22959
book.exec.php                                      17-Jul-2024 20:07                2870
book.exif.php                                      17-Jul-2024 20:07                2396
book.expect.php                                    17-Jul-2024 20:07                2423
book.fann.php                                      17-Jul-2024 20:07               21742
book.fdf.php                                       17-Jul-2024 20:07                5510
book.ffi.php                                       17-Jul-2024 20:07                5514
book.fileinfo.php                                  17-Jul-2024 20:07                2830
book.filesystem.php                                17-Jul-2024 20:07                9213
book.filter.php                                    17-Jul-2024 20:07                3313
book.fpm.php                                       17-Jul-2024 20:07                1949
book.ftp.php                                       17-Jul-2024 20:07                5564
book.funchand.php                                  17-Jul-2024 20:07                3260
book.gearman.php                                   17-Jul-2024 20:07               14689
book.gender.php                                    17-Jul-2024 20:07                2543
book.geoip.php                                     17-Jul-2024 20:07                4152
book.gettext.php                                   17-Jul-2024 20:07                2732
book.gmagick.php                                   17-Jul-2024 20:07               22458
book.gmp.php                                       17-Jul-2024 20:07                6426
book.gnupg.php                                     17-Jul-2024 20:07                4758
book.hash.php                                      17-Jul-2024 20:07                3891
book.hrtime.php                                    17-Jul-2024 20:07                3482
book.ibase.php                                     17-Jul-2024 20:07               11840
book.ibm-db2.php                                   17-Jul-2024 20:07                8590
book.iconv.php                                     17-Jul-2024 20:07                3136
book.igbinary.php                                  17-Jul-2024 20:07                2038
book.image.php                                     17-Jul-2024 20:07               14854
book.imagick.php                                   17-Jul-2024 20:07               63634
book.imap.php                                      17-Jul-2024 20:07               10147
book.info.php                                      17-Jul-2024 20:07                7549
book.inotify.php                                   17-Jul-2024 20:07                2386
book.intl.php                                      17-Jul-2024 20:07               44952
book.json.php                                      17-Jul-2024 20:07                2798
book.ldap.php                                      17-Jul-2024 20:07                9073
book.libxml.php                                    17-Jul-2024 20:07                3111
book.lua.php                                       17-Jul-2024 20:07                2520
book.luasandbox.php                                17-Jul-2024 20:07                5450
book.lzf.php                                       17-Jul-2024 20:07                1951
book.mail.php                                      17-Jul-2024 20:07                1901
book.mailparse.php                                 17-Jul-2024 20:07                3800
book.math.php                                      17-Jul-2024 20:07                4929
book.mbstring.php                                  17-Jul-2024 20:07                9530
book.mcrypt.php                                    17-Jul-2024 20:07                5941
book.memcache.php                                  17-Jul-2024 20:07                4187
book.memcached.php                                 17-Jul-2024 20:07                7944
book.mhash.php                                     17-Jul-2024 20:07                2348
book.misc.php                                      17-Jul-2024 20:07                4998
book.mongodb.php                                   17-Jul-2024 20:07               26855
book.mqseries.php                                  17-Jul-2024 20:07                3126
book.mysql-xdevapi.php                             17-Jul-2024 20:07               28950
book.mysql.php                                     17-Jul-2024 20:07                7400
book.mysqli.php                                    17-Jul-2024 20:07               17592
book.mysqlnd.php                                   17-Jul-2024 20:07                2452
book.network.php                                   17-Jul-2024 20:07                5380
book.oauth.php                                     17-Jul-2024 20:07                7043
book.oci8.php                                      17-Jul-2024 20:07               16375
book.opcache.php                                   17-Jul-2024 20:07                2537
book.openal.php                                    17-Jul-2024 20:07                4247
book.openssl.php                                   17-Jul-2024 20:07               10446
book.outcontrol.php                                17-Jul-2024 20:07                4916
book.parallel.php                                  17-Jul-2024 20:07                5704
book.parle.php                                     17-Jul-2024 20:07                8756
book.password.php                                  17-Jul-2024 20:07                2448
book.pcntl.php                                     17-Jul-2024 20:07                4771
book.pcre.php                                      17-Jul-2024 20:07                3600
book.pdo.php                                       17-Jul-2024 20:07                7511
book.pgsql.php                                     17-Jul-2024 20:07               12095
book.phar.php                                      17-Jul-2024 20:07               15653
book.phpdbg.php                                    17-Jul-2024 20:07                2857
book.posix.php                                     17-Jul-2024 20:07                6537
book.ps.php                                        17-Jul-2024 20:07                9077
book.pspell.php                                    17-Jul-2024 20:07                4307
book.pthreads.php                                  17-Jul-2024 20:07                5266
book.quickhash.php                                 17-Jul-2024 20:07                8711
book.radius.php                                    17-Jul-2024 20:07                5352
book.random.php                                    17-Jul-2024 20:07                8783
book.rar.php                                       17-Jul-2024 20:07                5077
book.readline.php                                  17-Jul-2024 20:07                3489
book.recode.php                                    17-Jul-2024 20:07                2082
book.reflection.php                                17-Jul-2024 20:07               36393
book.rnp.php                                       17-Jul-2024 20:07                5924
book.rpminfo.php                                   17-Jul-2024 20:07                2396
book.rrd.php                                       17-Jul-2024 20:07                4880
book.runkit7.php                                   17-Jul-2024 20:07                4170
book.scoutapm.php                                  17-Jul-2024 20:07                2009
book.seaslog.php                                   17-Jul-2024 20:07                5134
book.sem.php                                       17-Jul-2024 20:07                4039
book.session.php                                   17-Jul-2024 20:07                7564
book.shmop.php                                     17-Jul-2024 20:07                2548
book.simdjson.php                                  17-Jul-2024 20:07                2556
book.simplexml.php                                 17-Jul-2024 20:07                5252
book.snmp.php                                      17-Jul-2024 20:07                5637
book.soap.php                                      17-Jul-2024 20:07                6031
book.sockets.php                                   17-Jul-2024 20:07                6754
book.sodium.php                                    17-Jul-2024 20:07               17180
book.solr.php                                      17-Jul-2024 20:07               52960
book.spl.php                                       17-Jul-2024 20:07                9575
book.sqlite3.php                                   17-Jul-2024 20:07                7013
book.sqlsrv.php                                    17-Jul-2024 20:07                5281
book.ssdeep.php                                    17-Jul-2024 20:07                2134
book.ssh2.php                                      17-Jul-2024 20:07                5336
book.stats.php                                     17-Jul-2024 20:07               11616
book.stomp.php                                     17-Jul-2024 20:07                4082
book.stream.php                                    17-Jul-2024 20:07               11434
book.strings.php                                   17-Jul-2024 20:07               12553
book.svm.php                                       17-Jul-2024 20:07                3560
book.svn.php                                       17-Jul-2024 20:07                7445
book.swoole.php                                    17-Jul-2024 20:07               37202
book.sync.php                                      17-Jul-2024 20:07                4581
book.taint.php                                     17-Jul-2024 20:07                2414
book.tcpwrap.php                                   17-Jul-2024 20:07                1800
book.tidy.php                                      17-Jul-2024 20:07                6518
book.tokenizer.php                                 17-Jul-2024 20:07                2938
book.trader.php                                    17-Jul-2024 20:07               17447
book.ui.php                                        17-Jul-2024 20:07               27914
book.uodbc.php                                     17-Jul-2024 20:07                6952
book.uopz.php                                      17-Jul-2024 20:07                5038
book.url.php                                       17-Jul-2024 20:07                2762
book.v8js.php                                      17-Jul-2024 20:07                3041
book.var.php                                       17-Jul-2024 20:07                5082
book.var_representation.php                        17-Jul-2024 20:07                2025
book.varnish.php                                   17-Jul-2024 20:07                5244
book.wddx.php                                      17-Jul-2024 20:07                2605
book.win32service.php                              17-Jul-2024 20:07                3879
book.wincache.php                                  17-Jul-2024 20:07                5472
book.wkhtmltox.php                                 17-Jul-2024 20:07                3267
book.xattr.php                                     17-Jul-2024 20:07                2313
book.xdiff.php                                     17-Jul-2024 20:07                3956
book.xhprof.php                                    17-Jul-2024 20:07                2414
book.xlswriter.php                                 17-Jul-2024 20:07                4306
book.xml.php                                       17-Jul-2024 20:07                5199
book.xmldiff.php                                   17-Jul-2024 20:07                3079
book.xmlreader.php                                 17-Jul-2024 20:07                4698
book.xmlrpc.php                                    17-Jul-2024 20:07                3487
book.xmlwriter.php                                 17-Jul-2024 20:07                6320
book.xsl.php                                       17-Jul-2024 20:07                3628
book.yac.php                                       17-Jul-2024 20:07                2533
book.yaconf.php                                    17-Jul-2024 20:07                2013
book.yaf.php                                       17-Jul-2024 20:07               34332
book.yaml.php                                      17-Jul-2024 20:07                2700
book.yar.php                                       17-Jul-2024 20:07                3645
book.yaz.php                                       17-Jul-2024 20:07                4162
book.zip.php                                       17-Jul-2024 20:07                9891
book.zlib.php                                      17-Jul-2024 20:07                4975
book.zmq.php                                       17-Jul-2024 20:07                5465
book.zookeeper.php                                 17-Jul-2024 20:07                6518
bzip2.examples.php                                 17-Jul-2024 20:07                4059
bzip2.installation.php                             17-Jul-2024 20:07                1301
bzip2.requirements.php                             17-Jul-2024 20:07                1328
bzip2.resources.php                                17-Jul-2024 20:07                1213
bzip2.setup.php                                    17-Jul-2024 20:07                1485
cachingiterator.construct.php                      17-Jul-2024 20:07                2791
cachingiterator.count.php                          17-Jul-2024 20:07                2457
cachingiterator.current.php                        17-Jul-2024 20:07                2751
cachingiterator.getcache.php                       17-Jul-2024 20:07                5850
cachingiterator.getflags.php                       17-Jul-2024 20:07                2451
cachingiterator.hasnext.php                        17-Jul-2024 20:07                2571
cachingiterator.key.php                            17-Jul-2024 20:07                2162
cachingiterator.next.php                           17-Jul-2024 20:07                2368
cachingiterator.offsetexists.php                   17-Jul-2024 20:07                2928
cachingiterator.offsetget.php                      17-Jul-2024 20:07                2676
cachingiterator.offsetset.php                      17-Jul-2024 20:07                3039
cachingiterator.offsetunset.php                    17-Jul-2024 20:07                2712
cachingiterator.rewind.php                         17-Jul-2024 20:07                2384
cachingiterator.setflags.php                       17-Jul-2024 20:07                2744
cachingiterator.tostring.php                       17-Jul-2024 20:07                2589
cachingiterator.valid.php                          17-Jul-2024 20:07                2618
calendar.constants.php                             17-Jul-2024 20:07               12570
calendar.installation.php                          17-Jul-2024 20:07                1402
calendar.resources.php                             17-Jul-2024 20:07                1190
calendar.setup.php                                 17-Jul-2024 20:07                1458
callbackfilteriterator.accept.php                  17-Jul-2024 20:07                3568
callbackfilteriterator.construct.php               17-Jul-2024 20:07                3942
cc.license.php                                     17-Jul-2024 20:07               20752
changelog.misc.php                                 17-Jul-2024 20:07                1295
changelog.mysql.php                                17-Jul-2024 20:07                2403
changelog.mysql_xdevapi.php                        17-Jul-2024 20:07                2303
changelog.mysqli.php                               17-Jul-2024 20:07                1336
changelog.strings.php                              17-Jul-2024 20:07                1349
class.addressinfo.php                              17-Jul-2024 20:07                1750
class.allowdynamicproperties.php                   17-Jul-2024 20:07                4889
class.apcuiterator.php                             17-Jul-2024 20:07                7294
class.appenditerator.php                           17-Jul-2024 20:07                7843
class.argumentcounterror.php                       17-Jul-2024 20:07                8566
class.arithmeticerror.php                          17-Jul-2024 20:07                8693
class.arrayaccess.php                              17-Jul-2024 20:07               11745
class.arrayiterator.php                            17-Jul-2024 20:07               16848
class.arrayobject.php                              17-Jul-2024 20:07               16710
class.assertionerror.php                           17-Jul-2024 20:07                8469
class.attribute.php                                17-Jul-2024 20:07                8521
class.backedenum.php                               17-Jul-2024 20:07                4192
class.badfunctioncallexception.php                 17-Jul-2024 20:07                8566
class.badmethodcallexception.php                   17-Jul-2024 20:07                8566
class.cachingiterator.php                          17-Jul-2024 20:07               17187
class.callbackfilteriterator.php                   17-Jul-2024 20:07               11533
class.closedgeneratorexception.php                 17-Jul-2024 20:07                8702
class.closure.php                                  17-Jul-2024 20:07                6827
class.collator.php                                 17-Jul-2024 20:07               36476
class.collectable.php                              17-Jul-2024 20:07                2544
class.com-exception.php                            17-Jul-2024 20:07                8403
class.com-safearray-proxy.php                      17-Jul-2024 20:07                1882
class.com.php                                      17-Jul-2024 20:07               12519
class.commonmark-cql.php                           17-Jul-2024 20:07                7338
class.commonmark-interfaces-ivisitable.php         17-Jul-2024 20:07                2987
class.commonmark-interfaces-ivisitor.php           17-Jul-2024 20:07                4576
class.commonmark-node-blockquote.php               17-Jul-2024 20:07                8446
class.commonmark-node-bulletlist.php               17-Jul-2024 20:07               10606
class.commonmark-node-code.php                     17-Jul-2024 20:07                9440
class.commonmark-node-codeblock.php                17-Jul-2024 20:07               10810
class.commonmark-node-customblock.php              17-Jul-2024 20:07                9190
class.commonmark-node-custominline.php             17-Jul-2024 20:07                9170
class.commonmark-node-document.php                 17-Jul-2024 20:07                8398
class.commonmark-node-heading.php                  17-Jul-2024 20:07                9787
class.commonmark-node-htmlblock.php                17-Jul-2024 20:07                9498
class.commonmark-node-htmlinline.php               17-Jul-2024 20:07                9474
class.commonmark-node-image.php                    17-Jul-2024 20:07               10695
class.commonmark-node-item.php                     17-Jul-2024 20:07                8413
class.commonmark-node-linebreak.php                17-Jul-2024 20:07                8427
class.commonmark-node-link.php                     17-Jul-2024 20:07               10688
class.commonmark-node-orderedlist.php              17-Jul-2024 20:07               11572
class.commonmark-node-paragraph.php                17-Jul-2024 20:07                8452
class.commonmark-node-softbreak.php                17-Jul-2024 20:07                8445
class.commonmark-node-text-emphasis.php            17-Jul-2024 20:07                8474
class.commonmark-node-text-strong.php              17-Jul-2024 20:07                8463
class.commonmark-node-text.php                     17-Jul-2024 20:07                9825
class.commonmark-node-thematicbreak.php            17-Jul-2024 20:07                8474
class.commonmark-node.php                          17-Jul-2024 20:07                9351
class.commonmark-parser.php                        17-Jul-2024 20:07                3838
class.compersisthelper.php                         17-Jul-2024 20:07                7470
class.compileerror.php                             17-Jul-2024 20:07                8391
class.componere-abstract-definition.php            17-Jul-2024 20:07                4732
class.componere-definition.php                     17-Jul-2024 20:07               10246
class.componere-method.php                         17-Jul-2024 20:07                4330
class.componere-patch.php                          17-Jul-2024 20:07                8341
class.componere-value.php                          17-Jul-2024 20:07                5433
class.countable.php                                17-Jul-2024 20:07                2529
class.curlfile.php                                 17-Jul-2024 20:07                8201
class.curlhandle.php                               17-Jul-2024 20:07                1769
class.curlmultihandle.php                          17-Jul-2024 20:07                1807
class.curlsharehandle.php                          17-Jul-2024 20:07                1804
class.curlstringfile.php                           17-Jul-2024 20:07                5560
class.dateerror.php                                17-Jul-2024 20:07                9028
class.dateexception.php                            17-Jul-2024 20:07                9680
class.dateinterval.php                             17-Jul-2024 20:07               13622
class.dateinvalidoperationexception.php            17-Jul-2024 20:07                9143
class.dateinvalidtimezoneexception.php             17-Jul-2024 20:07                8721
class.datemalformedintervalstringexception.php     17-Jul-2024 20:07                8820
class.datemalformedperiodstringexception.php       17-Jul-2024 20:07                8802
class.datemalformedstringexception.php             17-Jul-2024 20:07                9101
class.dateobjecterror.php                          17-Jul-2024 20:07                8854
class.dateperiod.php                               17-Jul-2024 20:07               21973
class.daterangeerror.php                           17-Jul-2024 20:07                9042
class.datetime.php                                 17-Jul-2024 20:07               23061
class.datetimeimmutable.php                        17-Jul-2024 20:07               23376
class.datetimeinterface.php                        17-Jul-2024 20:07               20007
class.datetimezone.php                             17-Jul-2024 20:07               15480
class.deflatecontext.php                           17-Jul-2024 20:07                1823
class.directory.php                                17-Jul-2024 20:07                5478
class.directoryiterator.php                        17-Jul-2024 20:07               20003
class.divisionbyzeroerror.php                      17-Jul-2024 20:07                8421
class.domainexception.php                          17-Jul-2024 20:07                8503
class.domattr.php                                  17-Jul-2024 20:07               28244
class.domcdatasection.php                          17-Jul-2024 20:07               32104
class.domcharacterdata.php                         17-Jul-2024 20:07               33348
class.domchildnode.php                             17-Jul-2024 20:07                4227
class.domcomment.php                               17-Jul-2024 20:07               30771
class.domdocument.php                              17-Jul-2024 20:07               68167
class.domdocumentfragment.php                      17-Jul-2024 20:07               29112
class.domdocumenttype.php                          17-Jul-2024 20:07               27243
class.domelement.php                               17-Jul-2024 20:07               53070
class.domentity.php                                17-Jul-2024 20:07               27883
class.domentityreference.php                       17-Jul-2024 20:07               23380
class.domexception.php                             17-Jul-2024 20:07                9312
class.domimplementation.php                        17-Jul-2024 20:07                6027
class.domnamednodemap.php                          17-Jul-2024 20:07                7362
class.domnamespacenode.php                         17-Jul-2024 20:07                9404
class.domnode.php                                  17-Jul-2024 20:07               32466
class.domnodelist.php                              17-Jul-2024 20:07                5978
class.domnotation.php                              17-Jul-2024 20:07               23654
class.domparentnode.php                            17-Jul-2024 20:07                3897
class.domprocessinginstruction.php                 17-Jul-2024 20:07               24900
class.domtext.php                                  17-Jul-2024 20:07               33692
class.domxpath.php                                 17-Jul-2024 20:07                8680
class.dotnet.php                                   17-Jul-2024 20:07                6933
class.ds-collection.php                            17-Jul-2024 20:07                5988
class.ds-deque.php                                 17-Jul-2024 20:07               22087
class.ds-hashable.php                              17-Jul-2024 20:07                4109
class.ds-map.php                                   17-Jul-2024 20:07               23027
class.ds-pair.php                                  17-Jul-2024 20:07                4582
class.ds-priorityqueue.php                         17-Jul-2024 20:07                8348
class.ds-queue.php                                 17-Jul-2024 20:07                7830
class.ds-sequence.php                              17-Jul-2024 20:07               23599
class.ds-set.php                                   17-Jul-2024 20:07               18558
class.ds-stack.php                                 17-Jul-2024 20:07                7170
class.ds-vector.php                                17-Jul-2024 20:07               21623
class.emptyiterator.php                            17-Jul-2024 20:07                4065
class.enchantbroker.php                            17-Jul-2024 20:07                1835
class.enchantdictionary.php                        17-Jul-2024 20:07                1825
class.error.php                                    17-Jul-2024 20:07               10714
class.errorexception.php                           17-Jul-2024 20:07               14435
class.ev.php                                       17-Jul-2024 20:07               42323
class.evcheck.php                                  17-Jul-2024 20:07               10826
class.evchild.php                                  17-Jul-2024 20:07               12489
class.evembed.php                                  17-Jul-2024 20:07                9992
class.event.php                                    17-Jul-2024 20:07               18396
class.eventbase.php                                17-Jul-2024 20:07               14882
class.eventbuffer.php                              17-Jul-2024 20:07               23358
class.eventbufferevent.php                         17-Jul-2024 20:07               37860
class.eventconfig.php                              17-Jul-2024 20:07                7652
class.eventdnsbase.php                             17-Jul-2024 20:07               14255
class.eventexception.php                           17-Jul-2024 20:07                8530
class.eventhttp.php                                17-Jul-2024 20:07                9696
class.eventhttpconnection.php                      17-Jul-2024 20:07               10512
class.eventhttprequest.php                         17-Jul-2024 20:07               22841
class.eventlistener.php                            17-Jul-2024 20:07               12764
class.eventsslcontext.php                          17-Jul-2024 20:07               19129
class.eventutil.php                                17-Jul-2024 20:07               25540
class.evfork.php                                   17-Jul-2024 20:07                8992
class.evidle.php                                   17-Jul-2024 20:07                9819
class.evio.php                                     17-Jul-2024 20:07               12596
class.evloop.php                                   17-Jul-2024 20:07               31508
class.evperiodic.php                               17-Jul-2024 20:07               14911
class.evprepare.php                                17-Jul-2024 20:07               10965
class.evsignal.php                                 17-Jul-2024 20:07               11900
class.evstat.php                                   17-Jul-2024 20:07               14376
class.evtimer.php                                  17-Jul-2024 20:07               14289
class.evwatcher.php                                17-Jul-2024 20:07                9969
class.exception.php                                17-Jul-2024 20:07               10899
class.fannconnection.php                           17-Jul-2024 20:07                6454
class.ffi-cdata.php                                17-Jul-2024 20:07                6157
class.ffi-ctype.php                                17-Jul-2024 20:07               31238
class.ffi-exception.php                            17-Jul-2024 20:07                8216
class.ffi-parserexception.php                      17-Jul-2024 20:07                8271
class.ffi.php                                      17-Jul-2024 20:07               18172
class.fiber.php                                    17-Jul-2024 20:07                7586
class.fibererror.php                               17-Jul-2024 20:07                8109
class.filesystemiterator.php                       17-Jul-2024 20:07               31753
class.filteriterator.php                           17-Jul-2024 20:07                7277
class.finfo.php                                    17-Jul-2024 20:07                6209
class.ftp-connection.php                           17-Jul-2024 20:07                1797
class.gdfont.php                                   17-Jul-2024 20:07                1722
class.gdimage.php                                  17-Jul-2024 20:07                1717
class.gearmanclient.php                            17-Jul-2024 20:07               37772
class.gearmanexception.php                         17-Jul-2024 20:07                7214
class.gearmanjob.php                               17-Jul-2024 20:07                9234
class.gearmantask.php                              17-Jul-2024 20:07                8877
class.gearmanworker.php                            17-Jul-2024 20:07               13448
class.gender.php                                   17-Jul-2024 20:07               42211
class.generator.php                                17-Jul-2024 20:07                6453
class.globiterator.php                             17-Jul-2024 20:07               26469
class.gmagick.php                                  17-Jul-2024 20:07               87048
class.gmagickdraw.php                              17-Jul-2024 20:07               24452
class.gmagickpixel.php                             17-Jul-2024 20:07                5929
class.gmp.php                                      17-Jul-2024 20:07                4213
class.hashcontext.php                              17-Jul-2024 20:07                3307
class.hrtime-performancecounter.php                17-Jul-2024 20:07                3832
class.hrtime-stopwatch.php                         17-Jul-2024 20:07                7037
class.hrtime-unit.php                              17-Jul-2024 20:07                4408
class.imagick.php                                  17-Jul-2024 20:07              286369
class.imagickdraw.php                              17-Jul-2024 20:07               82896
class.imagickkernel.php                            17-Jul-2024 20:07                6544
class.imagickpixel.php                             17-Jul-2024 20:07               13861
class.imagickpixeliterator.php                     17-Jul-2024 20:07                9636
class.imap-connection.php                          17-Jul-2024 20:07                1800
class.infiniteiterator.php                         17-Jul-2024 20:07                5293
class.inflatecontext.php                           17-Jul-2024 20:07                1797
class.internaliterator.php                         17-Jul-2024 20:07                4700
class.intlbreakiterator.php                        17-Jul-2024 20:07               30488
class.intlcalendar.php                             17-Jul-2024 20:07               72212
class.intlchar.php                                 17-Jul-2024 20:07              473308
class.intlcodepointbreakiterator.php               17-Jul-2024 20:07               21522
class.intldateformatter.php                        17-Jul-2024 20:07               32384
class.intldatepatterngenerator.php                 17-Jul-2024 20:07                4748
class.intlexception.php                            17-Jul-2024 20:07                8627
class.intlgregoriancalendar.php                    17-Jul-2024 20:07               53241
class.intliterator.php                             17-Jul-2024 20:07                5053
class.intlpartsiterator.php                        17-Jul-2024 20:07                7124
class.intlrulebasedbreakiterator.php               17-Jul-2024 20:07               24437
class.intltimezone.php                             17-Jul-2024 20:07               28329
class.invalidargumentexception.php                 17-Jul-2024 20:07                8526
class.iterator.php                                 17-Jul-2024 20:07               11243
class.iteratoraggregate.php                        17-Jul-2024 20:07                6236
class.iteratoriterator.php                         17-Jul-2024 20:07                6295
class.jsonexception.php                            17-Jul-2024 20:07                8857
class.jsonserializable.php                         17-Jul-2024 20:07                2746
class.ldap-connection.php                          17-Jul-2024 20:07                1820
class.ldap-result-entry.php                        17-Jul-2024 20:07                1835
class.ldap-result.php                              17-Jul-2024 20:07                1812
class.lengthexception.php                          17-Jul-2024 20:07                8452
class.libxmlerror.php                              17-Jul-2024 20:07                5625
class.limititerator.php                            17-Jul-2024 20:07               11219
class.locale.php                                   17-Jul-2024 20:07               28517
class.logicexception.php                           17-Jul-2024 20:07                8512
class.lua.php                                      17-Jul-2024 20:07                7743
class.luaclosure.php                               17-Jul-2024 20:07                2657
class.luasandbox.php                               17-Jul-2024 20:07               14147
class.luasandboxerror.php                          17-Jul-2024 20:07               10083
class.luasandboxerrorerror.php                     17-Jul-2024 20:07                7629
class.luasandboxfatalerror.php                     17-Jul-2024 20:07                7751
class.luasandboxfunction.php                       17-Jul-2024 20:07                3941
class.luasandboxmemoryerror.php                    17-Jul-2024 20:07                7936
class.luasandboxruntimeerror.php                   17-Jul-2024 20:07                7771
class.luasandboxsyntaxerror.php                    17-Jul-2024 20:07                7633
class.luasandboxtimeouterror.php                   17-Jul-2024 20:07                7921
class.memcache.php                                 17-Jul-2024 20:07               19203
class.memcached.php                                17-Jul-2024 20:07               46770
class.memcachedexception.php                       17-Jul-2024 20:07                7505
class.messageformatter.php                         17-Jul-2024 20:07               12134
class.mongodb-bson-binary.php                      17-Jul-2024 20:07               17013
class.mongodb-bson-binaryinterface.php             17-Jul-2024 20:07                4723
class.mongodb-bson-dbpointer.php                   17-Jul-2024 20:07                6044
class.mongodb-bson-decimal128.php                  17-Jul-2024 20:07                7825
class.mongodb-bson-decimal128interface.php         17-Jul-2024 20:07                3850
class.mongodb-bson-document.php                    17-Jul-2024 20:07               14088
class.mongodb-bson-int64.php                       17-Jul-2024 20:07                7514
class.mongodb-bson-iterator.php                    17-Jul-2024 20:07                5006
class.mongodb-bson-javascript.php                  17-Jul-2024 20:07                8773
class.mongodb-bson-javascriptinterface.php         17-Jul-2024 20:07                4953
class.mongodb-bson-maxkey.php                      17-Jul-2024 20:07                5872
class.mongodb-bson-maxkeyinterface.php             17-Jul-2024 20:07                2232
class.mongodb-bson-minkey.php                      17-Jul-2024 20:07                5863
class.mongodb-bson-minkeyinterface.php             17-Jul-2024 20:07                2213
class.mongodb-bson-objectid.php                    17-Jul-2024 20:07                9238
class.mongodb-bson-objectidinterface.php           17-Jul-2024 20:07                4340
class.mongodb-bson-packedarray.php                 17-Jul-2024 20:07               11909
class.mongodb-bson-persistable.php                 17-Jul-2024 20:07                6166
class.mongodb-bson-regex.php                       17-Jul-2024 20:07                8204
class.mongodb-bson-regexinterface.php              17-Jul-2024 20:07                4742
class.mongodb-bson-serializable.php                17-Jul-2024 20:07                4240
class.mongodb-bson-symbol.php                      17-Jul-2024 20:07                5932
class.mongodb-bson-timestamp.php                   17-Jul-2024 20:07                8451
class.mongodb-bson-timestampinterface.php          17-Jul-2024 20:07                4900
class.mongodb-bson-type.php                        17-Jul-2024 20:07                2061
class.mongodb-bson-undefined.php                   17-Jul-2024 20:07                6020
class.mongodb-bson-unserializable.php              17-Jul-2024 20:07                3983
class.mongodb-bson-utcdatetime.php                 17-Jul-2024 20:07                8054
class.mongodb-bson-utcdatetimeinterface.php        17-Jul-2024 20:07                4413
class.mongodb-driver-bulkwrite.php                 17-Jul-2024 20:07               24111
class.mongodb-driver-clientencryption.php          17-Jul-2024 20:07               26288
class.mongodb-driver-command.php                   17-Jul-2024 20:07               14236
class.mongodb-driver-cursor.php                    17-Jul-2024 20:07               25849
class.mongodb-driver-cursorid.php                  17-Jul-2024 20:07                5563
class.mongodb-driver-cursorinterface.php           17-Jul-2024 20:07                6201
class.mongodb-driver-exception-authenticationex..> 17-Jul-2024 20:07                9183
class.mongodb-driver-exception-bulkwriteexcepti..> 17-Jul-2024 20:07               10037
class.mongodb-driver-exception-commandexception..> 17-Jul-2024 20:07               10918
class.mongodb-driver-exception-connectionexcept..> 17-Jul-2024 20:07                9252
class.mongodb-driver-exception-connectiontimeou..> 17-Jul-2024 20:07                9640
class.mongodb-driver-exception-encryptionexcept..> 17-Jul-2024 20:07                9186
class.mongodb-driver-exception-exception.php       17-Jul-2024 20:07                2313
class.mongodb-driver-exception-executiontimeout..> 17-Jul-2024 20:07               10287
class.mongodb-driver-exception-invalidargumente..> 17-Jul-2024 20:07                8212
class.mongodb-driver-exception-logicexception.php  17-Jul-2024 20:07                8096
class.mongodb-driver-exception-runtimeexception..> 17-Jul-2024 20:07               11663
class.mongodb-driver-exception-serverexception.php 17-Jul-2024 20:07                9263
class.mongodb-driver-exception-sslconnectionexc..> 17-Jul-2024 20:07                9535
class.mongodb-driver-exception-unexpectedvaluee..> 17-Jul-2024 20:07                8229
class.mongodb-driver-exception-writeexception.php  17-Jul-2024 20:07               12181
class.mongodb-driver-manager.php                   17-Jul-2024 20:07               21812
class.mongodb-driver-monitoring-commandfailedev..> 17-Jul-2024 20:07                8660
class.mongodb-driver-monitoring-commandstartede..> 17-Jul-2024 20:07                7583
class.mongodb-driver-monitoring-commandsubscrib..> 17-Jul-2024 20:07                6289
class.mongodb-driver-monitoring-commandsucceede..> 17-Jul-2024 20:07                8251
class.mongodb-driver-monitoring-logsubscriber.php  17-Jul-2024 20:07               10148
class.mongodb-driver-monitoring-sdamsubscriber.php 17-Jul-2024 20:07               11639
class.mongodb-driver-monitoring-serverchangedev..> 17-Jul-2024 20:07                5773
class.mongodb-driver-monitoring-serverclosedeve..> 17-Jul-2024 20:07                4420
class.mongodb-driver-monitoring-serverheartbeat..> 17-Jul-2024 20:07                5771
class.mongodb-driver-monitoring-serverheartbeat..> 17-Jul-2024 20:07                4598
class.mongodb-driver-monitoring-serverheartbeat..> 17-Jul-2024 20:07                5843
class.mongodb-driver-monitoring-serveropeningev..> 17-Jul-2024 20:07                4440
class.mongodb-driver-monitoring-subscriber.php     17-Jul-2024 20:07                2676
class.mongodb-driver-monitoring-topologychanged..> 17-Jul-2024 20:07                4768
class.mongodb-driver-monitoring-topologyclosede..> 17-Jul-2024 20:07                3379
class.mongodb-driver-monitoring-topologyopening..> 17-Jul-2024 20:07                3393
class.mongodb-driver-query.php                     17-Jul-2024 20:07                3452
class.mongodb-driver-readconcern.php               17-Jul-2024 20:07               17708
class.mongodb-driver-readpreference.php            17-Jul-2024 20:07               21918
class.mongodb-driver-server.php                    17-Jul-2024 20:07               27188
class.mongodb-driver-serverapi.php                 17-Jul-2024 20:07               14079
class.mongodb-driver-serverdescription.php         17-Jul-2024 20:07               16896
class.mongodb-driver-session.php                   17-Jul-2024 20:07               15555
class.mongodb-driver-topologydescription.php       17-Jul-2024 20:07               11660
class.mongodb-driver-writeconcern.php              17-Jul-2024 20:07               10303
class.mongodb-driver-writeconcernerror.php         17-Jul-2024 20:07                4411
class.mongodb-driver-writeerror.php                17-Jul-2024 20:07                4735
class.mongodb-driver-writeresult.php               17-Jul-2024 20:07                8713
class.multipleiterator.php                         17-Jul-2024 20:07               11539
class.mysql-xdevapi-baseresult.php                 17-Jul-2024 20:07                3076
class.mysql-xdevapi-client.php                     17-Jul-2024 20:07                3158
class.mysql-xdevapi-collection.php                 17-Jul-2024 20:07               10826
class.mysql-xdevapi-collectionadd.php              17-Jul-2024 20:07                2977
class.mysql-xdevapi-collectionfind.php             17-Jul-2024 20:07                8857
class.mysql-xdevapi-collectionmodify.php           17-Jul-2024 20:07               10314
class.mysql-xdevapi-collectionremove.php           17-Jul-2024 20:07                5251
class.mysql-xdevapi-columnresult.php               17-Jul-2024 20:07                6801
class.mysql-xdevapi-crudoperationbindable.php      17-Jul-2024 20:07                3013
class.mysql-xdevapi-crudoperationlimitable.php     17-Jul-2024 20:07                3019
class.mysql-xdevapi-crudoperationskippable.php     17-Jul-2024 20:07                3030
class.mysql-xdevapi-crudoperationsortable.php      17-Jul-2024 20:07                3006
class.mysql-xdevapi-databaseobject.php             17-Jul-2024 20:07                3577
class.mysql-xdevapi-docresult.php                  17-Jul-2024 20:07                4079
class.mysql-xdevapi-exception.php                  17-Jul-2024 20:07                2243
class.mysql-xdevapi-executable.php                 17-Jul-2024 20:07                2655
class.mysql-xdevapi-executionstatus.php            17-Jul-2024 20:07                4887
class.mysql-xdevapi-expression.php                 17-Jul-2024 20:07                3280
class.mysql-xdevapi-result.php                     17-Jul-2024 20:07                4463
class.mysql-xdevapi-rowresult.php                  17-Jul-2024 20:07                5176
class.mysql-xdevapi-schema.php                     17-Jul-2024 20:07                7880
class.mysql-xdevapi-schemaobject.php               17-Jul-2024 20:07                2840
class.mysql-xdevapi-session.php                    17-Jul-2024 20:07                9740
class.mysql-xdevapi-sqlstatement.php               17-Jul-2024 20:07                6680
class.mysql-xdevapi-sqlstatementresult.php         17-Jul-2024 20:07                7358
class.mysql-xdevapi-statement.php                  17-Jul-2024 20:07                5050
class.mysql-xdevapi-table.php                      17-Jul-2024 20:07                7449
class.mysql-xdevapi-tabledelete.php                17-Jul-2024 20:07                5216
class.mysql-xdevapi-tableinsert.php                17-Jul-2024 20:07                3537
class.mysql-xdevapi-tableselect.php                17-Jul-2024 20:07                8361
class.mysql-xdevapi-tableupdate.php                17-Jul-2024 20:07                6151
class.mysql-xdevapi-warning.php                    17-Jul-2024 20:07                3777
class.mysqli-driver.php                            17-Jul-2024 20:07                7856
class.mysqli-result.php                            17-Jul-2024 20:07               16016
class.mysqli-sql-exception.php                     17-Jul-2024 20:07               10026
class.mysqli-stmt.php                              17-Jul-2024 20:07               18756
class.mysqli-warning.php                           17-Jul-2024 20:07                4398
class.mysqli.php                                   17-Jul-2024 20:07               45016
class.norewinditerator.php                         17-Jul-2024 20:07                6730
class.normalizer.php                               17-Jul-2024 20:07               13604
class.numberformatter.php                          17-Jul-2024 20:07               74524
class.oauth.php                                    17-Jul-2024 20:07               19981
class.oauthexception.php                           17-Jul-2024 20:07                8510
class.oauthprovider.php                            17-Jul-2024 20:07               12925
class.ocicollection.php                            17-Jul-2024 20:07                7134
class.ocilob.php                                   17-Jul-2024 20:07               15353
class.opensslasymmetrickey.php                     17-Jul-2024 20:07                1899
class.opensslcertificate.php                       17-Jul-2024 20:07                1901
class.opensslcertificatesigningrequest.php         17-Jul-2024 20:07                1988
class.outeriterator.php                            17-Jul-2024 20:07                4340
class.outofboundsexception.php                     17-Jul-2024 20:07                8561
class.outofrangeexception.php                      17-Jul-2024 20:07                8563
class.overflowexception.php                        17-Jul-2024 20:07                8482
class.override.php                                 17-Jul-2024 20:07                3992
class.parallel-channel.php                         17-Jul-2024 20:07                8239
class.parallel-events-event-type.php               17-Jul-2024 20:07                3409
class.parallel-events-event.php                    17-Jul-2024 20:07                3562
class.parallel-events-input.php                    17-Jul-2024 20:07                4787
class.parallel-events.php                          17-Jul-2024 20:07                7159
class.parallel-future.php                          17-Jul-2024 20:07                7812
class.parallel-runtime.php                         17-Jul-2024 20:07                6436
class.parallel-sync.php                            17-Jul-2024 20:07                5260
class.parentiterator.php                           17-Jul-2024 20:07                9618
class.parle-errorinfo.php                          17-Jul-2024 20:07                3879
class.parle-lexer.php                              17-Jul-2024 20:07               13193
class.parle-lexerexception.php                     17-Jul-2024 20:07                7764
class.parle-parser.php                             17-Jul-2024 20:07               18121
class.parle-parserexception.php                    17-Jul-2024 20:07                7746
class.parle-rlexer.php                             17-Jul-2024 20:07               15428
class.parle-rparser.php                            17-Jul-2024 20:07               18294
class.parle-stack.php                              17-Jul-2024 20:07                4836
class.parle-token.php                              17-Jul-2024 20:07                4934
class.parseerror.php                               17-Jul-2024 20:07                8932
class.pdo.php                                      17-Jul-2024 20:07               42638
class.pdoexception.php                             17-Jul-2024 20:07               10339
class.pdorow.php                                   17-Jul-2024 20:07                4065
class.pdostatement.php                             17-Jul-2024 20:07               22734
class.pgsql-connection.php                         17-Jul-2024 20:07                1843
class.pgsql-lob.php                                17-Jul-2024 20:07                1785
class.pgsql-result.php                             17-Jul-2024 20:07                1817
class.phar.php                                     17-Jul-2024 20:07               74220
class.phardata.php                                 17-Jul-2024 20:07               49610
class.pharexception.php                            17-Jul-2024 20:07                8456
class.pharfileinfo.php                             17-Jul-2024 20:07               21674
class.php-user-filter.php                          17-Jul-2024 20:07                6433
class.phptoken.php                                 17-Jul-2024 20:07                8755
class.pool.php                                     17-Jul-2024 20:07                7744
class.pspell-config.php                            17-Jul-2024 20:07                1819
class.pspell-dictionary.php                        17-Jul-2024 20:07                1856
class.quickhashinthash.php                         17-Jul-2024 20:07               15112
class.quickhashintset.php                          17-Jul-2024 20:07               12888
class.quickhashintstringhash.php                   17-Jul-2024 20:07               16008
class.quickhashstringinthash.php                   17-Jul-2024 20:07               13677
class.random-brokenrandomengineerror.php           17-Jul-2024 20:07                8554
class.random-cryptosafeengine.php                  17-Jul-2024 20:07                2500
class.random-engine-mt19937.php                    17-Jul-2024 20:07                5370
class.random-engine-pcgoneseq128xslrr64.php        17-Jul-2024 20:07                6201
class.random-engine-secure.php                     17-Jul-2024 20:07                3428
class.random-engine-xoshiro256starstar.php         17-Jul-2024 20:07                6371
class.random-engine.php                            17-Jul-2024 20:07                3784
class.random-randomerror.php                       17-Jul-2024 20:07                8478
class.random-randomexception.php                   17-Jul-2024 20:07                8592
class.random-randomizer.php                        17-Jul-2024 20:07               10581
class.rangeexception.php                           17-Jul-2024 20:07                8691
class.rararchive.php                               17-Jul-2024 20:07                7748
class.rarentry.php                                 17-Jul-2024 20:07               49799
class.rarexception.php                             17-Jul-2024 20:07                8308
class.recursivearrayiterator.php                   17-Jul-2024 20:07               15911
class.recursivecachingiterator.php                 17-Jul-2024 20:07               14127
class.recursivecallbackfilteriterator.php          17-Jul-2024 20:07               13293
class.recursivedirectoryiterator.php               17-Jul-2024 20:07               29821
class.recursivefilteriterator.php                  17-Jul-2024 20:07                8249
class.recursiveiterator.php                        17-Jul-2024 20:07                4878
class.recursiveiteratoriterator.php                17-Jul-2024 20:07               14641
class.recursiveregexiterator.php                   17-Jul-2024 20:07               14755
class.recursivetreeiterator.php                    17-Jul-2024 20:07               25647
class.reflection.php                               17-Jul-2024 20:07                3438
class.reflectionattribute.php                      17-Jul-2024 20:07                6243
class.reflectionclass.php                          17-Jul-2024 20:07               37359
class.reflectionclassconstant.php                  17-Jul-2024 20:07               16233
class.reflectionenum.php                           17-Jul-2024 20:07               31453
class.reflectionenumbackedcase.php                 17-Jul-2024 20:07               12929
class.reflectionenumunitcase.php                   17-Jul-2024 20:07               12494
class.reflectionexception.php                      17-Jul-2024 20:07                8409
class.reflectionextension.php                      17-Jul-2024 20:07               10500
class.reflectionfiber.php                          17-Jul-2024 20:07                5264
class.reflectionfunction.php                       17-Jul-2024 20:07               21185
class.reflectionfunctionabstract.php               17-Jul-2024 20:07               19839
class.reflectiongenerator.php                      17-Jul-2024 20:07                6398
class.reflectionintersectiontype.php               17-Jul-2024 20:07                3436
class.reflectionmethod.php                         17-Jul-2024 20:07               32680
class.reflectionnamedtype.php                      17-Jul-2024 20:07                3764
class.reflectionobject.php                         17-Jul-2024 20:07               29252
class.reflectionparameter.php                      17-Jul-2024 20:07               16379
class.reflectionproperty.php                       17-Jul-2024 20:07               21941
class.reflectionreference.php                      17-Jul-2024 20:07                4112
class.reflectiontype.php                           17-Jul-2024 20:07                4462
class.reflectionuniontype.php                      17-Jul-2024 20:07                3323
class.reflectionzendextension.php                  17-Jul-2024 20:07                7842
class.reflector.php                                17-Jul-2024 20:07                3915
class.regexiterator.php                            17-Jul-2024 20:07               17598
class.resourcebundle.php                           17-Jul-2024 20:07               10431
class.returntypewillchange.php                     17-Jul-2024 20:07                3028
class.rnpffi.php                                   17-Jul-2024 20:07                1676
class.rrdcreator.php                               17-Jul-2024 20:07                4509
class.rrdgraph.php                                 17-Jul-2024 20:07                3931
class.rrdupdater.php                               17-Jul-2024 20:07                3317
class.runtimeexception.php                         17-Jul-2024 20:07                8469
class.seaslog.php                                  17-Jul-2024 20:07               21963
class.seekableiterator.php                         17-Jul-2024 20:07               11291
class.sensitiveparameter.php                       17-Jul-2024 20:07                6246
class.sensitiveparametervalue.php                  17-Jul-2024 20:07                4931
class.serializable.php                             17-Jul-2024 20:07                8050
class.sessionhandler.php                           17-Jul-2024 20:07               25274
class.sessionhandlerinterface.php                  17-Jul-2024 20:07               15503
class.sessionidinterface.php                       17-Jul-2024 20:07                3177
class.sessionupdatetimestamphandlerinterface.php   17-Jul-2024 20:07                4422
class.shmop.php                                    17-Jul-2024 20:07                1717
class.simdjsonexception.php                        17-Jul-2024 20:07                5045
class.simdjsonvalueerror.php                       17-Jul-2024 20:07                8341
class.simplexmlelement.php                         17-Jul-2024 20:07               18610
class.simplexmliterator.php                        17-Jul-2024 20:07               16635
class.snmp.php                                     17-Jul-2024 20:07               28284
class.snmpexception.php                            17-Jul-2024 20:07                9054
class.soapclient.php                               17-Jul-2024 20:07               34261
class.soapfault.php                                17-Jul-2024 20:07               14306
class.soapheader.php                               17-Jul-2024 20:07                6042
class.soapparam.php                                17-Jul-2024 20:07                3720
class.soapserver.php                               17-Jul-2024 20:07                9916
class.soapvar.php                                  17-Jul-2024 20:07                7854
class.socket.php                                   17-Jul-2024 20:07                1773
class.sodiumexception.php                          17-Jul-2024 20:07                8397
class.solrclient.php                               17-Jul-2024 20:07               24722
class.solrclientexception.php                      17-Jul-2024 20:07                9699
class.solrcollapsefunction.php                     17-Jul-2024 20:07               11782
class.solrdismaxquery.php                          17-Jul-2024 20:07              111877
class.solrdocument.php                             17-Jul-2024 20:07               23435
class.solrdocumentfield.php                        17-Jul-2024 20:07                4647
class.solrexception.php                            17-Jul-2024 20:07               10077
class.solrgenericresponse.php                      17-Jul-2024 20:07               12639
class.solrillegalargumentexception.php             17-Jul-2024 20:07                9823
class.solrillegaloperationexception.php            17-Jul-2024 20:07                9861
class.solrinputdocument.php                        17-Jul-2024 20:07               19474
class.solrmissingmandatoryparameterexception.php   17-Jul-2024 20:07                8992
class.solrmodifiableparams.php                     17-Jul-2024 20:07                8975
class.solrobject.php                               17-Jul-2024 20:07                5847
class.solrparams.php                               17-Jul-2024 20:07                9126
class.solrpingresponse.php                         17-Jul-2024 20:07               11108
class.solrquery.php                                17-Jul-2024 20:07              118978
class.solrqueryresponse.php                        17-Jul-2024 20:07               12558
class.solrresponse.php                             17-Jul-2024 20:07               14306
class.solrserverexception.php                      17-Jul-2024 20:07                9705
class.solrupdateresponse.php                       17-Jul-2024 20:07               12606
class.solrutils.php                                17-Jul-2024 20:07                4945
class.spldoublylinkedlist.php                      17-Jul-2024 20:07               17361
class.splfileinfo.php                              17-Jul-2024 20:07               18026
class.splfileobject.php                            17-Jul-2024 20:07               37287
class.splfixedarray.php                            17-Jul-2024 20:07               19857
class.splheap.php                                  17-Jul-2024 20:07                7757
class.splmaxheap.php                               17-Jul-2024 20:07                7192
class.splminheap.php                               17-Jul-2024 20:07                7202
class.splobjectstorage.php                         17-Jul-2024 20:07               21088
class.splobserver.php                              17-Jul-2024 20:07                2813
class.splpriorityqueue.php                         17-Jul-2024 20:07               11783
class.splqueue.php                                 17-Jul-2024 20:07               17115
class.splstack.php                                 17-Jul-2024 20:07               14335
class.splsubject.php                               17-Jul-2024 20:07                3682
class.spltempfileobject.php                        17-Jul-2024 20:07               31800
class.spoofchecker.php                             17-Jul-2024 20:07               17579
class.sqlite3.php                                  17-Jul-2024 20:07               39644
class.sqlite3exception.php                         17-Jul-2024 20:07                8397
class.sqlite3result.php                            17-Jul-2024 20:07                5793
class.sqlite3stmt.php                              17-Jul-2024 20:07                8262
class.stdclass.php                                 17-Jul-2024 20:07                6433
class.stomp.php                                    17-Jul-2024 20:07               21668
class.stompexception.php                           17-Jul-2024 20:07                5864
class.stompframe.php                               17-Jul-2024 20:07                4346
class.streamwrapper.php                            17-Jul-2024 20:07               20083
class.stringable.php                               17-Jul-2024 20:07                8059
class.svm.php                                      17-Jul-2024 20:07               18449
class.svmmodel.php                                 17-Jul-2024 20:07                6929
class.swoole-async.php                             17-Jul-2024 20:07                8021
class.swoole-atomic.php                            17-Jul-2024 20:07                5050
class.swoole-buffer.php                            17-Jul-2024 20:07                7505
class.swoole-channel.php                           17-Jul-2024 20:07                3948
class.swoole-client.php                            17-Jul-2024 20:07               16496
class.swoole-connection-iterator.php               17-Jul-2024 20:07                7501
class.swoole-coroutine.php                         17-Jul-2024 20:07               18637
class.swoole-event.php                             17-Jul-2024 20:07                7444
class.swoole-exception.php                         17-Jul-2024 20:07                4560
class.swoole-http-client.php                       17-Jul-2024 20:07               14755
class.swoole-http-request.php                      17-Jul-2024 20:07                3013
class.swoole-http-response.php                     17-Jul-2024 20:07               10889
class.swoole-http-server.php                       17-Jul-2024 20:07               26414
class.swoole-lock.php                              17-Jul-2024 20:07                4658
class.swoole-mmap.php                              17-Jul-2024 20:07                3059
class.swoole-mysql-exception.php                   17-Jul-2024 20:07                4601
class.swoole-mysql.php                             17-Jul-2024 20:07                5397
class.swoole-process.php                           17-Jul-2024 20:07               13638
class.swoole-redis-server.php                      17-Jul-2024 20:07               32038
class.swoole-serialize.php                         17-Jul-2024 20:07                3591
class.swoole-server.php                            17-Jul-2024 20:07               29556
class.swoole-table.php                             17-Jul-2024 20:07               12688
class.swoole-timer.php                             17-Jul-2024 20:07                4979
class.swoole-websocket-frame.php                   17-Jul-2024 20:07                1939
class.swoole-websocket-server.php                  17-Jul-2024 20:07                7807
class.syncevent.php                                17-Jul-2024 20:07                4877
class.syncmutex.php                                17-Jul-2024 20:07                4190
class.syncreaderwriter.php                         17-Jul-2024 20:07                5186
class.syncsemaphore.php                            17-Jul-2024 20:07                4634
class.syncsharedmemory.php                         17-Jul-2024 20:07                5484
class.sysvmessagequeue.php                         17-Jul-2024 20:07                1827
class.sysvsemaphore.php                            17-Jul-2024 20:07                1812
class.sysvsharedmemory.php                         17-Jul-2024 20:07                1815
class.thread.php                                   17-Jul-2024 20:07               11376
class.threaded.php                                 17-Jul-2024 20:07                8770
class.throwable.php                                17-Jul-2024 20:07                7100
class.tidy.php                                     17-Jul-2024 20:07               18842
class.tidynode.php                                 17-Jul-2024 20:07               11568
class.transliterator.php                           17-Jul-2024 20:07               10134
class.traversable.php                              17-Jul-2024 20:07                4138
class.typeerror.php                                17-Jul-2024 20:07                9273
class.uconverter.php                               17-Jul-2024 20:07               40997
class.ui-area.php                                  17-Jul-2024 20:07               12219
class.ui-control.php                               17-Jul-2024 20:07                5456
class.ui-controls-box.php                          17-Jul-2024 20:07               10076
class.ui-controls-button.php                       17-Jul-2024 20:07                6655
class.ui-controls-check.php                        17-Jul-2024 20:07                7499
class.ui-controls-colorbutton.php                  17-Jul-2024 20:07                6534
class.ui-controls-combo.php                        17-Jul-2024 20:07                6623
class.ui-controls-editablecombo.php                17-Jul-2024 20:07                6735
class.ui-controls-entry.php                        17-Jul-2024 20:07                9609
class.ui-controls-form.php                         17-Jul-2024 20:07                8013
class.ui-controls-grid.php                         17-Jul-2024 20:07               13107
class.ui-controls-group.php                        17-Jul-2024 20:07                8321
class.ui-controls-label.php                        17-Jul-2024 20:07                6406
class.ui-controls-multilineentry.php               17-Jul-2024 20:07                9852
class.ui-controls-picker.php                       17-Jul-2024 20:07                7541
class.ui-controls-progress.php                     17-Jul-2024 20:07                5907
class.ui-controls-radio.php                        17-Jul-2024 20:07                6602
class.ui-controls-separator.php                    17-Jul-2024 20:07                7045
class.ui-controls-slider.php                       17-Jul-2024 20:07                6990
class.ui-controls-spin.php                         17-Jul-2024 20:07                6860
class.ui-controls-tab.php                          17-Jul-2024 20:07                9119
class.ui-draw-brush-gradient.php                   17-Jul-2024 20:07                7315
class.ui-draw-brush-lineargradient.php             17-Jul-2024 20:07                6569
class.ui-draw-brush-radialgradient.php             17-Jul-2024 20:07                6755
class.ui-draw-brush.php                            17-Jul-2024 20:07                4416
class.ui-draw-color.php                            17-Jul-2024 20:07                8546
class.ui-draw-line-cap.php                         17-Jul-2024 20:07                3723
class.ui-draw-line-join.php                        17-Jul-2024 20:07                3707
class.ui-draw-matrix.php                           17-Jul-2024 20:07                5606
class.ui-draw-path.php                             17-Jul-2024 20:07               10734
class.ui-draw-pen.php                              17-Jul-2024 20:07                8113
class.ui-draw-stroke.php                           17-Jul-2024 20:07                6864
class.ui-draw-text-font-descriptor.php             17-Jul-2024 20:07                6026
class.ui-draw-text-font-italic.php                 17-Jul-2024 20:07                4082
class.ui-draw-text-font-stretch.php                17-Jul-2024 20:07                8278
class.ui-draw-text-font-weight.php                 17-Jul-2024 20:07                8880
class.ui-draw-text-font.php                        17-Jul-2024 20:07                4855
class.ui-draw-text-layout.php                      17-Jul-2024 20:07                5265
class.ui-exception-invalidargumentexception.php    17-Jul-2024 20:07                7782
class.ui-exception-runtimeexception.php            17-Jul-2024 20:07                7705
class.ui-executor.php                              17-Jul-2024 20:07                5416
class.ui-key.php                                   17-Jul-2024 20:07               21322
class.ui-menu.php                                  17-Jul-2024 20:07                6274
class.ui-menuitem.php                              17-Jul-2024 20:07                3744
class.ui-point.php                                 17-Jul-2024 20:07                6273
class.ui-size.php                                  17-Jul-2024 20:07                6375
class.ui-window.php                                17-Jul-2024 20:07               13063
class.underflowexception.php                       17-Jul-2024 20:07                8553
class.unexpectedvalueexception.php                 17-Jul-2024 20:07                8710
class.unhandledmatcherror.php                      17-Jul-2024 20:07                8563
class.unitenum.php                                 17-Jul-2024 20:07                2683
class.v8js.php                                     17-Jul-2024 20:07                9022
class.v8jsexception.php                            17-Jul-2024 20:07               11319
class.valueerror.php                               17-Jul-2024 20:07                8440
class.variant.php                                  17-Jul-2024 20:07                5663
class.varnishadmin.php                             17-Jul-2024 20:07               11516
class.varnishlog.php                               17-Jul-2024 20:07               34768
class.varnishstat.php                              17-Jul-2024 20:07                2993
class.volatile.php                                 17-Jul-2024 20:07               11740
class.vtiful-kernel-excel.php                      17-Jul-2024 20:07               12013
class.vtiful-kernel-format.php                     17-Jul-2024 20:07               16051
class.weakmap.php                                  17-Jul-2024 20:07                9174
class.weakreference.php                            17-Jul-2024 20:07                5472
class.win32serviceexception.php                    17-Jul-2024 20:07                7804
class.wkhtmltox-image-converter.php                17-Jul-2024 20:07                4143
class.wkhtmltox-pdf-converter.php                  17-Jul-2024 20:07                4461
class.wkhtmltox-pdf-object.php                     17-Jul-2024 20:07                2983
class.worker.php                                   17-Jul-2024 20:07                8616
class.xmldiff-base.php                             17-Jul-2024 20:07                4099
class.xmldiff-dom.php                              17-Jul-2024 20:07                5058
class.xmldiff-file.php                             17-Jul-2024 20:07                5034
class.xmldiff-memory.php                           17-Jul-2024 20:07                5066
class.xmlparser.php                                17-Jul-2024 20:07                1794
class.xmlreader.php                                17-Jul-2024 20:07               40771
class.xmlwriter.php                                17-Jul-2024 20:07               32361
class.xsltprocessor.php                            17-Jul-2024 20:07               11513
class.yac.php                                      17-Jul-2024 20:07                9526
class.yaconf.php                                   17-Jul-2024 20:07                3462
class.yaf-action-abstract.php                      17-Jul-2024 20:07               12657
class.yaf-application.php                          17-Jul-2024 20:07               12586
class.yaf-bootstrap-abstract.php                   17-Jul-2024 20:07                5519
class.yaf-config-abstract.php                      17-Jul-2024 20:07                5184
class.yaf-config-ini.php                           17-Jul-2024 20:07               17487
class.yaf-config-simple.php                        17-Jul-2024 20:07               13428
class.yaf-controller-abstract.php                  17-Jul-2024 20:07               19099
class.yaf-dispatcher.php                           17-Jul-2024 20:07               20237
class.yaf-exception-dispatchfailed.php             17-Jul-2024 20:07                2636
class.yaf-exception-loadfailed-action.php          17-Jul-2024 20:07                2707
class.yaf-exception-loadfailed-controller.php      17-Jul-2024 20:07                2732
class.yaf-exception-loadfailed-module.php          17-Jul-2024 20:07                2696
class.yaf-exception-loadfailed-view.php            17-Jul-2024 20:07                2636
class.yaf-exception-loadfailed.php                 17-Jul-2024 20:07                2610
class.yaf-exception-routerfailed.php               17-Jul-2024 20:07                2621
class.yaf-exception-startuperror.php               17-Jul-2024 20:07                2619
class.yaf-exception-typeerror.php                  17-Jul-2024 20:07                2590
class.yaf-exception.php                            17-Jul-2024 20:07                8466
class.yaf-loader.php                               17-Jul-2024 20:07               18541
class.yaf-plugin-abstract.php                      17-Jul-2024 20:07               15911
class.yaf-registry.php                             17-Jul-2024 20:07                6340
class.yaf-request-abstract.php                     17-Jul-2024 20:07               23643
class.yaf-request-http.php                         17-Jul-2024 20:07               23080
class.yaf-request-simple.php                       17-Jul-2024 20:07               22656
class.yaf-response-abstract.php                    17-Jul-2024 20:07               11813
class.yaf-route-interface.php                      17-Jul-2024 20:07                3782
class.yaf-route-map.php                            17-Jul-2024 20:07                6400
class.yaf-route-regex.php                          17-Jul-2024 20:07                8350
class.yaf-route-rewrite.php                        17-Jul-2024 20:07                7454
class.yaf-route-simple.php                         17-Jul-2024 20:07                6508
class.yaf-route-static.php                         17-Jul-2024 20:07                4971
class.yaf-route-supervar.php                       17-Jul-2024 20:07                4717
class.yaf-router.php                               17-Jul-2024 20:07               11766
class.yaf-session.php                              17-Jul-2024 20:07               12619
class.yaf-view-interface.php                       17-Jul-2024 20:07                6012
class.yaf-view-simple.php                          17-Jul-2024 20:07               11313
class.yar-client-exception.php                     17-Jul-2024 20:07                6598
class.yar-client.php                               17-Jul-2024 20:07                5826
class.yar-concurrent-client.php                    17-Jul-2024 20:07                6634
class.yar-server-exception.php                     17-Jul-2024 20:07                7053
class.yar-server.php                               17-Jul-2024 20:07                3471
class.ziparchive.php                               17-Jul-2024 20:07               89912
class.zmq.php                                      17-Jul-2024 20:07               41070
class.zmqcontext.php                               17-Jul-2024 20:07                5600
class.zmqdevice.php                                17-Jul-2024 20:07                7049
class.zmqpoll.php                                  17-Jul-2024 20:07                5185
class.zmqsocket.php                                17-Jul-2024 20:07               11462
class.zookeeper.php                                17-Jul-2024 20:07               56089
class.zookeeperauthenticationexception.php         17-Jul-2024 20:07                7712
class.zookeeperconfig.php                          17-Jul-2024 20:07                6436
class.zookeeperconnectionexception.php             17-Jul-2024 20:07                7707
class.zookeeperexception.php                       17-Jul-2024 20:07                7573
class.zookeepermarshallingexception.php            17-Jul-2024 20:07                7728
class.zookeepernonodeexception.php                 17-Jul-2024 20:07                7695
class.zookeeperoperationtimeoutexception.php       17-Jul-2024 20:07                7738
class.zookeepersessionexception.php                17-Jul-2024 20:07                7649
classobj.examples.php                              17-Jul-2024 20:07               13254
classobj.resources.php                             17-Jul-2024 20:07                1180
classobj.setup.php                                 17-Jul-2024 20:07                1392
closure.bind.php                                   17-Jul-2024 20:07                7775
closure.bindto.php                                 17-Jul-2024 20:07                9096
closure.call.php                                   17-Jul-2024 20:07                6229
closure.construct.php                              17-Jul-2024 20:07                2383
closure.fromcallable.php                           17-Jul-2024 20:07                3749
cmark.constants.php                                17-Jul-2024 20:07                4250
cmark.installation.php                             17-Jul-2024 20:07                1943
cmark.requirements.php                             17-Jul-2024 20:07                1287
cmark.setup.php                                    17-Jul-2024 20:07                1414
collator.asort.php                                 17-Jul-2024 20:07                9492
collator.compare.php                               17-Jul-2024 20:07               10456
collator.construct.php                             17-Jul-2024 20:07                5652
collator.create.php                                17-Jul-2024 20:07                5573
collator.getattribute.php                          17-Jul-2024 20:07                6072
collator.geterrorcode.php                          17-Jul-2024 20:07                5266
collator.geterrormessage.php                       17-Jul-2024 20:07                5337
collator.getlocale.php                             17-Jul-2024 20:07                6841
collator.getsortkey.php                            17-Jul-2024 20:07                6887
collator.getstrength.php                           17-Jul-2024 20:07                4878
collator.setattribute.php                          17-Jul-2024 20:07                6673
collator.setstrength.php                           17-Jul-2024 20:07               13239
collator.sort.php                                  17-Jul-2024 20:07                8302
collator.sortwithsortkeys.php                      17-Jul-2024 20:07                6517
collectable.isgarbage.php                          17-Jul-2024 20:07                3394
com.configuration.php                              17-Jul-2024 20:07                7284
com.constants.php                                  17-Jul-2024 20:07               26055
com.construct.php                                  17-Jul-2024 20:07                9501
com.error-handling.php                             17-Jul-2024 20:07                1619
com.examples.arrays.php                            17-Jul-2024 20:07                2111
com.examples.foreach.php                           17-Jul-2024 20:07                2914
com.examples.php                                   17-Jul-2024 20:07                1459
com.installation.php                               17-Jul-2024 20:07                1496
com.requirements.php                               17-Jul-2024 20:07                1247
com.resources.php                                  17-Jul-2024 20:07                1165
com.setup.php                                      17-Jul-2024 20:07                1529
commonmark-cql.construct.php                       17-Jul-2024 20:07                2227
commonmark-cql.invoke.php                          17-Jul-2024 20:07                3903
commonmark-interfaces-ivisitable.accept.php        17-Jul-2024 20:07                3139
commonmark-interfaces-ivisitor.enter.php           17-Jul-2024 20:07                4164
commonmark-interfaces-ivisitor.leave.php           17-Jul-2024 20:07                4166
commonmark-node-bulletlist.construct.php           17-Jul-2024 20:07                3158
commonmark-node-codeblock.construct.php            17-Jul-2024 20:07                2821
commonmark-node-heading.construct.php              17-Jul-2024 20:07                2599
commonmark-node-image.construct.php                17-Jul-2024 20:07                3264
commonmark-node-link.construct.php                 17-Jul-2024 20:07                3261
commonmark-node-orderedlist.construct.php          17-Jul-2024 20:07                4149
commonmark-node-text.construct.php                 17-Jul-2024 20:07                2649
commonmark-node.accept.php                         17-Jul-2024 20:07                2879
commonmark-node.appendchild.php                    17-Jul-2024 20:07                2685
commonmark-node.insertafter.php                    17-Jul-2024 20:07                2710
commonmark-node.insertbefore.php                   17-Jul-2024 20:07                2708
commonmark-node.prependchild.php                   17-Jul-2024 20:07                2712
commonmark-node.replace.php                        17-Jul-2024 20:07                2656
commonmark-node.unlink.php                         17-Jul-2024 20:07                2345
commonmark-parser.construct.php                    17-Jul-2024 20:07                3794
commonmark-parser.finish.php                       17-Jul-2024 20:07                2375
commonmark-parser.parse.php                        17-Jul-2024 20:07                2615
compersisthelper.construct.php                     17-Jul-2024 20:07                3634
compersisthelper.getcurfilename.php                17-Jul-2024 20:07                3134
compersisthelper.getmaxstreamsize.php              17-Jul-2024 20:07                3140
compersisthelper.initnew.php                       17-Jul-2024 20:07                3089
compersisthelper.loadfromfile.php                  17-Jul-2024 20:07                4314
compersisthelper.loadfromstream.php                17-Jul-2024 20:07                3531
compersisthelper.savetofile.php                    17-Jul-2024 20:07                6354
compersisthelper.savetostream.php                  17-Jul-2024 20:07                3558
componere-abstract-definition.addinterface.php     17-Jul-2024 20:07                3271
componere-abstract-definition.addmethod.php        17-Jul-2024 20:07                3997
componere-abstract-definition.addtrait.php         17-Jul-2024 20:07                3223
componere-abstract-definition.getreflector.php     17-Jul-2024 20:07                2409
componere-definition.addconstant.php               17-Jul-2024 20:07                4320
componere-definition.addproperty.php               17-Jul-2024 20:07                3729
componere-definition.construct.php                 17-Jul-2024 20:07                5966
componere-definition.getclosure.php                17-Jul-2024 20:07                3435
componere-definition.getclosures.php               17-Jul-2024 20:07                2691
componere-definition.isregistered.php              17-Jul-2024 20:07                2291
componere-definition.register.php                  17-Jul-2024 20:07                2444
componere-method.construct.php                     17-Jul-2024 20:07                2223
componere-method.getreflector.php                  17-Jul-2024 20:07                2212
componere-method.setprivate.php                    17-Jul-2024 20:07                2440
componere-method.setprotected.php                  17-Jul-2024 20:07                2455
componere-method.setstatic.php                     17-Jul-2024 20:07                2037
componere-patch.apply.php                          17-Jul-2024 20:07                1902
componere-patch.construct.php                      17-Jul-2024 20:07                3635
componere-patch.derive.php                         17-Jul-2024 20:07                3128
componere-patch.getclosure.php                     17-Jul-2024 20:07                3065
componere-patch.getclosures.php                    17-Jul-2024 20:07                2212
componere-patch.isapplied.php                      17-Jul-2024 20:07                1856
componere-patch.revert.php                         17-Jul-2024 20:07                1899
componere-value.construct.php                      17-Jul-2024 20:07                2656
componere-value.hasdefault.php                     17-Jul-2024 20:07                1900
componere-value.isprivate.php                      17-Jul-2024 20:07                1921
componere-value.isprotected.php                    17-Jul-2024 20:07                1931
componere-value.isstatic.php                       17-Jul-2024 20:07                1915
componere-value.setprivate.php                     17-Jul-2024 20:07                2463
componere-value.setprotected.php                   17-Jul-2024 20:07                2477
componere-value.setstatic.php                      17-Jul-2024 20:07                2054
componere.cast.php                                 17-Jul-2024 20:07                4883
componere.cast_by_ref.php                          17-Jul-2024 20:07                5056
componere.installation.php                         17-Jul-2024 20:07                1341
componere.requirements.php                         17-Jul-2024 20:07                1177
componere.setup.php                                17-Jul-2024 20:07                1453
configuration.changes.modes.php                    17-Jul-2024 20:07                3861
configuration.changes.php                          17-Jul-2024 20:07                7761
configuration.file.per-user.php                    17-Jul-2024 20:07                2886
configuration.file.php                             17-Jul-2024 20:07                9603
configuration.php                                  17-Jul-2024 20:07                1618
configure.about.php                                17-Jul-2024 20:07               11710
configure.php                                      17-Jul-2024 20:07                1400
context.ftp.php                                    17-Jul-2024 20:07                4100
context.http.php                                   17-Jul-2024 20:07               15563
context.params.php                                 17-Jul-2024 20:07                2505
context.phar.php                                   17-Jul-2024 20:07                2854
context.php                                        17-Jul-2024 20:07                2856
context.socket.php                                 17-Jul-2024 20:07                9108
context.ssl.php                                    17-Jul-2024 20:07               12668
context.zip.php                                    17-Jul-2024 20:07                4162
context.zlib.php                                   17-Jul-2024 20:07                2430
control-structures.alternative-syntax.php          17-Jul-2024 20:07                6606
control-structures.break.php                       17-Jul-2024 20:07                4535
control-structures.continue.php                    17-Jul-2024 20:07                7751
control-structures.declare.php                     17-Jul-2024 20:07                9718
control-structures.do.while.php                    17-Jul-2024 20:07                4808
control-structures.else.php                        17-Jul-2024 20:07                4538
control-structures.elseif.php                      17-Jul-2024 20:07                7420
control-structures.for.php                         17-Jul-2024 20:07               11343
control-structures.foreach.php                     17-Jul-2024 20:07               20333
control-structures.goto.php                        17-Jul-2024 20:07                6885
control-structures.if.php                          17-Jul-2024 20:07                4554
control-structures.intro.php                       17-Jul-2024 20:07                2343
control-structures.match.php                       17-Jul-2024 20:07               19577
control-structures.switch.php                      17-Jul-2024 20:07               16485
control-structures.while.php                       17-Jul-2024 20:07                4221
copyright.php                                      17-Jul-2024 20:07                1892
countable.count.php                                17-Jul-2024 20:07                5372
ctype.installation.php                             17-Jul-2024 20:07                1389
ctype.requirements.php                             17-Jul-2024 20:07                1193
ctype.resources.php                                17-Jul-2024 20:07                1160
ctype.setup.php                                    17-Jul-2024 20:07                1475
cubrid.configuration.php                           17-Jul-2024 20:07                1176
cubrid.constants.php                               17-Jul-2024 20:07               13770
cubrid.examples.php                                17-Jul-2024 20:07               13753
cubrid.installation.php                            17-Jul-2024 20:07                1959
cubrid.requirements.php                            17-Jul-2024 20:07                1224
cubrid.resources.php                               17-Jul-2024 20:07                3039
cubrid.setup.php                                   17-Jul-2024 20:07                1552
cubridmysql.cubrid.php                             17-Jul-2024 20:07                4939
curl.configuration.php                             17-Jul-2024 20:07                2435
curl.constants.php                                 17-Jul-2024 20:07              200573
curl.examples-basic.php                            17-Jul-2024 20:07                4495
curl.examples.php                                  17-Jul-2024 20:07                1380
curl.installation.php                              17-Jul-2024 20:07                2449
curl.requirements.php                              17-Jul-2024 20:07                1412
curl.resources.php                                 17-Jul-2024 20:07                1351
curl.setup.php                                     17-Jul-2024 20:07                1550
curlfile.construct.php                             17-Jul-2024 20:07               21106
curlfile.getfilename.php                           17-Jul-2024 20:07                2138
curlfile.getmimetype.php                           17-Jul-2024 20:07                2150
curlfile.getpostfilename.php                       17-Jul-2024 20:07                2212
curlfile.setmimetype.php                           17-Jul-2024 20:07                2435
curlfile.setpostfilename.php                       17-Jul-2024 20:07                2487
curlstringfile.construct.php                       17-Jul-2024 20:07                6936
dateinterval.construct.php                         17-Jul-2024 20:07               13373
dateinterval.createfromdatestring.php              17-Jul-2024 20:07               15520
dateinterval.format.php                            17-Jul-2024 20:07               14537
dateperiod.construct.php                           17-Jul-2024 20:07               19740
dateperiod.createfromiso8601string.php             17-Jul-2024 20:07                7860
dateperiod.getdateinterval.php                     17-Jul-2024 20:07                4740
dateperiod.getenddate.php                          17-Jul-2024 20:07                7684
dateperiod.getrecurrences.php                      17-Jul-2024 20:07                8837
dateperiod.getstartdate.php                        17-Jul-2024 20:07                5205
datetime.add.php                                   17-Jul-2024 20:07                4798
datetime.configuration.php                         17-Jul-2024 20:07                5843
datetime.constants.php                             17-Jul-2024 20:07                2900
datetime.construct.php                             17-Jul-2024 20:07                6271
datetime.createfromformat.php                      17-Jul-2024 20:07                7217
datetime.createfromimmutable.php                   17-Jul-2024 20:07                4850
datetime.createfrominterface.php                   17-Jul-2024 20:07                4843
datetime.diff.php                                  17-Jul-2024 20:07               16935
datetime.error.tree.php                            17-Jul-2024 20:07                3333
datetime.examples-arithmetic.php                   17-Jul-2024 20:07               14967
datetime.examples.php                              17-Jul-2024 20:07                1440
datetime.format.php                                17-Jul-2024 20:07               25795
datetime.formats.php                               17-Jul-2024 20:07               55184
datetime.getlasterrors.php                         17-Jul-2024 20:07                1883
datetime.getoffset.php                             17-Jul-2024 20:07                7832
datetime.gettimestamp.php                          17-Jul-2024 20:07               10026
datetime.gettimezone.php                           17-Jul-2024 20:07                7736
datetime.installation.php                          17-Jul-2024 20:07                1559
datetime.modify.php                                17-Jul-2024 20:07               14097
datetime.resources.php                             17-Jul-2024 20:07                1200
datetime.set-state.php                             17-Jul-2024 20:07                2854
datetime.setdate.php                               17-Jul-2024 20:07                5439
datetime.setisodate.php                            17-Jul-2024 20:07                5645
datetime.settime.php                               17-Jul-2024 20:07                6958
datetime.settimestamp.php                          17-Jul-2024 20:07                4915
datetime.settimezone.php                           17-Jul-2024 20:07                9183
datetime.setup.php                                 17-Jul-2024 20:07                1545
datetime.sub.php                                   17-Jul-2024 20:07                6067
datetime.wakeup.php                                17-Jul-2024 20:07                3020
datetimeimmutable.add.php                          17-Jul-2024 20:07               10470
datetimeimmutable.construct.php                    17-Jul-2024 20:07               18339
datetimeimmutable.createfromformat.php             17-Jul-2024 20:07               46930
datetimeimmutable.createfrominterface.php          17-Jul-2024 20:07                5107
datetimeimmutable.createfrommutable.php            17-Jul-2024 20:07                5007
datetimeimmutable.getlasterrors.php                17-Jul-2024 20:07                5579
datetimeimmutable.modify.php                       17-Jul-2024 20:07                9240
datetimeimmutable.set-state.php                    17-Jul-2024 20:07                2773
datetimeimmutable.setdate.php                      17-Jul-2024 20:07                9103
datetimeimmutable.setisodate.php                   17-Jul-2024 20:07               12698
datetimeimmutable.settime.php                      17-Jul-2024 20:07               11902
datetimeimmutable.settimestamp.php                 17-Jul-2024 20:07                5736
datetimeimmutable.settimezone.php                  17-Jul-2024 20:07                5932
datetimeimmutable.sub.php                          17-Jul-2024 20:07               11893
datetimezone.construct.php                         17-Jul-2024 20:07               10453
datetimezone.getlocation.php                       17-Jul-2024 20:07                5814
datetimezone.getname.php                           17-Jul-2024 20:07                3528
datetimezone.getoffset.php                         17-Jul-2024 20:07                6965
datetimezone.gettransitions.php                    17-Jul-2024 20:07               12083
datetimezone.listabbreviations.php                 17-Jul-2024 20:07                5901
datetimezone.listidentifiers.php                   17-Jul-2024 20:07               14518
dba.configuration.php                              17-Jul-2024 20:07                2228
dba.constants.php                                  17-Jul-2024 20:07                2097
dba.example.php                                    17-Jul-2024 20:07                6216
dba.examples.php                                   17-Jul-2024 20:07                1343
dba.installation.php                               17-Jul-2024 20:07                9422
dba.requirements.php                               17-Jul-2024 20:07                7253
dba.resources.php                                  17-Jul-2024 20:07                1453
dba.setup.php                                      17-Jul-2024 20:07                1532
dbase.constants.php                                17-Jul-2024 20:07                3587
dbase.installation.php                             17-Jul-2024 20:07                1510
dbase.resources.php                                17-Jul-2024 20:07                1455
dbase.setup.php                                    17-Jul-2024 20:07                1425
debugger-about.php                                 17-Jul-2024 20:07                1497
debugger.php                                       17-Jul-2024 20:07                1393
dio.constants.php                                  17-Jul-2024 20:07               10948
dio.installation.php                               17-Jul-2024 20:07                1882
dio.resources.php                                  17-Jul-2024 20:07                1286
dio.setup.php                                      17-Jul-2024 20:07                1409
dir.constants.php                                  17-Jul-2024 20:07                2797
dir.resources.php                                  17-Jul-2024 20:07                1155
dir.setup.php                                      17-Jul-2024 20:07                1346
directory.close.php                                17-Jul-2024 20:07                2183
directory.read.php                                 17-Jul-2024 20:07                2319
directory.rewind.php                               17-Jul-2024 20:07                2193
directoryiterator.construct.php                    17-Jul-2024 20:07                5789
directoryiterator.current.php                      17-Jul-2024 20:07                6040
directoryiterator.getbasename.php                  17-Jul-2024 20:07                6324
directoryiterator.getextension.php                 17-Jul-2024 20:07                6073
directoryiterator.getfilename.php                  17-Jul-2024 20:07                5061
directoryiterator.isdot.php                        17-Jul-2024 20:07                5274
directoryiterator.key.php                          17-Jul-2024 20:07                6481
directoryiterator.next.php                         17-Jul-2024 20:07                5391
directoryiterator.rewind.php                       17-Jul-2024 20:07                5324
directoryiterator.seek.php                         17-Jul-2024 20:07                5286
directoryiterator.tostring.php                     17-Jul-2024 20:07                4593
directoryiterator.valid.php                        17-Jul-2024 20:07                5730
doc.changelog.php                                  17-Jul-2024 20:07                1284
dom.constants.php                                  17-Jul-2024 20:07               19878
dom.examples.php                                   17-Jul-2024 20:07                2981
dom.installation.php                               17-Jul-2024 20:07                1241
dom.requirements.php                               17-Jul-2024 20:07                1429
dom.resources.php                                  17-Jul-2024 20:07                1155
dom.setup.php                                      17-Jul-2024 20:07                1455
domattr.construct.php                              17-Jul-2024 20:07                5568
domattr.isid.php                                   17-Jul-2024 20:07                5010
domcdatasection.construct.php                      17-Jul-2024 20:07                5175
domcharacterdata.after.php                         17-Jul-2024 20:07                7728
domcharacterdata.appenddata.php                    17-Jul-2024 20:07                4364
domcharacterdata.before.php                        17-Jul-2024 20:07                7357
domcharacterdata.deletedata.php                    17-Jul-2024 20:07                5053
domcharacterdata.insertdata.php                    17-Jul-2024 20:07                4777
domcharacterdata.remove.php                        17-Jul-2024 20:07                5382
domcharacterdata.replacedata.php                   17-Jul-2024 20:07                5445
domcharacterdata.replacewith.php                   17-Jul-2024 20:07                7818
domcharacterdata.substringdata.php                 17-Jul-2024 20:07                4900
domchildnode.after.php                             17-Jul-2024 20:07                5629
domchildnode.before.php                            17-Jul-2024 20:07                5055
domchildnode.remove.php                            17-Jul-2024 20:07                3071
domchildnode.replacewith.php                       17-Jul-2024 20:07                5247
domcomment.construct.php                           17-Jul-2024 20:07                4990
domdocument.adoptnode.php                          17-Jul-2024 20:07                6705
domdocument.append.php                             17-Jul-2024 20:07                6775
domdocument.construct.php                          17-Jul-2024 20:07                4378
domdocument.createattribute.php                    17-Jul-2024 20:07                5802
domdocument.createattributens.php                  17-Jul-2024 20:07                8109
domdocument.createcdatasection.php                 17-Jul-2024 20:07                5415
domdocument.createcomment.php                      17-Jul-2024 20:07                5786
domdocument.createdocumentfragment.php             17-Jul-2024 20:07                5606
domdocument.createelement.php                      17-Jul-2024 20:07               11228
domdocument.createelementns.php                    17-Jul-2024 20:07               13956
domdocument.createentityreference.php              17-Jul-2024 20:07                6119
domdocument.createprocessinginstruction.php        17-Jul-2024 20:07                6439
domdocument.createtextnode.php                     17-Jul-2024 20:07                5774
domdocument.getelementbyid.php                     17-Jul-2024 20:07                7638
domdocument.getelementsbytagname.php               17-Jul-2024 20:07                6051
domdocument.getelementsbytagnamens.php             17-Jul-2024 20:07                7648
domdocument.importnode.php                         17-Jul-2024 20:07                8914
domdocument.load.php                               17-Jul-2024 20:07                6581
domdocument.loadhtml.php                           17-Jul-2024 20:07                7721
domdocument.loadhtmlfile.php                       17-Jul-2024 20:07                7840
domdocument.loadxml.php                            17-Jul-2024 20:07                6296
domdocument.normalizedocument.php                  17-Jul-2024 20:07                2932
domdocument.prepend.php                            17-Jul-2024 20:07                6868
domdocument.registernodeclass.php                  17-Jul-2024 20:07               20780
domdocument.relaxngvalidate.php                    17-Jul-2024 20:07                4012
domdocument.relaxngvalidatesource.php              17-Jul-2024 20:07                4067
domdocument.replacechildren.php                    17-Jul-2024 20:07                7173
domdocument.save.php                               17-Jul-2024 20:07                7586
domdocument.savehtml.php                           17-Jul-2024 20:07                7521
domdocument.savehtmlfile.php                       17-Jul-2024 20:07                7962
domdocument.savexml.php                            17-Jul-2024 20:07                9687
domdocument.schemavalidate.php                     17-Jul-2024 20:07                4398
domdocument.schemavalidatesource.php               17-Jul-2024 20:07                4460
domdocument.validate.php                           17-Jul-2024 20:07                6032
domdocument.xinclude.php                           17-Jul-2024 20:07                7137
domdocumentfragment.append.php                     17-Jul-2024 20:07                7473
domdocumentfragment.appendxml.php                  17-Jul-2024 20:07                5546
domdocumentfragment.construct.php                  17-Jul-2024 20:07                2130
domdocumentfragment.prepend.php                    17-Jul-2024 20:07                7532
domdocumentfragment.replacechildren.php            17-Jul-2024 20:07                7925
domelement.after.php                               17-Jul-2024 20:07                7400
domelement.append.php                              17-Jul-2024 20:07                7086
domelement.before.php                              17-Jul-2024 20:07                6986
domelement.construct.php                           17-Jul-2024 20:07                6666
domelement.getattribute.php                        17-Jul-2024 20:07                3526
domelement.getattributenames.php                   17-Jul-2024 20:07                3942
domelement.getattributenode.php                    17-Jul-2024 20:07                4075
domelement.getattributenodens.php                  17-Jul-2024 20:07                4565
domelement.getattributens.php                      17-Jul-2024 20:07                4068
domelement.getelementsbytagname.php                17-Jul-2024 20:07                3633
domelement.getelementsbytagnamens.php              17-Jul-2024 20:07                4712
domelement.hasattribute.php                        17-Jul-2024 20:07                3816
domelement.hasattributens.php                      17-Jul-2024 20:07                4288
domelement.insertadjacentelement.php               17-Jul-2024 20:07                6627
domelement.insertadjacenttext.php                  17-Jul-2024 20:07                6434
domelement.prepend.php                             17-Jul-2024 20:07                7137
domelement.remove.php                              17-Jul-2024 20:07                5019
domelement.removeattribute.php                     17-Jul-2024 20:07                4030
domelement.removeattributenode.php                 17-Jul-2024 20:07                4441
domelement.removeattributens.php                   17-Jul-2024 20:07                4307
domelement.replacechildren.php                     17-Jul-2024 20:07                7736
domelement.replacewith.php                         17-Jul-2024 20:07                7796
domelement.setattribute.php                        17-Jul-2024 20:07                6193
domelement.setattributenode.php                    17-Jul-2024 20:07                4737
domelement.setattributenodens.php                  17-Jul-2024 20:07                4804
domelement.setattributens.php                      17-Jul-2024 20:07                5236
domelement.setidattribute.php                      17-Jul-2024 20:07                4825
domelement.setidattributenode.php                  17-Jul-2024 20:07                4819
domelement.setidattributens.php                    17-Jul-2024 20:07                5277
domelement.toggleattribute.php                     17-Jul-2024 20:07                6411
domentityreference.construct.php                   17-Jul-2024 20:07                4832
domimplementation.construct.php                    17-Jul-2024 20:07                2140
domimplementation.createdocument.php               17-Jul-2024 20:07                7333
domimplementation.createdocumenttype.php           17-Jul-2024 20:07                9842
domimplementation.hasfeature.php                   17-Jul-2024 20:07                9258
domnamednodemap.count.php                          17-Jul-2024 20:07                2410
domnamednodemap.getiterator.php                    17-Jul-2024 20:07                3163
domnamednodemap.getnameditem.php                   17-Jul-2024 20:07                3454
domnamednodemap.getnameditemns.php                 17-Jul-2024 20:07                3906
domnamednodemap.item.php                           17-Jul-2024 20:07                3061
domnode.appendchild.php                            17-Jul-2024 20:07                8710
domnode.c14n.php                                   17-Jul-2024 20:07                7939
domnode.c14nfile.php                               17-Jul-2024 20:07                5695
domnode.clonenode.php                              17-Jul-2024 20:07                2834
domnode.contains.php                               17-Jul-2024 20:07                5346
domnode.getlineno.php                              17-Jul-2024 20:07                4848
domnode.getnodepath.php                            17-Jul-2024 20:07                5195
domnode.getrootnode.php                            17-Jul-2024 20:07                4389
domnode.hasattributes.php                          17-Jul-2024 20:07                2937
domnode.haschildnodes.php                          17-Jul-2024 20:07                2801
domnode.insertbefore.php                           17-Jul-2024 20:07                5457
domnode.isdefaultnamespace.php                     17-Jul-2024 20:07                2922
domnode.isequalnode.php                            17-Jul-2024 20:07                4685
domnode.issamenode.php                             17-Jul-2024 20:07                2779
domnode.issupported.php                            17-Jul-2024 20:07                3800
domnode.lookupnamespaceuri.php                     17-Jul-2024 20:07                3571
domnode.lookupprefix.php                           17-Jul-2024 20:07                3209
domnode.normalize.php                              17-Jul-2024 20:07                2778
domnode.removechild.php                            17-Jul-2024 20:07                7014
domnode.replacechild.php                           17-Jul-2024 20:07                5705
domnodelist.count.php                              17-Jul-2024 20:07                2339
domnodelist.getiterator.php                        17-Jul-2024 20:07                3066
domnodelist.item.php                               17-Jul-2024 20:07                6966
domparentnode.append.php                           17-Jul-2024 20:07                4731
domparentnode.prepend.php                          17-Jul-2024 20:07                4771
domparentnode.replacechildren.php                  17-Jul-2024 20:07                6582
domprocessinginstruction.construct.php             17-Jul-2024 20:07                6671
domtext.construct.php                              17-Jul-2024 20:07                4788
domtext.iselementcontentwhitespace.php             17-Jul-2024 20:07                2622
domtext.iswhitespaceinelementcontent.php           17-Jul-2024 20:07                2825
domtext.splittext.php                              17-Jul-2024 20:07                3230
domxpath.construct.php                             17-Jul-2024 20:07                3497
domxpath.evaluate.php                              17-Jul-2024 20:07                7882
domxpath.query.php                                 17-Jul-2024 20:07               12347
domxpath.registernamespace.php                     17-Jul-2024 20:07                3297
domxpath.registerphpfunctions.php                  17-Jul-2024 20:07               13736
dotnet.construct.php                               17-Jul-2024 20:07                3118
ds-collection.clear.php                            17-Jul-2024 20:07                3878
ds-collection.copy.php                             17-Jul-2024 20:07                4291
ds-collection.isempty.php                          17-Jul-2024 20:07                4219
ds-collection.toarray.php                          17-Jul-2024 20:07                4210
ds-deque.allocate.php                              17-Jul-2024 20:07                4645
ds-deque.apply.php                                 17-Jul-2024 20:07                4941
ds-deque.capacity.php                              17-Jul-2024 20:07                3918
ds-deque.clear.php                                 17-Jul-2024 20:07                3795
ds-deque.construct.php                             17-Jul-2024 20:07                4304
ds-deque.contains.php                              17-Jul-2024 20:07                7067
ds-deque.copy.php                                  17-Jul-2024 20:07                4157
ds-deque.count.php                                 17-Jul-2024 20:07                1620
ds-deque.filter.php                                17-Jul-2024 20:07                7586
ds-deque.find.php                                  17-Jul-2024 20:07                5406
ds-deque.first.php                                 17-Jul-2024 20:07                3725
ds-deque.get.php                                   17-Jul-2024 20:07                6559
ds-deque.insert.php                                17-Jul-2024 20:07                6638
ds-deque.isempty.php                               17-Jul-2024 20:07                4105
ds-deque.join.php                                  17-Jul-2024 20:07                5711
ds-deque.jsonserialize.php                         17-Jul-2024 20:07                1876
ds-deque.last.php                                  17-Jul-2024 20:07                3713
ds-deque.map.php                                   17-Jul-2024 20:07                5302
ds-deque.merge.php                                 17-Jul-2024 20:07                4852
ds-deque.pop.php                                   17-Jul-2024 20:07                4210
ds-deque.push.php                                  17-Jul-2024 20:07                4645
ds-deque.reduce.php                                17-Jul-2024 20:07                7957
ds-deque.remove.php                                17-Jul-2024 20:07                4846
ds-deque.reverse.php                               17-Jul-2024 20:07                3631
ds-deque.reversed.php                              17-Jul-2024 20:07                3984
ds-deque.rotate.php                                17-Jul-2024 20:07                5031
ds-deque.set.php                                   17-Jul-2024 20:07                6026
ds-deque.shift.php                                 17-Jul-2024 20:07                4311
ds-deque.slice.php                                 17-Jul-2024 20:07                7128
ds-deque.sort.php                                  17-Jul-2024 20:07                7279
ds-deque.sorted.php                                17-Jul-2024 20:07                7306
ds-deque.sum.php                                   17-Jul-2024 20:07                5223
ds-deque.toarray.php                               17-Jul-2024 20:07                4096
ds-deque.unshift.php                               17-Jul-2024 20:07                4726
ds-hashable.equals.php                             17-Jul-2024 20:07                3689
ds-hashable.hash.php                               17-Jul-2024 20:07                7449
ds-map.allocate.php                                17-Jul-2024 20:07                4511
ds-map.apply.php                                   17-Jul-2024 20:07                5637
ds-map.capacity.php                                17-Jul-2024 20:07                3208
ds-map.clear.php                                   17-Jul-2024 20:07                4271
ds-map.construct.php                               17-Jul-2024 20:07                4806
ds-map.copy.php                                    17-Jul-2024 20:07                4017
ds-map.count.php                                   17-Jul-2024 20:07                1581
ds-map.diff.php                                    17-Jul-2024 20:07                5424
ds-map.filter.php                                  17-Jul-2024 20:07                8370
ds-map.first.php                                   17-Jul-2024 20:07                4024
ds-map.get.php                                     17-Jul-2024 20:07                8383
ds-map.haskey.php                                  17-Jul-2024 20:07                4663
ds-map.hasvalue.php                                17-Jul-2024 20:07                4707
ds-map.intersect.php                               17-Jul-2024 20:07                5947
ds-map.isempty.php                                 17-Jul-2024 20:07                4327
ds-map.jsonserialize.php                           17-Jul-2024 20:07                1854
ds-map.keys.php                                    17-Jul-2024 20:07                3918
ds-map.ksort.php                                   17-Jul-2024 20:07                7966
ds-map.ksorted.php                                 17-Jul-2024 20:07                8055
ds-map.last.php                                    17-Jul-2024 20:07                4009
ds-map.map.php                                     17-Jul-2024 20:07                6283
ds-map.merge.php                                   17-Jul-2024 20:07                5834
ds-map.pairs.php                                   17-Jul-2024 20:07                4333
ds-map.put.php                                     17-Jul-2024 20:07               13905
ds-map.putall.php                                  17-Jul-2024 20:07                5512
ds-map.reduce.php                                  17-Jul-2024 20:07                8892
ds-map.remove.php                                  17-Jul-2024 20:07                6945
ds-map.reverse.php                                 17-Jul-2024 20:07                4083
ds-map.reversed.php                                17-Jul-2024 20:07                4194
ds-map.skip.php                                    17-Jul-2024 20:07                4596
ds-map.slice.php                                   17-Jul-2024 20:07                7980
ds-map.sort.php                                    17-Jul-2024 20:07                7889
ds-map.sorted.php                                  17-Jul-2024 20:07                8034
ds-map.sum.php                                     17-Jul-2024 20:07                5690
ds-map.toarray.php                                 17-Jul-2024 20:07                5091
ds-map.union.php                                   17-Jul-2024 20:07                5931
ds-map.values.php                                  17-Jul-2024 20:07                3917
ds-map.xor.php                                     17-Jul-2024 20:07                5490
ds-pair.clear.php                                  17-Jul-2024 20:07                3700
ds-pair.construct.php                              17-Jul-2024 20:07                2594
ds-pair.copy.php                                   17-Jul-2024 20:07                4071
ds-pair.isempty.php                                17-Jul-2024 20:07                4055
ds-pair.jsonserialize.php                          17-Jul-2024 20:07                1874
ds-pair.toarray.php                                17-Jul-2024 20:07                4030
ds-priorityqueue.allocate.php                      17-Jul-2024 20:07                4811
ds-priorityqueue.capacity.php                      17-Jul-2024 20:07                3417
ds-priorityqueue.clear.php                         17-Jul-2024 20:07                4452
ds-priorityqueue.construct.php                     17-Jul-2024 20:07                2916
ds-priorityqueue.copy.php                          17-Jul-2024 20:07                4460
ds-priorityqueue.count.php                         17-Jul-2024 20:07                1729
ds-priorityqueue.isempty.php                       17-Jul-2024 20:07                5015
ds-priorityqueue.jsonserialize.php                 17-Jul-2024 20:07                1994
ds-priorityqueue.peek.php                          17-Jul-2024 20:07                4703
ds-priorityqueue.pop.php                           17-Jul-2024 20:07                5475
ds-priorityqueue.push.php                          17-Jul-2024 20:07                5571
ds-priorityqueue.toarray.php                       17-Jul-2024 20:07                5197
ds-queue.allocate.php                              17-Jul-2024 20:07                4840
ds-queue.capacity.php                              17-Jul-2024 20:07                3924
ds-queue.clear.php                                 17-Jul-2024 20:07                3780
ds-queue.construct.php                             17-Jul-2024 20:07                4302
ds-queue.copy.php                                  17-Jul-2024 20:07                4259
ds-queue.count.php                                 17-Jul-2024 20:07                1617
ds-queue.isempty.php                               17-Jul-2024 20:07                4121
ds-queue.jsonserialize.php                         17-Jul-2024 20:07                1882
ds-queue.peek.php                                  17-Jul-2024 20:07                4307
ds-queue.pop.php                                   17-Jul-2024 20:07                4841
ds-queue.push.php                                  17-Jul-2024 20:07                4680
ds-queue.toarray.php                               17-Jul-2024 20:07                4262
ds-sequence.allocate.php                           17-Jul-2024 20:07                4547
ds-sequence.apply.php                              17-Jul-2024 20:07                5056
ds-sequence.capacity.php                           17-Jul-2024 20:07                4473
ds-sequence.contains.php                           17-Jul-2024 20:07                7194
ds-sequence.filter.php                             17-Jul-2024 20:07                7725
ds-sequence.find.php                               17-Jul-2024 20:07                5518
ds-sequence.first.php                              17-Jul-2024 20:07                3840
ds-sequence.get.php                                17-Jul-2024 20:07                6687
ds-sequence.insert.php                             17-Jul-2024 20:07                6757
ds-sequence.join.php                               17-Jul-2024 20:07                5807
ds-sequence.last.php                               17-Jul-2024 20:07                3807
ds-sequence.map.php                                17-Jul-2024 20:07                5431
ds-sequence.merge.php                              17-Jul-2024 20:07                4978
ds-sequence.pop.php                                17-Jul-2024 20:07                4322
ds-sequence.push.php                               17-Jul-2024 20:07                4767
ds-sequence.reduce.php                             17-Jul-2024 20:07                8076
ds-sequence.remove.php                             17-Jul-2024 20:07                4958
ds-sequence.reverse.php                            17-Jul-2024 20:07                3744
ds-sequence.reversed.php                           17-Jul-2024 20:07                4107
ds-sequence.rotate.php                             17-Jul-2024 20:07                5168
ds-sequence.set.php                                17-Jul-2024 20:07                6150
ds-sequence.shift.php                              17-Jul-2024 20:07                4423
ds-sequence.slice.php                              17-Jul-2024 20:07                7293
ds-sequence.sort.php                               17-Jul-2024 20:07                7406
ds-sequence.sorted.php                             17-Jul-2024 20:07                7433
ds-sequence.sum.php                                17-Jul-2024 20:07                5348
ds-sequence.unshift.php                            17-Jul-2024 20:07                4837
ds-set.add.php                                     17-Jul-2024 20:07               12136
ds-set.allocate.php                                17-Jul-2024 20:07                4520
ds-set.capacity.php                                17-Jul-2024 20:07                3876
ds-set.clear.php                                   17-Jul-2024 20:07                3726
ds-set.construct.php                               17-Jul-2024 20:07                4256
ds-set.contains.php                                17-Jul-2024 20:07                7261
ds-set.copy.php                                    17-Jul-2024 20:07                4198
ds-set.count.php                                   17-Jul-2024 20:07                1581
ds-set.diff.php                                    17-Jul-2024 20:07                4714
ds-set.filter.php                                  17-Jul-2024 20:07                7534
ds-set.first.php                                   17-Jul-2024 20:07                3678
ds-set.get.php                                     17-Jul-2024 20:07                6503
ds-set.intersect.php                               17-Jul-2024 20:07                4945
ds-set.isempty.php                                 17-Jul-2024 20:07                4063
ds-set.join.php                                    17-Jul-2024 20:07                5657
ds-set.jsonserialize.php                           17-Jul-2024 20:07                1848
ds-set.last.php                                    17-Jul-2024 20:07                3679
ds-set.merge.php                                   17-Jul-2024 20:07                4778
ds-set.reduce.php                                  17-Jul-2024 20:07                7903
ds-set.remove.php                                  17-Jul-2024 20:07                4951
ds-set.reverse.php                                 17-Jul-2024 20:07                3579
ds-set.reversed.php                                17-Jul-2024 20:07                3922
ds-set.slice.php                                   17-Jul-2024 20:07                7042
ds-set.sort.php                                    17-Jul-2024 20:07                7215
ds-set.sorted.php                                  17-Jul-2024 20:07                7242
ds-set.sum.php                                     17-Jul-2024 20:07                5163
ds-set.toarray.php                                 17-Jul-2024 20:07                4042
ds-set.union.php                                   17-Jul-2024 20:07                4908
ds-set.xor.php                                     17-Jul-2024 20:07                4884
ds-stack.allocate.php                              17-Jul-2024 20:07                2840
ds-stack.capacity.php                              17-Jul-2024 20:07                2168
ds-stack.clear.php                                 17-Jul-2024 20:07                3776
ds-stack.construct.php                             17-Jul-2024 20:07                4268
ds-stack.copy.php                                  17-Jul-2024 20:07                4259
ds-stack.count.php                                 17-Jul-2024 20:07                1617
ds-stack.isempty.php                               17-Jul-2024 20:07                4121
ds-stack.jsonserialize.php                         17-Jul-2024 20:07                1882
ds-stack.peek.php                                  17-Jul-2024 20:07                4301
ds-stack.pop.php                                   17-Jul-2024 20:07                4835
ds-stack.push.php                                  17-Jul-2024 20:07                4680
ds-stack.toarray.php                               17-Jul-2024 20:07                4087
ds-vector.allocate.php                             17-Jul-2024 20:07                4464
ds-vector.apply.php                                17-Jul-2024 20:07                4967
ds-vector.capacity.php                             17-Jul-2024 20:07                4378
ds-vector.clear.php                                17-Jul-2024 20:07                3807
ds-vector.construct.php                            17-Jul-2024 20:07                4336
ds-vector.contains.php                             17-Jul-2024 20:07                7097
ds-vector.copy.php                                 17-Jul-2024 20:07                4283
ds-vector.count.php                                17-Jul-2024 20:07                1634
ds-vector.filter.php                               17-Jul-2024 20:07                7620
ds-vector.find.php                                 17-Jul-2024 20:07                5431
ds-vector.first.php                                17-Jul-2024 20:07                3751
ds-vector.get.php                                  17-Jul-2024 20:07                6590
ds-vector.insert.php                               17-Jul-2024 20:07                6668
ds-vector.isempty.php                              17-Jul-2024 20:07                4129
ds-vector.join.php                                 17-Jul-2024 20:07                5738
ds-vector.jsonserialize.php                        17-Jul-2024 20:07                1890
ds-vector.last.php                                 17-Jul-2024 20:07                3738
ds-vector.map.php                                  17-Jul-2024 20:07                5334
ds-vector.merge.php                                17-Jul-2024 20:07                4883
ds-vector.pop.php                                  17-Jul-2024 20:07                4235
ds-vector.push.php                                 17-Jul-2024 20:07                4674
ds-vector.reduce.php                               17-Jul-2024 20:07                7985
ds-vector.remove.php                               17-Jul-2024 20:07                4871
ds-vector.reverse.php                              17-Jul-2024 20:07                3657
ds-vector.reversed.php                             17-Jul-2024 20:07                4014
ds-vector.rotate.php                               17-Jul-2024 20:07                5065
ds-vector.set.php                                  17-Jul-2024 20:07                6057
ds-vector.shift.php                                17-Jul-2024 20:07                4336
ds-vector.slice.php                                17-Jul-2024 20:07                7174
ds-vector.sort.php                                 17-Jul-2024 20:07                7311
ds-vector.sorted.php                               17-Jul-2024 20:07                7338
ds-vector.sum.php                                  17-Jul-2024 20:07                5253
ds-vector.toarray.php                              17-Jul-2024 20:07                4121
ds-vector.unshift.php                              17-Jul-2024 20:07                4756
ds.examples.php                                    17-Jul-2024 20:07                4697
ds.installation.php                                17-Jul-2024 20:07                2481
ds.requirements.php                                17-Jul-2024 20:07                1178
ds.setup.php                                       17-Jul-2024 20:07                1390
eio.constants.php                                  17-Jul-2024 20:07               21767
eio.examples.php                                   17-Jul-2024 20:07               27014
eio.installation.php                               17-Jul-2024 20:07                1644
eio.requirements.php                               17-Jul-2024 20:07                1298
eio.resources.php                                  17-Jul-2024 20:07                1209
eio.setup.php                                      17-Jul-2024 20:07                1465
emptyiterator.current.php                          17-Jul-2024 20:07                2676
emptyiterator.key.php                              17-Jul-2024 20:07                2640
emptyiterator.next.php                             17-Jul-2024 20:07                2340
emptyiterator.rewind.php                           17-Jul-2024 20:07                2362
emptyiterator.valid.php                            17-Jul-2024 20:07                2723
enchant.constants.php                              17-Jul-2024 20:07                2934
enchant.examples.php                               17-Jul-2024 20:07                5437
enchant.installation.php                           17-Jul-2024 20:07                3007
enchant.requirements.php                           17-Jul-2024 20:07                1781
enchant.resources.php                              17-Jul-2024 20:07                1316
enchant.setup.php                                  17-Jul-2024 20:07                1508
error.clone.php                                    17-Jul-2024 20:07                2776
error.construct.php                                17-Jul-2024 20:07                3401
error.getcode.php                                  17-Jul-2024 20:07                3978
error.getfile.php                                  17-Jul-2024 20:07                3675
error.getline.php                                  17-Jul-2024 20:07                3884
error.getmessage.php                               17-Jul-2024 20:07                3776
error.getprevious.php                              17-Jul-2024 20:07                6534
error.gettrace.php                                 17-Jul-2024 20:07                4286
error.gettraceasstring.php                         17-Jul-2024 20:07                4077
error.tostring.php                                 17-Jul-2024 20:07                3928
errorexception.construct.php                       17-Jul-2024 20:07                6103
errorexception.getseverity.php                     17-Jul-2024 20:07                4308
errorfunc.configuration.php                        17-Jul-2024 20:07               24157
errorfunc.constants.php                            17-Jul-2024 20:07               11264
errorfunc.examples.php                             17-Jul-2024 20:07               19026
errorfunc.resources.php                            17-Jul-2024 20:07                1207
errorfunc.setup.php                                17-Jul-2024 20:07                1486
ev.backend.php                                     17-Jul-2024 20:07                3371
ev.depth.php                                       17-Jul-2024 20:07                3241
ev.embeddablebackends.php                          17-Jul-2024 20:07                6449
ev.examples.php                                    17-Jul-2024 20:07               41888
ev.feedsignal.php                                  17-Jul-2024 20:07                3369
ev.feedsignalevent.php                             17-Jul-2024 20:07                3156
ev.installation.php                                17-Jul-2024 20:07                1625
ev.iteration.php                                   17-Jul-2024 20:07                2617
ev.now.php                                         17-Jul-2024 20:07                3088
ev.nowupdate.php                                   17-Jul-2024 20:07                3162
ev.periodic-modes.php                              17-Jul-2024 20:07                7697
ev.recommendedbackends.php                         17-Jul-2024 20:07                7141
ev.requirements.php                                17-Jul-2024 20:07                1233
ev.resources.php                                   17-Jul-2024 20:07                1138
ev.resume.php                                      17-Jul-2024 20:07                3684
ev.run.php                                         17-Jul-2024 20:07                5067
ev.setup.php                                       17-Jul-2024 20:07                1428
ev.sleep.php                                       17-Jul-2024 20:07                2434
ev.stop.php                                        17-Jul-2024 20:07                2868
ev.supportedbackends.php                           17-Jul-2024 20:07                6431
ev.suspend.php                                     17-Jul-2024 20:07                3451
ev.time.php                                        17-Jul-2024 20:07                2662
ev.verify.php                                      17-Jul-2024 20:07                2248
ev.watcher-callbacks.php                           17-Jul-2024 20:07                4559
ev.watchers.php                                    17-Jul-2024 20:07                3477
evcheck.construct.php                              17-Jul-2024 20:07                3657
evcheck.createstopped.php                          17-Jul-2024 20:07                3759
evchild.construct.php                              17-Jul-2024 20:07                6734
evchild.createstopped.php                          17-Jul-2024 20:07                5130
evchild.set.php                                    17-Jul-2024 20:07                3205
evembed.construct.php                              17-Jul-2024 20:07                7959
evembed.createstopped.php                          17-Jul-2024 20:07                4772
evembed.set.php                                    17-Jul-2024 20:07                2558
evembed.sweep.php                                  17-Jul-2024 20:07                3047
event.add.php                                      17-Jul-2024 20:07               10271
event.addsignal.php                                17-Jul-2024 20:07                1688
event.addtimer.php                                 17-Jul-2024 20:07                1697
event.callbacks.php                                17-Jul-2024 20:07                5714
event.construct.php                                17-Jul-2024 20:07                4585
event.constructing.signal.events.php               17-Jul-2024 20:07                6086
event.del.php                                      17-Jul-2024 20:07                2622
event.delsignal.php                                17-Jul-2024 20:07                1688
event.deltimer.php                                 17-Jul-2024 20:07                1685
event.examples.php                                 17-Jul-2024 20:07              164971
event.flags.php                                    17-Jul-2024 20:07                2638
event.free.php                                     17-Jul-2024 20:07                3005
event.getsupportedmethods.php                      17-Jul-2024 20:07                2659
event.installation.php                             17-Jul-2024 20:07                1646
event.pending.php                                  17-Jul-2024 20:07                3127
event.persistence.php                              17-Jul-2024 20:07                2968
event.requirements.php                             17-Jul-2024 20:07                1418
event.resources.php                                17-Jul-2024 20:07                1159
event.set.php                                      17-Jul-2024 20:07                4703
event.setpriority.php                              17-Jul-2024 20:07                2619
event.settimer.php                                 17-Jul-2024 20:07                4126
event.setup.php                                    17-Jul-2024 20:07                1464
event.signal.php                                   17-Jul-2024 20:07                4312
event.timer.php                                    17-Jul-2024 20:07                3608
eventbase.construct.php                            17-Jul-2024 20:07                3031
eventbase.dispatch.php                             17-Jul-2024 20:07                3315
eventbase.exit.php                                 17-Jul-2024 20:07                3112
eventbase.free.php                                 17-Jul-2024 20:07                3356
eventbase.getfeatures.php                          17-Jul-2024 20:07                5771
eventbase.getmethod.php                            17-Jul-2024 20:07                4540
eventbase.gettimeofdaycached.php                   17-Jul-2024 20:07                2736
eventbase.gotexit.php                              17-Jul-2024 20:07                3350
eventbase.gotstop.php                              17-Jul-2024 20:07                3322
eventbase.loop.php                                 17-Jul-2024 20:07                3654
eventbase.priorityinit.php                         17-Jul-2024 20:07                3089
eventbase.reinit.php                               17-Jul-2024 20:07                2412
eventbase.stop.php                                 17-Jul-2024 20:07                2875
eventbuffer.add.php                                17-Jul-2024 20:07                3090
eventbuffer.addbuffer.php                          17-Jul-2024 20:07                3442
eventbuffer.appendfrom.php                         17-Jul-2024 20:07                4932
eventbuffer.construct.php                          17-Jul-2024 20:07                1979
eventbuffer.copyout.php                            17-Jul-2024 20:07                3986
eventbuffer.drain.php                              17-Jul-2024 20:07                3565
eventbuffer.enablelocking.php                      17-Jul-2024 20:07                2888
eventbuffer.expand.php                             17-Jul-2024 20:07                2892
eventbuffer.freeze.php                             17-Jul-2024 20:07                3138
eventbuffer.lock.php                               17-Jul-2024 20:07                3013
eventbuffer.prepend.php                            17-Jul-2024 20:07                3565
eventbuffer.prependbuffer.php                      17-Jul-2024 20:07                3727
eventbuffer.pullup.php                             17-Jul-2024 20:07                4693
eventbuffer.read.php                               17-Jul-2024 20:07                4957
eventbuffer.readfrom.php                           17-Jul-2024 20:07                4399
eventbuffer.readline.php                           17-Jul-2024 20:07                4320
eventbuffer.search.php                             17-Jul-2024 20:07                8341
eventbuffer.searcheol.php                          17-Jul-2024 20:07                4892
eventbuffer.substr.php                             17-Jul-2024 20:07                3606
eventbuffer.unfreeze.php                           17-Jul-2024 20:07                3152
eventbuffer.unlock.php                             17-Jul-2024 20:07                2850
eventbuffer.write.php                              17-Jul-2024 20:07                3512
eventbufferevent.about.callbacks.php               17-Jul-2024 20:07                6179
eventbufferevent.close.php                         17-Jul-2024 20:07                2583
eventbufferevent.connect.php                       17-Jul-2024 20:07               23919
eventbufferevent.connecthost.php                   17-Jul-2024 20:07               17822
eventbufferevent.construct.php                     17-Jul-2024 20:07                6907
eventbufferevent.createpair.php                    17-Jul-2024 20:07                4354
eventbufferevent.disable.php                       17-Jul-2024 20:07                3593
eventbufferevent.enable.php                        17-Jul-2024 20:07                4063
eventbufferevent.free.php                          17-Jul-2024 20:07                2804
eventbufferevent.getdnserrorstring.php             17-Jul-2024 20:07                3129
eventbufferevent.getenabled.php                    17-Jul-2024 20:07                3078
eventbufferevent.getinput.php                      17-Jul-2024 20:07                5029
eventbufferevent.getoutput.php                     17-Jul-2024 20:07                7910
eventbufferevent.read.php                          17-Jul-2024 20:07                3108
eventbufferevent.readbuffer.php                    17-Jul-2024 20:07                3279
eventbufferevent.setcallbacks.php                  17-Jul-2024 20:07                4592
eventbufferevent.setpriority.php                   17-Jul-2024 20:07                3001
eventbufferevent.settimeouts.php                   17-Jul-2024 20:07                3226
eventbufferevent.setwatermark.php                  17-Jul-2024 20:07                4130
eventbufferevent.sslerror.php                      17-Jul-2024 20:07                5913
eventbufferevent.sslfilter.php                     17-Jul-2024 20:07               34516
eventbufferevent.sslgetcipherinfo.php              17-Jul-2024 20:07                2948
eventbufferevent.sslgetciphername.php              17-Jul-2024 20:07                2851
eventbufferevent.sslgetcipherversion.php           17-Jul-2024 20:07                2880
eventbufferevent.sslgetprotocol.php                17-Jul-2024 20:07                2757
eventbufferevent.sslrenegotiate.php                17-Jul-2024 20:07                2839
eventbufferevent.sslsocket.php                     17-Jul-2024 20:07                5931
eventbufferevent.write.php                         17-Jul-2024 20:07                3275
eventbufferevent.writebuffer.php                   17-Jul-2024 20:07                3397
eventconfig.avoidmethod.php                        17-Jul-2024 20:07                4442
eventconfig.construct.php                          17-Jul-2024 20:07                4021
eventconfig.requirefeatures.php                    17-Jul-2024 20:07                5992
eventconfig.setflags.php                           17-Jul-2024 20:07                3334
eventconfig.setmaxdispatchinterval.php             17-Jul-2024 20:07                4433
eventdnsbase.addnameserverip.php                   17-Jul-2024 20:07                3028
eventdnsbase.addsearch.php                         17-Jul-2024 20:07                2588
eventdnsbase.clearsearch.php                       17-Jul-2024 20:07                2819
eventdnsbase.construct.php                         17-Jul-2024 20:07                7549
eventdnsbase.countnameservers.php                  17-Jul-2024 20:07                2562
eventdnsbase.loadhosts.php                         17-Jul-2024 20:07                2901
eventdnsbase.parseresolvconf.php                   17-Jul-2024 20:07                4277
eventdnsbase.setoption.php                         17-Jul-2024 20:07                3475
eventdnsbase.setsearchndots.php                    17-Jul-2024 20:07                2964
eventhttp.accept.php                               17-Jul-2024 20:07               12428
eventhttp.addserveralias.php                       17-Jul-2024 20:07                6488
eventhttp.bind.php                                 17-Jul-2024 20:07                7889
eventhttp.construct.php                            17-Jul-2024 20:07               17416
eventhttp.removeserveralias.php                    17-Jul-2024 20:07                3285
eventhttp.setallowedmethods.php                    17-Jul-2024 20:07                3427
eventhttp.setcallback.php                          17-Jul-2024 20:07               18088
eventhttp.setdefaultcallback.php                   17-Jul-2024 20:07                7906
eventhttp.setmaxbodysize.php                       17-Jul-2024 20:07                2936
eventhttp.setmaxheaderssize.php                    17-Jul-2024 20:07                2848
eventhttp.settimeout.php                           17-Jul-2024 20:07                2541
eventhttpconnection.construct.php                  17-Jul-2024 20:07                5148
eventhttpconnection.getbase.php                    17-Jul-2024 20:07                2637
eventhttpconnection.getpeer.php                    17-Jul-2024 20:07                3057
eventhttpconnection.makerequest.php                17-Jul-2024 20:07               11696
eventhttpconnection.setclosecallback.php           17-Jul-2024 20:07                9471
eventhttpconnection.setlocaladdress.php            17-Jul-2024 20:07                3235
eventhttpconnection.setlocalport.php               17-Jul-2024 20:07                3129
eventhttpconnection.setmaxbodysize.php             17-Jul-2024 20:07                3160
eventhttpconnection.setmaxheaderssize.php          17-Jul-2024 20:07                3181
eventhttpconnection.setretries.php                 17-Jul-2024 20:07                2771
eventhttpconnection.settimeout.php                 17-Jul-2024 20:07                2668
eventhttprequest.addheader.php                     17-Jul-2024 20:07                4007
eventhttprequest.cancel.php                        17-Jul-2024 20:07                2858
eventhttprequest.clearheaders.php                  17-Jul-2024 20:07                2804
eventhttprequest.closeconnection.php               17-Jul-2024 20:07                2413
eventhttprequest.construct.php                     17-Jul-2024 20:07               11450
eventhttprequest.findheader.php                    17-Jul-2024 20:07                3571
eventhttprequest.free.php                          17-Jul-2024 20:07                2321
eventhttprequest.getbufferevent.php                17-Jul-2024 20:07                3690
eventhttprequest.getcommand.php                    17-Jul-2024 20:07                2701
eventhttprequest.getconnection.php                 17-Jul-2024 20:07                4444
eventhttprequest.gethost.php                       17-Jul-2024 20:07                2872
eventhttprequest.getinputbuffer.php                17-Jul-2024 20:07                2774
eventhttprequest.getinputheaders.php               17-Jul-2024 20:07                2865
eventhttprequest.getoutputbuffer.php               17-Jul-2024 20:07                2833
eventhttprequest.getoutputheaders.php              17-Jul-2024 20:07                2816
eventhttprequest.getresponsecode.php               17-Jul-2024 20:07                3152
eventhttprequest.geturi.php                        17-Jul-2024 20:07                3065
eventhttprequest.removeheader.php                  17-Jul-2024 20:07                3531
eventhttprequest.senderror.php                     17-Jul-2024 20:07                5872
eventhttprequest.sendreply.php                     17-Jul-2024 20:07                4071
eventhttprequest.sendreplychunk.php                17-Jul-2024 20:07                3443
eventhttprequest.sendreplyend.php                  17-Jul-2024 20:07                3037
eventhttprequest.sendreplystart.php                17-Jul-2024 20:07                4330
eventlistener.construct.php                        17-Jul-2024 20:07               22447
eventlistener.disable.php                          17-Jul-2024 20:07                2826
eventlistener.enable.php                           17-Jul-2024 20:07                2812
eventlistener.getbase.php                          17-Jul-2024 20:07                2340
eventlistener.getsocketname.php                    17-Jul-2024 20:07                3396
eventlistener.setcallback.php                      17-Jul-2024 20:07                6049
eventlistener.seterrorcallback.php                 17-Jul-2024 20:07                4420
eventsslcontext.construct.php                      17-Jul-2024 20:07                5333
eventutil.construct.php                            17-Jul-2024 20:07                2173
eventutil.getlastsocketerrno.php                   17-Jul-2024 20:07                3320
eventutil.getlastsocketerror.php                   17-Jul-2024 20:07                3136
eventutil.getsocketfd.php                          17-Jul-2024 20:07                3244
eventutil.getsocketname.php                        17-Jul-2024 20:07                3799
eventutil.setsocketoption.php                      17-Jul-2024 20:07                5721
eventutil.sslrandpoll.php                          17-Jul-2024 20:07                2386
evfork.construct.php                               17-Jul-2024 20:07                3683
evfork.createstopped.php                           17-Jul-2024 20:07                3961
evidle.construct.php                               17-Jul-2024 20:07                3687
evidle.createstopped.php                           17-Jul-2024 20:07                4159
evio.construct.php                                 17-Jul-2024 20:07                4835
evio.createstopped.php                             17-Jul-2024 20:07                5165
evio.set.php                                       17-Jul-2024 20:07                2853
evloop.backend.php                                 17-Jul-2024 20:07                2718
evloop.check.php                                   17-Jul-2024 20:07                3316
evloop.child.php                                   17-Jul-2024 20:07                3798
evloop.construct.php                               17-Jul-2024 20:07                4054
evloop.defaultloop.php                             17-Jul-2024 20:07                4645
evloop.embed.php                                   17-Jul-2024 20:07                3841
evloop.fork.php                                    17-Jul-2024 20:07                3398
evloop.idle.php                                    17-Jul-2024 20:07                3418
evloop.invokepending.php                           17-Jul-2024 20:07                2228
evloop.io.php                                      17-Jul-2024 20:07                3854
evloop.loopfork.php                                17-Jul-2024 20:07                2566
evloop.now.php                                     17-Jul-2024 20:07                2832
evloop.nowupdate.php                               17-Jul-2024 20:07                3141
evloop.periodic.php                                17-Jul-2024 20:07                3992
evloop.prepare.php                                 17-Jul-2024 20:07                3416
evloop.resume.php                                  17-Jul-2024 20:07                2801
evloop.run.php                                     17-Jul-2024 20:07                5050
evloop.signal.php                                  17-Jul-2024 20:07                3721
evloop.stat.php                                    17-Jul-2024 20:07                3902
evloop.stop.php                                    17-Jul-2024 20:07                2980
evloop.suspend.php                                 17-Jul-2024 20:07                2793
evloop.timer.php                                   17-Jul-2024 20:07                3919
evloop.verify.php                                  17-Jul-2024 20:07                2566
evperiodic.again.php                               17-Jul-2024 20:07                2556
evperiodic.at.php                                  17-Jul-2024 20:07                2641
evperiodic.construct.php                           17-Jul-2024 20:07               10071
evperiodic.createstopped.php                       17-Jul-2024 20:07                5867
evperiodic.set.php                                 17-Jul-2024 20:07                3210
evprepare.construct.php                            17-Jul-2024 20:07                3590
evprepare.createstopped.php                        17-Jul-2024 20:07                4322
evsignal.construct.php                             17-Jul-2024 20:07                5521
evsignal.createstopped.php                         17-Jul-2024 20:07                4847
evsignal.set.php                                   17-Jul-2024 20:07                2510
evstat.attr.php                                    17-Jul-2024 20:07                8227
evstat.construct.php                               17-Jul-2024 20:07                7246
evstat.createstopped.php                           17-Jul-2024 20:07                5223
evstat.prev.php                                    17-Jul-2024 20:07                2930
evstat.set.php                                     17-Jul-2024 20:07                2869
evstat.stat.php                                    17-Jul-2024 20:07                2987
evtimer.again.php                                  17-Jul-2024 20:07                3051
evtimer.construct.php                              17-Jul-2024 20:07               12666
evtimer.createstopped.php                          17-Jul-2024 20:07                8372
evtimer.set.php                                    17-Jul-2024 20:07                3026
evwatcher.clear.php                                17-Jul-2024 20:07                2828
evwatcher.construct.php                            17-Jul-2024 20:07                2114
evwatcher.feed.php                                 17-Jul-2024 20:07                2623
evwatcher.getloop.php                              17-Jul-2024 20:07                2314
evwatcher.invoke.php                               17-Jul-2024 20:07                2630
evwatcher.keepalive.php                            17-Jul-2024 20:07                5359
evwatcher.setcallback.php                          17-Jul-2024 20:07                2585
evwatcher.start.php                                17-Jul-2024 20:07                2498
evwatcher.stop.php                                 17-Jul-2024 20:07                2467
example.xml-external-entity.php                    17-Jul-2024 20:07               21327
example.xml-map-tags.php                           17-Jul-2024 20:07                8137
example.xml-structure.php                          17-Jul-2024 20:07                6205
example.xmlwriter-namespace.php                    17-Jul-2024 20:07                5401
example.xmlwriter-oop.php                          17-Jul-2024 20:07                3409
example.xmlwriter-simple.php                       17-Jul-2024 20:07                8654
exception.clone.php                                17-Jul-2024 20:07                3008
exception.construct.php                            17-Jul-2024 20:07                3738
exception.getcode.php                              17-Jul-2024 20:07                4445
exception.getfile.php                              17-Jul-2024 20:07                3785
exception.getline.php                              17-Jul-2024 20:07                4035
exception.getmessage.php                           17-Jul-2024 20:07                3897
exception.getprevious.php                          17-Jul-2024 20:07                6780
exception.gettrace.php                             17-Jul-2024 20:07                4401
exception.gettraceasstring.php                     17-Jul-2024 20:07                4175
exception.tostring.php                             17-Jul-2024 20:07                4116
exec.resources.php                                 17-Jul-2024 20:07                1323
exec.setup.php                                     17-Jul-2024 20:07                1361
exif.configuration.php                             17-Jul-2024 20:07                6926
exif.constants.php                                 17-Jul-2024 20:07                1943
exif.installation.php                              17-Jul-2024 20:07                1640
exif.requirements.php                              17-Jul-2024 20:07                1769
exif.resources.php                                 17-Jul-2024 20:07                1172
exif.setup.php                                     17-Jul-2024 20:07                1550
expect.configuration.php                           17-Jul-2024 20:07                5317
expect.constants.php                               17-Jul-2024 20:07                3819
expect.examples-usage.php                          17-Jul-2024 20:07               12232
expect.examples.php                                17-Jul-2024 20:07                1407
expect.installation.php                            17-Jul-2024 20:07                2241
expect.requirements.php                            17-Jul-2024 20:07                1304
expect.resources.php                               17-Jul-2024 20:07                1403
expect.setup.php                                   17-Jul-2024 20:07                1572
extensions.alphabetical.php                        17-Jul-2024 20:07               20800
extensions.membership.php                          17-Jul-2024 20:07               20472
extensions.php                                     17-Jul-2024 20:07                1634
extensions.state.php                               17-Jul-2024 20:07                2683
fann.constants.php                                 17-Jul-2024 20:07               22832
fann.examples-1.php                                17-Jul-2024 20:07                8614
fann.examples.php                                  17-Jul-2024 20:07                1373
fann.installation.php                              17-Jul-2024 20:07                4728
fann.requirements.php                              17-Jul-2024 20:07                1159
fann.resources.php                                 17-Jul-2024 20:07                1130
fann.setup.php                                     17-Jul-2024 20:07                1455
fannconnection.construct.php                       17-Jul-2024 20:07                2990
fannconnection.getfromneuron.php                   17-Jul-2024 20:07                2346
fannconnection.gettoneuron.php                     17-Jul-2024 20:07                2324
fannconnection.getweight.php                       17-Jul-2024 20:07                2266
fannconnection.setweight.php                       17-Jul-2024 20:07                2913
faq.build.php                                      17-Jul-2024 20:07               20782
faq.com.php                                        17-Jul-2024 20:07               10576
faq.databases.php                                  17-Jul-2024 20:07                7028
faq.general.php                                    17-Jul-2024 20:07                4600
faq.html.php                                       17-Jul-2024 20:07               18426
faq.installation.php                               17-Jul-2024 20:07               23971
faq.mailinglist.php                                17-Jul-2024 20:07                9177
faq.misc.php                                       17-Jul-2024 20:07                4080
faq.obtaining.php                                  17-Jul-2024 20:07               10493
faq.passwords.php                                  17-Jul-2024 20:07                9440
faq.php                                            17-Jul-2024 20:07                1988
faq.using.php                                      17-Jul-2024 20:07               22313
fdf.constants.php                                  17-Jul-2024 20:07                9156
fdf.examples.php                                   17-Jul-2024 20:07                6029
fdf.installation.php                               17-Jul-2024 20:07                3197
fdf.requirements.php                               17-Jul-2024 20:07                1495
fdf.resources.php                                  17-Jul-2024 20:07                1690
fdf.setup.php                                      17-Jul-2024 20:07                1460
features.commandline.differences.php               17-Jul-2024 20:07               11437
features.commandline.ini.php                       17-Jul-2024 20:07                2214
features.commandline.interactive.php               17-Jul-2024 20:07                8210
features.commandline.io-streams.php                17-Jul-2024 20:07                5798
features.commandline.options.php                   17-Jul-2024 20:07               24415
features.commandline.php                           17-Jul-2024 20:07                7115
features.commandline.usage.php                     17-Jul-2024 20:07               13204
features.commandline.webserver.php                 17-Jul-2024 20:07               12586
features.connection-handling.php                   17-Jul-2024 20:07                4631
features.cookies.php                               17-Jul-2024 20:07                2852
features.dtrace.dtrace.php                         17-Jul-2024 20:07               13653
features.dtrace.introduction.php                   17-Jul-2024 20:07                2895
features.dtrace.php                                17-Jul-2024 20:07                1643
features.dtrace.systemtap.php                      17-Jul-2024 20:07                8003
features.file-upload.common-pitfalls.php           17-Jul-2024 20:07                4711
features.file-upload.errors.php                    17-Jul-2024 20:07                3518
features.file-upload.errors.seealso.php            17-Jul-2024 20:07                1341
features.file-upload.multiple.php                  17-Jul-2024 20:07                4425
features.file-upload.php                           17-Jul-2024 20:07                1838
features.file-upload.post-method.php               17-Jul-2024 20:07               14743
features.file-upload.put-method.php                17-Jul-2024 20:07                5549
features.gc.collecting-cycles.php                  17-Jul-2024 20:07                7091
features.gc.performance-considerations.php         17-Jul-2024 20:07               12702
features.gc.php                                    17-Jul-2024 20:07                1697
features.gc.refcounting-basics.php                 17-Jul-2024 20:07               19913
features.http-auth.php                             17-Jul-2024 20:07               22154
features.persistent-connections.php                17-Jul-2024 20:07                7259
features.php                                       17-Jul-2024 20:07                3811
features.remote-files.php                          17-Jul-2024 20:07                7470
features.session.security.management.php           17-Jul-2024 20:07               24844
features.sessions.php                              17-Jul-2024 20:07                1360
features.xforms.php                                17-Jul-2024 20:07                5064
ffi-ctype.getalignment.php                         17-Jul-2024 20:07                2308
ffi-ctype.getarrayelementtype.php                  17-Jul-2024 20:07                2394
ffi-ctype.getarraylength.php                       17-Jul-2024 20:07                2351
ffi-ctype.getattributes.php                        17-Jul-2024 20:07                2327
ffi-ctype.getenumkind.php                          17-Jul-2024 20:07                2303
ffi-ctype.getfuncabi.php                           17-Jul-2024 20:07                2311
ffi-ctype.getfuncparametercount.php                17-Jul-2024 20:07                2417
ffi-ctype.getfuncparametertype.php                 17-Jul-2024 20:07                2670
ffi-ctype.getfuncreturntype.php                    17-Jul-2024 20:07                2376
ffi-ctype.getkind.php                              17-Jul-2024 20:07                2265
ffi-ctype.getname.php                              17-Jul-2024 20:07                2271
ffi-ctype.getpointertype.php                       17-Jul-2024 20:07                2320
ffi-ctype.getsize.php                              17-Jul-2024 20:07                2283
ffi-ctype.getstructfieldnames.php                  17-Jul-2024 20:07                2393
ffi-ctype.getstructfieldoffset.php                 17-Jul-2024 20:07                2666
ffi-ctype.getstructfieldtype.php                   17-Jul-2024 20:07                2628
ffi.addr.php                                       17-Jul-2024 20:07                2790
ffi.alignof.php                                    17-Jul-2024 20:07                2920
ffi.arraytype.php                                  17-Jul-2024 20:07                4620
ffi.cast.php                                       17-Jul-2024 20:07                4824
ffi.cdef.php                                       17-Jul-2024 20:07                4446
ffi.configuration.php                              17-Jul-2024 20:07                4218
ffi.examples-basic.php                             17-Jul-2024 20:07               15621
ffi.examples-callback.php                          17-Jul-2024 20:07                4886
ffi.examples-complete.php                          17-Jul-2024 20:07                5338
ffi.examples.php                                   17-Jul-2024 20:07                1511
ffi.free.php                                       17-Jul-2024 20:07                2424
ffi.installation.php                               17-Jul-2024 20:07                1407
ffi.isnull.php                                     17-Jul-2024 20:07                2533
ffi.load.php                                       17-Jul-2024 20:07                4297
ffi.memcmp.php                                     17-Jul-2024 20:07                4098
ffi.memcpy.php                                     17-Jul-2024 20:07                3276
ffi.memset.php                                     17-Jul-2024 20:07                3116
ffi.new.php                                        17-Jul-2024 20:07                5156
ffi.requirements.php                               17-Jul-2024 20:07                1255
ffi.resources.php                                  17-Jul-2024 20:07                1155
ffi.scope.php                                      17-Jul-2024 20:07                3136
ffi.setup.php                                      17-Jul-2024 20:07                1517
ffi.sizeof.php                                     17-Jul-2024 20:07                2761
ffi.string.php                                     17-Jul-2024 20:07                4193
ffi.type.php                                       17-Jul-2024 20:07                3570
ffi.typeof.php                                     17-Jul-2024 20:07                2854
fiber.construct.php                                17-Jul-2024 20:07                2332
fiber.getcurrent.php                               17-Jul-2024 20:07                2495
fiber.getreturn.php                                17-Jul-2024 20:07                2539
fiber.isrunning.php                                17-Jul-2024 20:07                2701
fiber.isstarted.php                                17-Jul-2024 20:07                2307
fiber.issuspended.php                              17-Jul-2024 20:07                2324
fiber.isterminated.php                             17-Jul-2024 20:07                2377
fiber.resume.php                                   17-Jul-2024 20:07                3285
fiber.start.php                                    17-Jul-2024 20:07                2944
fiber.suspend.php                                  17-Jul-2024 20:07                3984
fiber.throw.php                                    17-Jul-2024 20:07                3153
fibererror.construct.php                           17-Jul-2024 20:07                2151
fileinfo.constants.php                             17-Jul-2024 20:07                6308
fileinfo.installation.php                          17-Jul-2024 20:07                1640
fileinfo.resources.php                             17-Jul-2024 20:07                1367
fileinfo.setup.php                                 17-Jul-2024 20:07                1460
filesystem.configuration.php                       17-Jul-2024 20:07                7193
filesystem.constants.php                           17-Jul-2024 20:07               13207
filesystem.resources.php                           17-Jul-2024 20:07                1357
filesystem.setup.php                               17-Jul-2024 20:07                1504
filesystemiterator.construct.php                   17-Jul-2024 20:07                7530
filesystemiterator.current.php                     17-Jul-2024 20:07                5371
filesystemiterator.getflags.php                    17-Jul-2024 20:07                3187
filesystemiterator.key.php                         17-Jul-2024 20:07                5089
filesystemiterator.next.php                        17-Jul-2024 20:07                4477
filesystemiterator.rewind.php                      17-Jul-2024 20:07                5106
filesystemiterator.setflags.php                    17-Jul-2024 20:07                6653
filter.configuration.php                           17-Jul-2024 20:07                4855
filter.constants.php                               17-Jul-2024 20:07               25141
filter.examples.php                                17-Jul-2024 20:07                1457
filter.examples.sanitization.php                   17-Jul-2024 20:07                5565
filter.examples.validation.php                     17-Jul-2024 20:07               10133
filter.filters.flags.php                           17-Jul-2024 20:07               16855
filter.filters.misc.php                            17-Jul-2024 20:07                1951
filter.filters.php                                 17-Jul-2024 20:07                1629
filter.filters.sanitize.php                        17-Jul-2024 20:07               13636
filter.filters.validate.php                        17-Jul-2024 20:07               13628
filter.installation.php                            17-Jul-2024 20:07                1270
filter.resources.php                               17-Jul-2024 20:07                1184
filter.setup.php                                   17-Jul-2024 20:07                1505
filteriterator.accept.php                          17-Jul-2024 20:07                5287
filteriterator.construct.php                       17-Jul-2024 20:07                3047
filteriterator.current.php                         17-Jul-2024 20:07                2917
filteriterator.key.php                             17-Jul-2024 20:07                2857
filteriterator.next.php                            17-Jul-2024 20:07                2867
filteriterator.rewind.php                          17-Jul-2024 20:07                3045
filteriterator.valid.php                           17-Jul-2024 20:07                2806
filters.compression.php                            17-Jul-2024 20:07               14804
filters.convert.php                                17-Jul-2024 20:07               11265
filters.encryption.php                             17-Jul-2024 20:07               41018
filters.php                                        17-Jul-2024 20:07                3019
filters.string.php                                 17-Jul-2024 20:07                9843
finfo.buffer.php                                   17-Jul-2024 20:07                2901
finfo.construct.php                                17-Jul-2024 20:07                3068
finfo.file.php                                     17-Jul-2024 20:07                2892
finfo.set-flags.php                                17-Jul-2024 20:07                2107
fpm.observability.php                              17-Jul-2024 20:07                1401
fpm.setup.php                                      17-Jul-2024 20:07                1271
fpm.status.php                                     17-Jul-2024 20:07                9272
ftp.constants.php                                  17-Jul-2024 20:07                5226
ftp.examples-basic.php                             17-Jul-2024 20:07                4786
ftp.examples.php                                   17-Jul-2024 20:07                1359
ftp.installation.php                               17-Jul-2024 20:07                1402
ftp.resources.php                                  17-Jul-2024 20:07                1442
ftp.setup.php                                      17-Jul-2024 20:07                1405
funchand.resources.php                             17-Jul-2024 20:07                1188
funchand.setup.php                                 17-Jul-2024 20:07                1394
funcref.php                                        17-Jul-2024 20:07               13658
function.abs.php                                   17-Jul-2024 20:07                5499
function.acos.php                                  17-Jul-2024 20:07                3423
function.acosh.php                                 17-Jul-2024 20:07                3166
function.addcslashes.php                           17-Jul-2024 20:07                7647
function.addslashes.php                            17-Jul-2024 20:07                6127
function.apache-child-terminate.php                17-Jul-2024 20:07                3286
function.apache-get-modules.php                    17-Jul-2024 20:07                3331
function.apache-get-version.php                    17-Jul-2024 20:07                3886
function.apache-getenv.php                         17-Jul-2024 20:07                5061
function.apache-lookup-uri.php                     17-Jul-2024 20:07                5777
function.apache-note.php                           17-Jul-2024 20:07                7161
function.apache-request-headers.php                17-Jul-2024 20:07                5570
function.apache-response-headers.php               17-Jul-2024 20:07                4336
function.apache-setenv.php                         17-Jul-2024 20:07                5633
function.apcu-add.php                              17-Jul-2024 20:07                8305
function.apcu-cache-info.php                       17-Jul-2024 20:07                6621
function.apcu-cas.php                              17-Jul-2024 20:07                8756
function.apcu-clear-cache.php                      17-Jul-2024 20:07                2577
function.apcu-dec.php                              17-Jul-2024 20:07                8229
function.apcu-delete.php                           17-Jul-2024 20:07                6076
function.apcu-enabled.php                          17-Jul-2024 20:07                2387
function.apcu-entry.php                            17-Jul-2024 20:07                8441
function.apcu-exists.php                           17-Jul-2024 20:07                6919
function.apcu-fetch.php                            17-Jul-2024 20:07                5762
function.apcu-inc.php                              17-Jul-2024 20:07                8213
function.apcu-key-info.php                         17-Jul-2024 20:07                4961
function.apcu-sma-info.php                         17-Jul-2024 20:07                4603
function.apcu-store.php                            17-Jul-2024 20:07                7263
function.array-change-key-case.php                 17-Jul-2024 20:07                5456
function.array-chunk.php                           17-Jul-2024 20:07                7891
function.array-column.php                          17-Jul-2024 20:07               16510
function.array-combine.php                         17-Jul-2024 20:07                7511
function.array-count-values.php                    17-Jul-2024 20:07                5961
function.array-diff-assoc.php                      17-Jul-2024 20:07               10912
function.array-diff-key.php                        17-Jul-2024 20:07               12256
function.array-diff-uassoc.php                     17-Jul-2024 20:07               11401
function.array-diff-ukey.php                       17-Jul-2024 20:07               11739
function.array-diff.php                            17-Jul-2024 20:07               11901
function.array-fill-keys.php                       17-Jul-2024 20:07                5238
function.array-fill.php                            17-Jul-2024 20:07                8953
function.array-filter.php                          17-Jul-2024 20:07               16764
function.array-flip.php                            17-Jul-2024 20:07                7104
function.array-intersect-assoc.php                 17-Jul-2024 20:07                8538
function.array-intersect-key.php                   17-Jul-2024 20:07                9629
function.array-intersect-uassoc.php                17-Jul-2024 20:07                8731
function.array-intersect-ukey.php                  17-Jul-2024 20:07               11432
function.array-intersect.php                       17-Jul-2024 20:07                6834
function.array-is-list.php                         17-Jul-2024 20:07                7060
function.array-key-exists.php                      17-Jul-2024 20:07                9871
function.array-key-first.php                       17-Jul-2024 20:07                7026
function.array-key-last.php                        17-Jul-2024 20:07                3394
function.array-keys.php                            17-Jul-2024 20:07                8404
function.array-map.php                             17-Jul-2024 20:07               27251
function.array-merge-recursive.php                 17-Jul-2024 20:07                6838
function.array-merge.php                           17-Jul-2024 20:07               12328
function.array-multisort.php                       17-Jul-2024 20:07               23350
function.array-pad.php                             17-Jul-2024 20:07                7459
function.array-pop.php                             17-Jul-2024 20:07                5688
function.array-product.php                         17-Jul-2024 20:07                5731
function.array-push.php                            17-Jul-2024 20:07                7182
function.array-rand.php                            17-Jul-2024 20:07                9260
function.array-reduce.php                          17-Jul-2024 20:07                9827
function.array-replace-recursive.php               17-Jul-2024 20:07               11125
function.array-replace.php                         17-Jul-2024 20:07                6789
function.array-reverse.php                         17-Jul-2024 20:07                6214
function.array-search.php                          17-Jul-2024 20:07                8284
function.array-shift.php                           17-Jul-2024 20:07                5754
function.array-slice.php                           17-Jul-2024 20:07               13757
function.array-splice.php                          17-Jul-2024 20:07               17572
function.array-sum.php                             17-Jul-2024 20:07                6387
function.array-udiff-assoc.php                     17-Jul-2024 20:07               17327
function.array-udiff-uassoc.php                    17-Jul-2024 20:07               18843
function.array-udiff.php                           17-Jul-2024 20:07               29502
function.array-uintersect-assoc.php                17-Jul-2024 20:07               11637
function.array-uintersect-uassoc.php               17-Jul-2024 20:07               11890
function.array-uintersect.php                      17-Jul-2024 20:07               11555
function.array-unique.php                          17-Jul-2024 20:07                9624
function.array-unshift.php                         17-Jul-2024 20:07               10966
function.array-values.php                          17-Jul-2024 20:07                4588
function.array-walk-recursive.php                  17-Jul-2024 20:07                7563
function.array-walk.php                            17-Jul-2024 20:07               13541
function.array.php                                 17-Jul-2024 20:07               11311
function.arsort.php                                17-Jul-2024 20:07                9067
function.asin.php                                  17-Jul-2024 20:07                3428
function.asinh.php                                 17-Jul-2024 20:07                3183
function.asort.php                                 17-Jul-2024 20:07                9056
function.assert-options.php                        17-Jul-2024 20:07               13705
function.assert.php                                17-Jul-2024 20:07               21947
function.atan.php                                  17-Jul-2024 20:07                3428
function.atan2.php                                 17-Jul-2024 20:07                3400
function.atanh.php                                 17-Jul-2024 20:07                3190
function.autoload.php                              17-Jul-2024 20:07                3100
function.base-convert.php                          17-Jul-2024 20:07                6357
function.base64-decode.php                         17-Jul-2024 20:07                5088
function.base64-encode.php                         17-Jul-2024 20:07                4663
function.basename.php                              17-Jul-2024 20:07                7379
function.bcadd.php                                 17-Jul-2024 20:07                5795
function.bccomp.php                                17-Jul-2024 20:07                5713
function.bcdiv.php                                 17-Jul-2024 20:07                5362
function.bcmod.php                                 17-Jul-2024 20:07                7432
function.bcmul.php                                 17-Jul-2024 20:07                7169
function.bcpow.php                                 17-Jul-2024 20:07                7121
function.bcpowmod.php                              17-Jul-2024 20:07                7286
function.bcscale.php                               17-Jul-2024 20:07                5542
function.bcsqrt.php                                17-Jul-2024 20:07                6158
function.bcsub.php                                 17-Jul-2024 20:07                5768
function.bin2hex.php                               17-Jul-2024 20:07                4466
function.bind-textdomain-codeset.php               17-Jul-2024 20:07                4590
function.bindec.php                                17-Jul-2024 20:07               14769
function.bindtextdomain.php                        17-Jul-2024 20:07                5538
function.boolval.php                               17-Jul-2024 20:07               10111
function.bzclose.php                               17-Jul-2024 20:07                3049
function.bzcompress.php                            17-Jul-2024 20:07                5104
function.bzdecompress.php                          17-Jul-2024 20:07                6522
function.bzerrno.php                               17-Jul-2024 20:07                3100
function.bzerror.php                               17-Jul-2024 20:07                4307
function.bzerrstr.php                              17-Jul-2024 20:07                3117
function.bzflush.php                               17-Jul-2024 20:07                3347
function.bzopen.php                                17-Jul-2024 20:07                5226
function.bzread.php                                17-Jul-2024 20:07                6477
function.bzwrite.php                               17-Jul-2024 20:07                6341
function.cal-days-in-month.php                     17-Jul-2024 20:07                4548
function.cal-from-jd.php                           17-Jul-2024 20:07                6897
function.cal-info.php                              17-Jul-2024 20:07                6027
function.cal-to-jd.php                             17-Jul-2024 20:07                5878
function.call-user-func-array.php                  17-Jul-2024 20:07               17433
function.call-user-func.php                        17-Jul-2024 20:07               14349
function.ceil.php                                  17-Jul-2024 20:07                5101
function.chdir.php                                 17-Jul-2024 20:07                5533
function.checkdate.php                             17-Jul-2024 20:07                5508
function.checkdnsrr.php                            17-Jul-2024 20:07                5003
function.chgrp.php                                 17-Jul-2024 20:07                6667
function.chmod.php                                 17-Jul-2024 20:07                8532
function.chop.php                                  17-Jul-2024 20:07                2048
function.chown.php                                 17-Jul-2024 20:07                6765
function.chr.php                                   17-Jul-2024 20:07                8642
function.chroot.php                                17-Jul-2024 20:07                4522
function.chunk-split.php                           17-Jul-2024 20:07                5200
function.class-alias.php                           17-Jul-2024 20:07                8830
function.class-exists.php                          17-Jul-2024 20:07                6966
function.class-implements.php                      17-Jul-2024 20:07                7163
function.class-parents.php                         17-Jul-2024 20:07                6872
function.class-uses.php                            17-Jul-2024 20:07                6287
function.clearstatcache.php                        17-Jul-2024 20:07               10697
function.cli-get-process-title.php                 17-Jul-2024 20:07                4475
function.cli-set-process-title.php                 17-Jul-2024 20:07                5553
function.closedir.php                              17-Jul-2024 20:07                4831
function.closelog.php                              17-Jul-2024 20:07                2823
function.com-create-guid.php                       17-Jul-2024 20:07                2855
function.com-event-sink.php                        17-Jul-2024 20:07               10418
function.com-get-active-object.php                 17-Jul-2024 20:07                5688
function.com-load-typelib.php                      17-Jul-2024 20:07                4964
function.com-message-pump.php                      17-Jul-2024 20:07                4080
function.com-print-typeinfo.php                    17-Jul-2024 20:07                5156
function.commonmark-parse.php                      17-Jul-2024 20:07                4158
function.commonmark-render-html.php                17-Jul-2024 20:07                4668
function.commonmark-render-latex.php               17-Jul-2024 20:07                4998
function.commonmark-render-man.php                 17-Jul-2024 20:07                4980
function.commonmark-render-xml.php                 17-Jul-2024 20:07                4625
function.commonmark-render.php                     17-Jul-2024 20:07                4926
function.compact.php                               17-Jul-2024 20:07                8099
function.connection-aborted.php                    17-Jul-2024 20:07                2938
function.connection-status.php                     17-Jul-2024 20:07                3076
function.constant.php                              17-Jul-2024 20:07                9058
function.convert-cyr-string.php                    17-Jul-2024 20:07                5099
function.convert-uudecode.php                      17-Jul-2024 20:07                4535
function.convert-uuencode.php                      17-Jul-2024 20:07                5436
function.copy.php                                  17-Jul-2024 20:07                5983
function.cos.php                                   17-Jul-2024 20:07                3919
function.cosh.php                                  17-Jul-2024 20:07                3146
function.count-chars.php                           17-Jul-2024 20:07                7309
function.count.php                                 17-Jul-2024 20:07               15937
function.crc32.php                                 17-Jul-2024 20:07                6572
function.create-function.php                       17-Jul-2024 20:07               30822
function.crypt.php                                 17-Jul-2024 20:07               12431
function.ctype-alnum.php                           17-Jul-2024 20:07                6517
function.ctype-alpha.php                           17-Jul-2024 20:07                6886
function.ctype-cntrl.php                           17-Jul-2024 20:07                6539
function.ctype-digit.php                           17-Jul-2024 20:07                8630
function.ctype-graph.php                           17-Jul-2024 20:07                7179
function.ctype-lower.php                           17-Jul-2024 20:07                6687
function.ctype-print.php                           17-Jul-2024 20:07                7252
function.ctype-punct.php                           17-Jul-2024 20:07                6587
function.ctype-space.php                           17-Jul-2024 20:07                7271
function.ctype-upper.php                           17-Jul-2024 20:07                6736
function.ctype-xdigit.php                          17-Jul-2024 20:07                6474
function.cubrid-affected-rows.php                  17-Jul-2024 20:07                9387
function.cubrid-bind.php                           17-Jul-2024 20:07               20685
function.cubrid-client-encoding.php                17-Jul-2024 20:07                5275
function.cubrid-close-prepare.php                  17-Jul-2024 20:07                6263
function.cubrid-close-request.php                  17-Jul-2024 20:07                6274
function.cubrid-close.php                          17-Jul-2024 20:07                6401
function.cubrid-col-get.php                        17-Jul-2024 20:07                8563
function.cubrid-col-size.php                       17-Jul-2024 20:07                8662
function.cubrid-column-names.php                   17-Jul-2024 20:07                8507
function.cubrid-column-types.php                   17-Jul-2024 20:07                8487
function.cubrid-commit.php                         17-Jul-2024 20:07               15325
function.cubrid-connect-with-url.php               17-Jul-2024 20:07               15116
function.cubrid-connect.php                        17-Jul-2024 20:07               12321
function.cubrid-current-oid.php                    17-Jul-2024 20:07                5988
function.cubrid-data-seek.php                      17-Jul-2024 20:07                7465
function.cubrid-db-name.php                        17-Jul-2024 20:07                6547
function.cubrid-disconnect.php                     17-Jul-2024 20:07                7137
function.cubrid-drop.php                           17-Jul-2024 20:07               11420
function.cubrid-errno.php                          17-Jul-2024 20:07                6804
function.cubrid-error-code-facility.php            17-Jul-2024 20:07                5807
function.cubrid-error-code.php                     17-Jul-2024 20:07                5717
function.cubrid-error-msg.php                      17-Jul-2024 20:07                5167
function.cubrid-error.php                          17-Jul-2024 20:07                6364
function.cubrid-execute.php                        17-Jul-2024 20:07               14361
function.cubrid-fetch-array.php                    17-Jul-2024 20:07                9805
function.cubrid-fetch-assoc.php                    17-Jul-2024 20:07                9039
function.cubrid-fetch-field.php                    17-Jul-2024 20:07               14077
function.cubrid-fetch-lengths.php                  17-Jul-2024 20:07                6129
function.cubrid-fetch-object.php                   17-Jul-2024 20:07               11984
function.cubrid-fetch-row.php                      17-Jul-2024 20:07                8963
function.cubrid-fetch.php                          17-Jul-2024 20:07                9942
function.cubrid-field-flags.php                    17-Jul-2024 20:07                7785
function.cubrid-field-len.php                      17-Jul-2024 20:07                8294
function.cubrid-field-name.php                     17-Jul-2024 20:07                7200
function.cubrid-field-seek.php                     17-Jul-2024 20:07               10952
function.cubrid-field-table.php                    17-Jul-2024 20:07                7405
function.cubrid-field-type.php                     17-Jul-2024 20:07                7467
function.cubrid-free-result.php                    17-Jul-2024 20:07                5939
function.cubrid-get-autocommit.php                 17-Jul-2024 20:07                3812
function.cubrid-get-charset.php                    17-Jul-2024 20:07                5000
function.cubrid-get-class-name.php                 17-Jul-2024 20:07                6330
function.cubrid-get-client-info.php                17-Jul-2024 20:07                8140
function.cubrid-get-db-parameter.php               17-Jul-2024 20:07               14278
function.cubrid-get-query-timeout.php              17-Jul-2024 20:07                6716
function.cubrid-get-server-info.php                17-Jul-2024 20:07                8431
function.cubrid-get.php                            17-Jul-2024 20:07                9852
function.cubrid-insert-id.php                      17-Jul-2024 20:07                7134
function.cubrid-is-instance.php                    17-Jul-2024 20:07                7176
function.cubrid-list-dbs.php                       17-Jul-2024 20:07                4547
function.cubrid-load-from-glo.php                  17-Jul-2024 20:07                6861
function.cubrid-lob-close.php                      17-Jul-2024 20:07                7256
function.cubrid-lob-export.php                     17-Jul-2024 20:07                7835
function.cubrid-lob-get.php                        17-Jul-2024 20:07                7638
function.cubrid-lob-send.php                       17-Jul-2024 20:07                7010
function.cubrid-lob-size.php                       17-Jul-2024 20:07                5827
function.cubrid-lob2-bind.php                      17-Jul-2024 20:07                9720
function.cubrid-lob2-close.php                     17-Jul-2024 20:07                3414
function.cubrid-lob2-export.php                    17-Jul-2024 20:07                8713
function.cubrid-lob2-import.php                    17-Jul-2024 20:07                8582
function.cubrid-lob2-new.php                       17-Jul-2024 20:07                3938
function.cubrid-lob2-read.php                      17-Jul-2024 20:07               13692
function.cubrid-lob2-seek.php                      17-Jul-2024 20:07               11244
function.cubrid-lob2-seek64.php                    17-Jul-2024 20:07               12666
function.cubrid-lob2-size.php                      17-Jul-2024 20:07                4319
function.cubrid-lob2-size64.php                    17-Jul-2024 20:07                4499
function.cubrid-lob2-tell.php                      17-Jul-2024 20:07                4338
function.cubrid-lob2-tell64.php                    17-Jul-2024 20:07                4536
function.cubrid-lob2-write.php                     17-Jul-2024 20:07               14005
function.cubrid-lock-read.php                      17-Jul-2024 20:07                9141
function.cubrid-lock-write.php                     17-Jul-2024 20:07                9529
function.cubrid-move-cursor.php                    17-Jul-2024 20:07                9513
function.cubrid-new-glo.php                        17-Jul-2024 20:07                6918
function.cubrid-next-result.php                    17-Jul-2024 20:07               16300
function.cubrid-num-cols.php                       17-Jul-2024 20:07                5973
function.cubrid-num-fields.php                     17-Jul-2024 20:07                5694
function.cubrid-num-rows.php                       17-Jul-2024 20:07                7157
function.cubrid-pconnect-with-url.php              17-Jul-2024 20:07               14443
function.cubrid-pconnect.php                       17-Jul-2024 20:07               12102
function.cubrid-ping.php                           17-Jul-2024 20:07                6089
function.cubrid-prepare.php                        17-Jul-2024 20:07               10257
function.cubrid-put.php                            17-Jul-2024 20:07               11362
function.cubrid-query.php                          17-Jul-2024 20:07               14720
function.cubrid-real-escape-string.php             17-Jul-2024 20:07                8215
function.cubrid-result.php                         17-Jul-2024 20:07                7425
function.cubrid-rollback.php                       17-Jul-2024 20:07               14620
function.cubrid-save-to-glo.php                    17-Jul-2024 20:07                6780
function.cubrid-schema.php                         17-Jul-2024 20:07               20453
function.cubrid-send-glo.php                       17-Jul-2024 20:07                6247
function.cubrid-seq-drop.php                       17-Jul-2024 20:07                9790
function.cubrid-seq-insert.php                     17-Jul-2024 20:07               10296
function.cubrid-seq-put.php                        17-Jul-2024 20:07               10223
function.cubrid-set-add.php                        17-Jul-2024 20:07                9562
function.cubrid-set-autocommit.php                 17-Jul-2024 20:07                4177
function.cubrid-set-db-parameter.php               17-Jul-2024 20:07                8179
function.cubrid-set-drop.php                       17-Jul-2024 20:07                9539
function.cubrid-set-query-timeout.php              17-Jul-2024 20:07                3565
function.cubrid-unbuffered-query.php               17-Jul-2024 20:07                7014
function.cubrid-version.php                        17-Jul-2024 20:07                8661
function.curl-close.php                            17-Jul-2024 20:07                5850
function.curl-copy-handle.php                      17-Jul-2024 20:07                6256
function.curl-errno.php                            17-Jul-2024 20:07                5935
function.curl-error.php                            17-Jul-2024 20:07                5872
function.curl-escape.php                           17-Jul-2024 20:07                7427
function.curl-exec.php                             17-Jul-2024 20:07                7161
function.curl-getinfo.php                          17-Jul-2024 20:07               41965
function.curl-init.php                             17-Jul-2024 20:07                7082
function.curl-multi-add-handle.php                 17-Jul-2024 20:07               10032
function.curl-multi-close.php                      17-Jul-2024 20:07                9409
function.curl-multi-errno.php                      17-Jul-2024 20:07                3839
function.curl-multi-exec.php                       17-Jul-2024 20:07               10043
function.curl-multi-getcontent.php                 17-Jul-2024 20:07                4325
function.curl-multi-info-read.php                  17-Jul-2024 20:07               11838
function.curl-multi-init.php                       17-Jul-2024 20:07                8537
function.curl-multi-remove-handle.php              17-Jul-2024 20:07                5283
function.curl-multi-select.php                     17-Jul-2024 20:07                4216
function.curl-multi-setopt.php                     17-Jul-2024 20:07               12466
function.curl-multi-strerror.php                   17-Jul-2024 20:07                7030
function.curl-pause.php                            17-Jul-2024 20:07                3839
function.curl-reset.php                            17-Jul-2024 20:07                6252
function.curl-setopt-array.php                     17-Jul-2024 20:07                7473
function.curl-setopt.php                           17-Jul-2024 20:07              153479
function.curl-share-close.php                      17-Jul-2024 20:07                7819
function.curl-share-errno.php                      17-Jul-2024 20:07                3859
function.curl-share-init.php                       17-Jul-2024 20:07                7376
function.curl-share-setopt.php                     17-Jul-2024 20:07                9980
function.curl-share-strerror.php                   17-Jul-2024 20:07                3370
function.curl-strerror.php                         17-Jul-2024 20:07                6127
function.curl-unescape.php                         17-Jul-2024 20:07                7873
function.curl-version.php                          17-Jul-2024 20:07                6584
function.curl_upkeep.php                           17-Jul-2024 20:07                6871
function.current.php                               17-Jul-2024 20:07               10979
function.date-add.php                              17-Jul-2024 20:07                1740
function.date-create-from-format.php               17-Jul-2024 20:07                1915
function.date-create-immutable-from-format.php     17-Jul-2024 20:07                2027
function.date-create-immutable.php                 17-Jul-2024 20:07                4256
function.date-create.php                           17-Jul-2024 20:07                4411
function.date-date-set.php                         17-Jul-2024 20:07                1799
function.date-default-timezone-get.php             17-Jul-2024 20:07                6832
function.date-default-timezone-set.php             17-Jul-2024 20:07                5475
function.date-diff.php                             17-Jul-2024 20:07                1759
function.date-format.php                           17-Jul-2024 20:07                1767
function.date-get-last-errors.php                  17-Jul-2024 20:07                1932
function.date-interval-create-from-date-string.php 17-Jul-2024 20:07                2043
function.date-interval-format.php                  17-Jul-2024 20:07                1894
function.date-isodate-set.php                      17-Jul-2024 20:07                1822
function.date-modify.php                           17-Jul-2024 20:07                1771
function.date-offset-get.php                       17-Jul-2024 20:07                1815
function.date-parse-from-format.php                17-Jul-2024 20:07               13769
function.date-parse.php                            17-Jul-2024 20:07               18916
function.date-sub.php                              17-Jul-2024 20:07                2323
function.date-sun-info.php                         17-Jul-2024 20:07               15618
function.date-sunrise.php                          17-Jul-2024 20:07               14096
function.date-sunset.php                           17-Jul-2024 20:07               14095
function.date-time-set.php                         17-Jul-2024 20:07                1785
function.date-timestamp-get.php                    17-Jul-2024 20:07                1844
function.date-timestamp-set.php                    17-Jul-2024 20:07                1852
function.date-timezone-get.php                     17-Jul-2024 20:07                1841
function.date-timezone-set.php                     17-Jul-2024 20:07                1813
function.date.php                                  17-Jul-2024 20:07               21171
function.db2-autocommit.php                        17-Jul-2024 20:07               11049
function.db2-bind-param.php                        17-Jul-2024 20:07               22822
function.db2-client-info.php                       17-Jul-2024 20:07               11626
function.db2-close.php                             17-Jul-2024 20:07                5640
function.db2-column-privileges.php                 17-Jul-2024 20:07                9148
function.db2-columns.php                           17-Jul-2024 20:07               11197
function.db2-commit.php                            17-Jul-2024 20:07                3721
function.db2-conn-error.php                        17-Jul-2024 20:07                6922
function.db2-conn-errormsg.php                     17-Jul-2024 20:07                6714
function.db2-connect.php                           17-Jul-2024 20:07               39900
function.db2-cursor-type.php                       17-Jul-2024 20:07                3318
function.db2-escape-string.php                     17-Jul-2024 20:07                7559
function.db2-exec.php                              17-Jul-2024 20:07               26229
function.db2-execute.php                           17-Jul-2024 20:07               25596
function.db2-fetch-array.php                       17-Jul-2024 20:07               11261
function.db2-fetch-assoc.php                       17-Jul-2024 20:07               11277
function.db2-fetch-both.php                        17-Jul-2024 20:07               11810
function.db2-fetch-object.php                      17-Jul-2024 20:07                8997
function.db2-fetch-row.php                         17-Jul-2024 20:07               16274
function.db2-field-display-size.php                17-Jul-2024 20:07                5112
function.db2-field-name.php                        17-Jul-2024 20:07                5000
function.db2-field-num.php                         17-Jul-2024 20:07                5008
function.db2-field-precision.php                   17-Jul-2024 20:07                5040
function.db2-field-scale.php                       17-Jul-2024 20:07                5002
function.db2-field-type.php                        17-Jul-2024 20:07                5005
function.db2-field-width.php                       17-Jul-2024 20:07                5210
function.db2-foreign-keys.php                      17-Jul-2024 20:07                9053
function.db2-free-result.php                       17-Jul-2024 20:07                3379
function.db2-free-stmt.php                         17-Jul-2024 20:07                3367
function.db2-get-option.php                        17-Jul-2024 20:07               24079
function.db2-last-insert-id.php                    17-Jul-2024 20:07                8160
function.db2-lob-read.php                          17-Jul-2024 20:07               16366
function.db2-next-result.php                       17-Jul-2024 20:07                8814
function.db2-num-fields.php                        17-Jul-2024 20:07                7153
function.db2-num-rows.php                          17-Jul-2024 20:07                4742
function.db2-pclose.php                            17-Jul-2024 20:07                5847
function.db2-pconnect.php                          17-Jul-2024 20:07               34767
function.db2-prepare.php                           17-Jul-2024 20:07               10565
function.db2-primary-keys.php                      17-Jul-2024 20:07                7687
function.db2-procedure-columns.php                 17-Jul-2024 20:07               12155
function.db2-procedures.php                        17-Jul-2024 20:07                8016
function.db2-result.php                            17-Jul-2024 20:07                7956
function.db2-rollback.php                          17-Jul-2024 20:07                9292
function.db2-server-info.php                       17-Jul-2024 20:07               22472
function.db2-set-option.php                        17-Jul-2024 20:07               67252
function.db2-special-columns.php                   17-Jul-2024 20:07               10268
function.db2-statistics.php                        17-Jul-2024 20:07               12539
function.db2-stmt-error.php                        17-Jul-2024 20:07                4617
function.db2-stmt-errormsg.php                     17-Jul-2024 20:07                4248
function.db2-table-privileges.php                  17-Jul-2024 20:07                8577
function.db2-tables.php                            17-Jul-2024 20:07                8907
function.dba-close.php                             17-Jul-2024 20:07                3173
function.dba-delete.php                            17-Jul-2024 20:07                4125
function.dba-exists.php                            17-Jul-2024 20:07                4157
function.dba-fetch.php                             17-Jul-2024 20:07                7097
function.dba-firstkey.php                          17-Jul-2024 20:07                3647
function.dba-handlers.php                          17-Jul-2024 20:07                5505
function.dba-insert.php                            17-Jul-2024 20:07                4763
function.dba-key-split.php                         17-Jul-2024 20:07                3946
function.dba-list.php                              17-Jul-2024 20:07                2221
function.dba-nextkey.php                           17-Jul-2024 20:07                3569
function.dba-open.php                              17-Jul-2024 20:07               13815
function.dba-optimize.php                          17-Jul-2024 20:07                3209
function.dba-popen.php                             17-Jul-2024 20:07                9143
function.dba-replace.php                           17-Jul-2024 20:07                4591
function.dba-sync.php                              17-Jul-2024 20:07                3229
function.dbase-add-record.php                      17-Jul-2024 20:07                6900
function.dbase-close.php                           17-Jul-2024 20:07                5240
function.dbase-create.php                          17-Jul-2024 20:07                8216
function.dbase-delete-record.php                   17-Jul-2024 20:07                4984
function.dbase-get-header-info.php                 17-Jul-2024 20:07                6993
function.dbase-get-record-with-names.php           17-Jul-2024 20:07                8801
function.dbase-get-record.php                      17-Jul-2024 20:07                5753
function.dbase-numfields.php                       17-Jul-2024 20:07                5956
function.dbase-numrecords.php                      17-Jul-2024 20:07                6904
function.dbase-open.php                            17-Jul-2024 20:07                6556
function.dbase-pack.php                            17-Jul-2024 20:07                6332
function.dbase-replace-record.php                  17-Jul-2024 20:07                9464
function.dcgettext.php                             17-Jul-2024 20:07                3515
function.dcngettext.php                            17-Jul-2024 20:07                4167
function.debug-backtrace.php                       17-Jul-2024 20:07               11818
function.debug-print-backtrace.php                 17-Jul-2024 20:07                6576
function.debug-zval-dump.php                       17-Jul-2024 20:07                9172
function.decbin.php                                17-Jul-2024 20:07                8675
function.dechex.php                                17-Jul-2024 20:07                7039
function.decoct.php                                17-Jul-2024 20:07                4761
function.define.php                                17-Jul-2024 20:07               11709
function.defined.php                               17-Jul-2024 20:07                7757
function.deflate-add.php                           17-Jul-2024 20:07                5944
function.deflate-init.php                          17-Jul-2024 20:07                7890
function.deg2rad.php                               17-Jul-2024 20:07                3923
function.delete.php                                17-Jul-2024 20:07                2402
function.dgettext.php                              17-Jul-2024 20:07                3267
function.die.php                                   17-Jul-2024 20:07                1614
function.dio-close.php                             17-Jul-2024 20:07                3916
function.dio-fcntl.php                             17-Jul-2024 20:07                9347
function.dio-open.php                              17-Jul-2024 20:07                8122
function.dio-read.php                              17-Jul-2024 20:07                3489
function.dio-seek.php                              17-Jul-2024 20:07                7138
function.dio-stat.php                              17-Jul-2024 20:07                4244
function.dio-tcsetattr.php                         17-Jul-2024 20:07                6854
function.dio-truncate.php                          17-Jul-2024 20:07                3687
function.dio-write.php                             17-Jul-2024 20:07                3791
function.dir.php                                   17-Jul-2024 20:07                7099
function.dirname.php                               17-Jul-2024 20:07                9249
function.disk-free-space.php                       17-Jul-2024 20:07                5332
function.disk-total-space.php                      17-Jul-2024 20:07                5422
function.diskfreespace.php                         17-Jul-2024 20:07                1785
function.dl.php                                    17-Jul-2024 20:07                9381
function.dngettext.php                             17-Jul-2024 20:07                3931
function.dns-check-record.php                      17-Jul-2024 20:07                1757
function.dns-get-mx.php                            17-Jul-2024 20:07                1727
function.dns-get-record.php                        17-Jul-2024 20:07               23045
function.dom-import-simplexml.php                  17-Jul-2024 20:07                7009
function.doubleval.php                             17-Jul-2024 20:07                1703
function.each.php                                  17-Jul-2024 20:07               11184
function.easter-date.php                           17-Jul-2024 20:07               13589
function.easter-days.php                           17-Jul-2024 20:07                6828
function.echo.php                                  17-Jul-2024 20:07               16687
function.eio-busy.php                              17-Jul-2024 20:07                4904
function.eio-cancel.php                            17-Jul-2024 20:07                7414
function.eio-chmod.php                             17-Jul-2024 20:07                6101
function.eio-chown.php                             17-Jul-2024 20:07                6303
function.eio-close.php                             17-Jul-2024 20:07                5533
function.eio-custom.php                            17-Jul-2024 20:07               10185
function.eio-dup2.php                              17-Jul-2024 20:07                5589
function.eio-event-loop.php                        17-Jul-2024 20:07                5745
function.eio-fallocate.php                         17-Jul-2024 20:07                7446
function.eio-fchmod.php                            17-Jul-2024 20:07                6060
function.eio-fchown.php                            17-Jul-2024 20:07                6362
function.eio-fdatasync.php                         17-Jul-2024 20:07                5453
function.eio-fstat.php                             17-Jul-2024 20:07               11420
function.eio-fstatvfs.php                          17-Jul-2024 20:07                5575
function.eio-fsync.php                             17-Jul-2024 20:07                5549
function.eio-ftruncate.php                         17-Jul-2024 20:07                6078
function.eio-futime.php                            17-Jul-2024 20:07                6384
function.eio-get-event-stream.php                  17-Jul-2024 20:07                8023
function.eio-get-last-error.php                    17-Jul-2024 20:07                3088
function.eio-grp-add.php                           17-Jul-2024 20:07               11415
function.eio-grp-cancel.php                        17-Jul-2024 20:07                3113
function.eio-grp-limit.php                         17-Jul-2024 20:07                3027
function.eio-grp.php                               17-Jul-2024 20:07               11622
function.eio-init.php                              17-Jul-2024 20:07                2569
function.eio-link.php                              17-Jul-2024 20:07               12429
function.eio-lstat.php                             17-Jul-2024 20:07                9802
function.eio-mkdir.php                             17-Jul-2024 20:07                9106
function.eio-mknod.php                             17-Jul-2024 20:07               11361
function.eio-nop.php                               17-Jul-2024 20:07                5206
function.eio-npending.php                          17-Jul-2024 20:07                2983
function.eio-nready.php                            17-Jul-2024 20:07                2731
function.eio-nreqs.php                             17-Jul-2024 20:07                5504
function.eio-nthreads.php                          17-Jul-2024 20:07                3405
function.eio-open.php                              17-Jul-2024 20:07               11384
function.eio-poll.php                              17-Jul-2024 20:07                5634
function.eio-read.php                              17-Jul-2024 20:07               12399
function.eio-readahead.php                         17-Jul-2024 20:07                6122
function.eio-readdir.php                           17-Jul-2024 20:07               18136
function.eio-readlink.php                          17-Jul-2024 20:07               12117
function.eio-realpath.php                          17-Jul-2024 20:07                5327
function.eio-rename.php                            17-Jul-2024 20:07                9197
function.eio-rmdir.php                             17-Jul-2024 20:07                8137
function.eio-seek.php                              17-Jul-2024 20:07                6932
function.eio-sendfile.php                          17-Jul-2024 20:07                6447
function.eio-set-max-idle.php                      17-Jul-2024 20:07                3116
function.eio-set-max-parallel.php                  17-Jul-2024 20:07                3165
function.eio-set-max-poll-reqs.php                 17-Jul-2024 20:07                2489
function.eio-set-max-poll-time.php                 17-Jul-2024 20:07                2559
function.eio-set-min-parallel.php                  17-Jul-2024 20:07                3156
function.eio-stat.php                              17-Jul-2024 20:07                9779
function.eio-statvfs.php                           17-Jul-2024 20:07                8271
function.eio-symlink.php                           17-Jul-2024 20:07               10751
function.eio-sync-file-range.php                   17-Jul-2024 20:07                7227
function.eio-sync.php                              17-Jul-2024 20:07                2878
function.eio-syncfs.php                            17-Jul-2024 20:07                5136
function.eio-truncate.php                          17-Jul-2024 20:07                6055
function.eio-unlink.php                            17-Jul-2024 20:07                5242
function.eio-utime.php                             17-Jul-2024 20:07                6093
function.eio-write.php                             17-Jul-2024 20:07                6811
function.empty.php                                 17-Jul-2024 20:07                9235
function.enchant-broker-describe.php               17-Jul-2024 20:07                6042
function.enchant-broker-dict-exists.php            17-Jul-2024 20:07                5735
function.enchant-broker-free-dict.php              17-Jul-2024 20:07                4772
function.enchant-broker-free.php                   17-Jul-2024 20:07                4324
function.enchant-broker-get-dict-path.php          17-Jul-2024 20:07                5290
function.enchant-broker-get-error.php              17-Jul-2024 20:07                3682
function.enchant-broker-init.php                   17-Jul-2024 20:07                3489
function.enchant-broker-list-dicts.php             17-Jul-2024 20:07                6917
function.enchant-broker-request-dict.php           17-Jul-2024 20:07                7057
function.enchant-broker-request-pwl-dict.php       17-Jul-2024 20:07                5371
function.enchant-broker-set-dict-path.php          17-Jul-2024 20:07                5573
function.enchant-broker-set-ordering.php           17-Jul-2024 20:07                4812
function.enchant-dict-add-to-personal.php          17-Jul-2024 20:07                2192
function.enchant-dict-add-to-session.php           17-Jul-2024 20:07                4433
function.enchant-dict-add.php                      17-Jul-2024 20:07                6390
function.enchant-dict-check.php                    17-Jul-2024 20:07                4263
function.enchant-dict-describe.php                 17-Jul-2024 20:07                6531
function.enchant-dict-get-error.php                17-Jul-2024 20:07                3885
function.enchant-dict-is-added.php                 17-Jul-2024 20:07                4488
function.enchant-dict-is-in-session.php            17-Jul-2024 20:07                2178
function.enchant-dict-quick-check.php              17-Jul-2024 20:07                8289
function.enchant-dict-store-replacement.php        17-Jul-2024 20:07                4723
function.enchant-dict-suggest.php                  17-Jul-2024 20:07                7457
function.end.php                                   17-Jul-2024 20:07                6577
function.enum-exists.php                           17-Jul-2024 20:07                5266
function.error-clear-last.php                      17-Jul-2024 20:07                4555
function.error-get-last.php                        17-Jul-2024 20:07                4803
function.error-log.php                             17-Jul-2024 20:07               10515
function.error-reporting.php                       17-Jul-2024 20:07                8868
function.escapeshellarg.php                        17-Jul-2024 20:07                5138
function.escapeshellcmd.php                        17-Jul-2024 20:07                7392
function.eval.php                                  17-Jul-2024 20:07                8789
function.exec.php                                  17-Jul-2024 20:07               10409
function.exif-imagetype.php                        17-Jul-2024 20:07                9697
function.exif-read-data.php                        17-Jul-2024 20:07               20628
function.exif-tagname.php                          17-Jul-2024 20:07                4727
function.exif-thumbnail.php                        17-Jul-2024 20:07                8686
function.exit.php                                  17-Jul-2024 20:07                9132
function.exp.php                                   17-Jul-2024 20:07                4238
function.expect-expectl.php                        17-Jul-2024 20:07               11072
function.expect-popen.php                          17-Jul-2024 20:07                4621
function.explode.php                               17-Jul-2024 20:07               15229
function.expm1.php                                 17-Jul-2024 20:07                3340
function.extension-loaded.php                      17-Jul-2024 20:07                5417
function.extract.php                               17-Jul-2024 20:07               13552
function.ezmlm-hash.php                            17-Jul-2024 20:07                4439
function.fann-cascadetrain-on-data.php             17-Jul-2024 20:07                6454
function.fann-cascadetrain-on-file.php             17-Jul-2024 20:07                5545
function.fann-clear-scaling-params.php             17-Jul-2024 20:07                2725
function.fann-copy.php                             17-Jul-2024 20:07                3253
function.fann-create-from-file.php                 17-Jul-2024 20:07                3225
function.fann-create-shortcut-array.php            17-Jul-2024 20:07                4036
function.fann-create-shortcut.php                  17-Jul-2024 20:07                4974
function.fann-create-sparse-array.php              17-Jul-2024 20:07                4736
function.fann-create-sparse.php                    17-Jul-2024 20:07                5433
function.fann-create-standard-array.php            17-Jul-2024 20:07                4369
function.fann-create-standard.php                  17-Jul-2024 20:07                5130
function.fann-create-train-from-callback.php       17-Jul-2024 20:07                8937
function.fann-create-train.php                     17-Jul-2024 20:07                4564
function.fann-descale-input.php                    17-Jul-2024 20:07                3737
function.fann-descale-output.php                   17-Jul-2024 20:07                3750
function.fann-descale-train.php                    17-Jul-2024 20:07                3709
function.fann-destroy-train.php                    17-Jul-2024 20:07                2679
function.fann-destroy.php                          17-Jul-2024 20:07                2704
function.fann-duplicate-train-data.php             17-Jul-2024 20:07                2864
function.fann-get-activation-function.php          17-Jul-2024 20:07                5084
function.fann-get-activation-steepness.php         17-Jul-2024 20:07                5323
function.fann-get-bias-array.php                   17-Jul-2024 20:07                2568
function.fann-get-bit-fail-limit.php               17-Jul-2024 20:07                3702
function.fann-get-bit-fail.php                     17-Jul-2024 20:07                4816
function.fann-get-cascade-activation-functions-..> 17-Jul-2024 20:07                3786
function.fann-get-cascade-activation-functions.php 17-Jul-2024 20:07                4560
function.fann-get-cascade-activation-steepnesse..> 17-Jul-2024 20:07                3829
function.fann-get-cascade-activation-steepnesse..> 17-Jul-2024 20:07                3937
function.fann-get-cascade-candidate-change-frac..> 17-Jul-2024 20:07                4960
function.fann-get-cascade-candidate-limit.php      17-Jul-2024 20:07                3528
function.fann-get-cascade-candidate-stagnation-..> 17-Jul-2024 20:07                4154
function.fann-get-cascade-max-cand-epochs.php      17-Jul-2024 20:07                3384
function.fann-get-cascade-max-out-epochs.php       17-Jul-2024 20:07                3350
function.fann-get-cascade-min-cand-epochs.php      17-Jul-2024 20:07                3698
function.fann-get-cascade-min-out-epochs.php       17-Jul-2024 20:07                3673
function.fann-get-cascade-num-candidate-groups.php 17-Jul-2024 20:07                3724
function.fann-get-cascade-num-candidates.php       17-Jul-2024 20:07                5737
function.fann-get-cascade-output-change-fractio..> 17-Jul-2024 20:07                4875
function.fann-get-cascade-output-stagnation-epo..> 17-Jul-2024 20:07                4099
function.fann-get-cascade-weight-multiplier.php    17-Jul-2024 20:07                3430
function.fann-get-connection-array.php             17-Jul-2024 20:07                2622
function.fann-get-connection-rate.php              17-Jul-2024 20:07                2732
function.fann-get-errno.php                        17-Jul-2024 20:07                3325
function.fann-get-errstr.php                       17-Jul-2024 20:07                3349
function.fann-get-layer-array.php                  17-Jul-2024 20:07                2685
function.fann-get-learning-momentum.php            17-Jul-2024 20:07                3799
function.fann-get-learning-rate.php                17-Jul-2024 20:07                3800
function.fann-get-mse.php                          17-Jul-2024 20:07                3139
function.fann-get-network-type.php                 17-Jul-2024 20:07                2726
function.fann-get-num-input.php                    17-Jul-2024 20:07                2635
function.fann-get-num-layers.php                   17-Jul-2024 20:07                2632
function.fann-get-num-output.php                   17-Jul-2024 20:07                2652
function.fann-get-quickprop-decay.php              17-Jul-2024 20:07                3255
function.fann-get-quickprop-mu.php                 17-Jul-2024 20:07                3220
function.fann-get-rprop-decrease-factor.php        17-Jul-2024 20:07                3287
function.fann-get-rprop-delta-max.php              17-Jul-2024 20:07                3330
function.fann-get-rprop-delta-min.php              17-Jul-2024 20:07                3157
function.fann-get-rprop-delta-zero.php             17-Jul-2024 20:07                3508
function.fann-get-rprop-increase-factor.php        17-Jul-2024 20:07                3303
function.fann-get-sarprop-step-error-shift.php     17-Jul-2024 20:07                3691
function.fann-get-sarprop-step-error-threshold-..> 17-Jul-2024 20:07                3841
function.fann-get-sarprop-temperature.php          17-Jul-2024 20:07                3574
function.fann-get-sarprop-weight-decay-shift.php   17-Jul-2024 20:07                3688
function.fann-get-total-connections.php            17-Jul-2024 20:07                2777
function.fann-get-total-neurons.php                17-Jul-2024 20:07                2844
function.fann-get-train-error-function.php         17-Jul-2024 20:07                3608
function.fann-get-train-stop-function.php          17-Jul-2024 20:07                3577
function.fann-get-training-algorithm.php           17-Jul-2024 20:07                3814
function.fann-init-weights.php                     17-Jul-2024 20:07                4274
function.fann-length-train-data.php                17-Jul-2024 20:07                2911
function.fann-merge-train-data.php                 17-Jul-2024 20:07                3247
function.fann-num-input-train-data.php             17-Jul-2024 20:07                3485
function.fann-num-output-train-data.php            17-Jul-2024 20:07                3480
function.fann-print-error.php                      17-Jul-2024 20:07                3042
function.fann-randomize-weights.php                17-Jul-2024 20:07                3965
function.fann-read-train-from-file.php             17-Jul-2024 20:07                4983
function.fann-reset-errno.php                      17-Jul-2024 20:07                3222
function.fann-reset-errstr.php                     17-Jul-2024 20:07                3212
function.fann-reset-mse.php                        17-Jul-2024 20:07                3412
function.fann-run.php                              17-Jul-2024 20:07                2878
function.fann-save-train.php                       17-Jul-2024 20:07                3512
function.fann-save.php                             17-Jul-2024 20:07                4272
function.fann-scale-input-train-data.php           17-Jul-2024 20:07                4092
function.fann-scale-input.php                      17-Jul-2024 20:07                3768
function.fann-scale-output-train-data.php          17-Jul-2024 20:07                4117
function.fann-scale-output.php                     17-Jul-2024 20:07                3766
function.fann-scale-train-data.php                 17-Jul-2024 20:07                4090
function.fann-scale-train.php                      17-Jul-2024 20:07                3735
function.fann-set-activation-function-hidden.php   17-Jul-2024 20:07                4388
function.fann-set-activation-function-layer.php    17-Jul-2024 20:07                4865
function.fann-set-activation-function-output.php   17-Jul-2024 20:07                4405
function.fann-set-activation-function.php          17-Jul-2024 20:07                6277
function.fann-set-activation-steepness-hidden.php  17-Jul-2024 20:07                4618
function.fann-set-activation-steepness-layer.php   17-Jul-2024 20:07                5045
function.fann-set-activation-steepness-output.php  17-Jul-2024 20:07                4596
function.fann-set-activation-steepness.php         17-Jul-2024 20:07                5838
function.fann-set-bit-fail-limit.php               17-Jul-2024 20:07                3456
function.fann-set-callback.php                     17-Jul-2024 20:07                5569
function.fann-set-cascade-activation-functions.php 17-Jul-2024 20:07                4062
function.fann-set-cascade-activation-steepnesse..> 17-Jul-2024 20:07                4258
function.fann-set-cascade-candidate-change-frac..> 17-Jul-2024 20:07                3795
function.fann-set-cascade-candidate-limit.php      17-Jul-2024 20:07                3627
function.fann-set-cascade-candidate-stagnation-..> 17-Jul-2024 20:07                3827
function.fann-set-cascade-max-cand-epochs.php      17-Jul-2024 20:07                3648
function.fann-set-cascade-max-out-epochs.php       17-Jul-2024 20:07                3596
function.fann-set-cascade-min-cand-epochs.php      17-Jul-2024 20:07                3945
function.fann-set-cascade-min-out-epochs.php       17-Jul-2024 20:07                3934
function.fann-set-cascade-num-candidate-groups.php 17-Jul-2024 20:07                3683
function.fann-set-cascade-output-change-fractio..> 17-Jul-2024 20:07                3764
function.fann-set-cascade-output-stagnation-epo..> 17-Jul-2024 20:07                3806
function.fann-set-cascade-weight-multiplier.php    17-Jul-2024 20:07                3603
function.fann-set-error-log.php                    17-Jul-2024 20:07                3068
function.fann-set-input-scaling-params.php         17-Jul-2024 20:07                4447
function.fann-set-learning-momentum.php            17-Jul-2024 20:07                3840
function.fann-set-learning-rate.php                17-Jul-2024 20:07                3782
function.fann-set-output-scaling-params.php        17-Jul-2024 20:07                4459
function.fann-set-quickprop-decay.php              17-Jul-2024 20:07                3529
function.fann-set-quickprop-mu.php                 17-Jul-2024 20:07                3432
function.fann-set-rprop-decrease-factor.php        17-Jul-2024 20:07                3599
function.fann-set-rprop-delta-max.php              17-Jul-2024 20:07                3667
function.fann-set-rprop-delta-min.php              17-Jul-2024 20:07                3484
function.fann-set-rprop-delta-zero.php             17-Jul-2024 20:07                3840
function.fann-set-rprop-increase-factor.php        17-Jul-2024 20:07                3619
function.fann-set-sarprop-step-error-shift.php     17-Jul-2024 20:07                4041
function.fann-set-sarprop-step-error-threshold-..> 17-Jul-2024 20:07                4214
function.fann-set-sarprop-temperature.php          17-Jul-2024 20:07                3928
function.fann-set-sarprop-weight-decay-shift.php   17-Jul-2024 20:07                4044
function.fann-set-scaling-params.php               17-Jul-2024 20:07                5427
function.fann-set-train-error-function.php         17-Jul-2024 20:07                3804
function.fann-set-train-stop-function.php          17-Jul-2024 20:07                3794
function.fann-set-training-algorithm.php           17-Jul-2024 20:07                3740
function.fann-set-weight-array.php                 17-Jul-2024 20:07                3279
function.fann-set-weight.php                       17-Jul-2024 20:07                3716
function.fann-shuffle-train-data.php               17-Jul-2024 20:07                2861
function.fann-subset-train-data.php                17-Jul-2024 20:07                4218
function.fann-test-data.php                        17-Jul-2024 20:07                4083
function.fann-test.php                             17-Jul-2024 20:07                4478
function.fann-train-epoch.php                      17-Jul-2024 20:07                4414
function.fann-train-on-data.php                    17-Jul-2024 20:07                6348
function.fann-train-on-file.php                    17-Jul-2024 20:07                6346
function.fann-train.php                            17-Jul-2024 20:07                4606
function.fastcgi-finish-request.php                17-Jul-2024 20:07                2559
function.fbird-add-user.php                        17-Jul-2024 20:07                2322
function.fbird-affected-rows.php                   17-Jul-2024 20:07                2340
function.fbird-backup.php                          17-Jul-2024 20:07                1777
function.fbird-blob-add.php                        17-Jul-2024 20:07                2651
function.fbird-blob-cancel.php                     17-Jul-2024 20:07                3682
function.fbird-blob-close.php                      17-Jul-2024 20:07                2682
function.fbird-blob-create.php                     17-Jul-2024 20:07                2682
function.fbird-blob-echo.php                       17-Jul-2024 20:07                2485
function.fbird-blob-get.php                        17-Jul-2024 20:07                2478
function.fbird-blob-import.php                     17-Jul-2024 20:07                2678
function.fbird-blob-info.php                       17-Jul-2024 20:07                1809
function.fbird-blob-open.php                       17-Jul-2024 20:07                2475
function.fbird-close.php                           17-Jul-2024 20:07                2263
function.fbird-commit-ret.php                      17-Jul-2024 20:07                1802
function.fbird-commit.php                          17-Jul-2024 20:07                1770
function.fbird-connect.php                         17-Jul-2024 20:07                2269
function.fbird-db-info.php                         17-Jul-2024 20:07                1783
function.fbird-delete-user.php                     17-Jul-2024 20:07                2337
function.fbird-drop-db.php                         17-Jul-2024 20:07                2285
function.fbird-errcode.php                         17-Jul-2024 20:07                2110
function.fbird-errmsg.php                          17-Jul-2024 20:07                2103
function.fbird-execute.php                         17-Jul-2024 20:07                2115
function.fbird-fetch-assoc.php                     17-Jul-2024 20:07                2353
function.fbird-fetch-object.php                    17-Jul-2024 20:07                2364
function.fbird-fetch-row.php                       17-Jul-2024 20:07                2341
function.fbird-field-info.php                      17-Jul-2024 20:07                2185
function.fbird-free-event-handler.php              17-Jul-2024 20:07                2289
function.fbird-free-query.php                      17-Jul-2024 20:07                1838
function.fbird-free-result.php                     17-Jul-2024 20:07                1823
function.fbird-gen-id.php                          17-Jul-2024 20:07                1780
function.fbird-maintain-db.php                     17-Jul-2024 20:07                1825
function.fbird-modify-user.php                     17-Jul-2024 20:07                2353
function.fbird-name-result.php                     17-Jul-2024 20:07                2336
function.fbird-num-fields.php                      17-Jul-2024 20:07                2174
function.fbird-num-params.php                      17-Jul-2024 20:07                2331
function.fbird-param-info.php                      17-Jul-2024 20:07                2336
function.fbird-pconnect.php                        17-Jul-2024 20:07                2286
function.fbird-prepare.php                         17-Jul-2024 20:07                1773
function.fbird-query.php                           17-Jul-2024 20:07                2598
function.fbird-restore.php                         17-Jul-2024 20:07                1780
function.fbird-rollback-ret.php                    17-Jul-2024 20:07                1832
function.fbird-rollback.php                        17-Jul-2024 20:07                1804
function.fbird-server-info.php                     17-Jul-2024 20:07                1835
function.fbird-service-attach.php                  17-Jul-2024 20:07                1874
function.fbird-service-detach.php                  17-Jul-2024 20:07                1886
function.fbird-set-event-handler.php               17-Jul-2024 20:07                2446
function.fbird-trans.php                           17-Jul-2024 20:07                1779
function.fbird-wait-event.php                      17-Jul-2024 20:07                2371
function.fclose.php                                17-Jul-2024 20:07                4373
function.fdatasync.php                             17-Jul-2024 20:07                5910
function.fdf-add-doc-javascript.php                17-Jul-2024 20:07                5537
function.fdf-add-template.php                      17-Jul-2024 20:07                2885
function.fdf-close.php                             17-Jul-2024 20:07                3068
function.fdf-create.php                            17-Jul-2024 20:07                5574
function.fdf-enum-values.php                       17-Jul-2024 20:07                2458
function.fdf-errno.php                             17-Jul-2024 20:07                2743
function.fdf-error.php                             17-Jul-2024 20:07                3197
function.fdf-get-ap.php                            17-Jul-2024 20:07                4420
function.fdf-get-attachment.php                    17-Jul-2024 20:07                6092
function.fdf-get-encoding.php                      17-Jul-2024 20:07                3379
function.fdf-get-file.php                          17-Jul-2024 20:07                3199
function.fdf-get-flags.php                         17-Jul-2024 20:07                2378
function.fdf-get-opt.php                           17-Jul-2024 20:07                2417
function.fdf-get-status.php                        17-Jul-2024 20:07                3218
function.fdf-get-value.php                         17-Jul-2024 20:07                4512
function.fdf-get-version.php                       17-Jul-2024 20:07                3578
function.fdf-header.php                            17-Jul-2024 20:07                2312
function.fdf-next-field-name.php                   17-Jul-2024 20:07                5381
function.fdf-open-string.php                       17-Jul-2024 20:07                4837
function.fdf-open.php                              17-Jul-2024 20:07                5848
function.fdf-remove-item.php                       17-Jul-2024 20:07                2391
function.fdf-save-string.php                       17-Jul-2024 20:07                5603
function.fdf-save.php                              17-Jul-2024 20:07                4086
function.fdf-set-ap.php                            17-Jul-2024 20:07                4647
function.fdf-set-encoding.php                      17-Jul-2024 20:07                3775
function.fdf-set-file.php                          17-Jul-2024 20:07                6714
function.fdf-set-flags.php                         17-Jul-2024 20:07                4392
function.fdf-set-javascript-action.php             17-Jul-2024 20:07                4589
function.fdf-set-on-import-javascript.php          17-Jul-2024 20:07                3162
function.fdf-set-opt.php                           17-Jul-2024 20:07                4675
function.fdf-set-status.php                        17-Jul-2024 20:07                3805
function.fdf-set-submit-form-action.php            17-Jul-2024 20:07                4888
function.fdf-set-target-frame.php                  17-Jul-2024 20:07                3805
function.fdf-set-value.php                         17-Jul-2024 20:07                5244
function.fdf-set-version.php                       17-Jul-2024 20:07                4029
function.fdiv.php                                  17-Jul-2024 20:07                6342
function.feof.php                                  17-Jul-2024 20:07                7647
function.fflush.php                                17-Jul-2024 20:07                6200
function.fgetc.php                                 17-Jul-2024 20:07                6390
function.fgetcsv.php                               17-Jul-2024 20:07               12453
function.fgets.php                                 17-Jul-2024 20:07                8351
function.fgetss.php                                17-Jul-2024 20:07                9119
function.file-exists.php                           17-Jul-2024 20:07                6439
function.file-get-contents.php                     17-Jul-2024 20:07               17885
function.file-put-contents.php                     17-Jul-2024 20:07               12592
function.file.php                                  17-Jul-2024 20:07               11574
function.fileatime.php                             17-Jul-2024 20:07                6626
function.filectime.php                             17-Jul-2024 20:07                6769
function.filegroup.php                             17-Jul-2024 20:07                5612
function.fileinode.php                             17-Jul-2024 20:07                5223
function.filemtime.php                             17-Jul-2024 20:07                6457
function.fileowner.php                             17-Jul-2024 20:07                5467
function.fileperms.php                             17-Jul-2024 20:07               15942
function.filesize.php                              17-Jul-2024 20:07                5643
function.filetype.php                              17-Jul-2024 20:07                6545
function.filter-has-var.php                        17-Jul-2024 20:07                3406
function.filter-id.php                             17-Jul-2024 20:07                2996
function.filter-input-array.php                    17-Jul-2024 20:07               13122
function.filter-input.php                          17-Jul-2024 20:07                8498
function.filter-list.php                           17-Jul-2024 20:07                3669
function.filter-var-array.php                      17-Jul-2024 20:07               12074
function.filter-var.php                            17-Jul-2024 20:07               14196
function.finfo-buffer.php                          17-Jul-2024 20:07                8436
function.finfo-close.php                           17-Jul-2024 20:07                3524
function.finfo-file.php                            17-Jul-2024 20:07                8940
function.finfo-open.php                            17-Jul-2024 20:07               10010
function.finfo-set-flags.php                       17-Jul-2024 20:07                4639
function.floatval.php                              17-Jul-2024 20:07                6552
function.flock.php                                 17-Jul-2024 20:07               12625
function.floor.php                                 17-Jul-2024 20:07                4858
function.flush.php                                 17-Jul-2024 20:07                4429
function.fmod.php                                  17-Jul-2024 20:07                4905
function.fnmatch.php                               17-Jul-2024 20:07               10638
function.fopen.php                                 17-Jul-2024 20:07               21891
function.forward-static-call-array.php             17-Jul-2024 20:07                9379
function.forward-static-call.php                   17-Jul-2024 20:07                8840
function.fpassthru.php                             17-Jul-2024 20:07                6983
function.fpm-get-status.php                        17-Jul-2024 20:07                2710
function.fprintf.php                               17-Jul-2024 20:07               21649
function.fputcsv.php                               17-Jul-2024 20:07               10143
function.fputs.php                                 17-Jul-2024 20:07                1672
function.fread.php                                 17-Jul-2024 20:07               14418
function.frenchtojd.php                            17-Jul-2024 20:07                3942
function.fscanf.php                                17-Jul-2024 20:07                9049
function.fseek.php                                 17-Jul-2024 20:07                7693
function.fsockopen.php                             17-Jul-2024 20:07               16441
function.fstat.php                                 17-Jul-2024 20:07                5970
function.fsync.php                                 17-Jul-2024 20:07                5655
function.ftell.php                                 17-Jul-2024 20:07                6001
function.ftok.php                                  17-Jul-2024 20:07                3640
function.ftp-alloc.php                             17-Jul-2024 20:07                8284
function.ftp-append.php                            17-Jul-2024 20:07                4517
function.ftp-cdup.php                              17-Jul-2024 20:07                6605
function.ftp-chdir.php                             17-Jul-2024 20:07                7396
function.ftp-chmod.php                             17-Jul-2024 20:07                7038
function.ftp-close.php                             17-Jul-2024 20:07                5976
function.ftp-connect.php                           17-Jul-2024 20:07                6440
function.ftp-delete.php                            17-Jul-2024 20:07                6244
function.ftp-exec.php                              17-Jul-2024 20:07                6676
function.ftp-fget.php                              17-Jul-2024 20:07                9989
function.ftp-fput.php                              17-Jul-2024 20:07                9390
function.ftp-get-option.php                        17-Jul-2024 20:07                6146
function.ftp-get.php                               17-Jul-2024 20:07                9313
function.ftp-login.php                             17-Jul-2024 20:07                6817
function.ftp-mdtm.php                              17-Jul-2024 20:07                6973
function.ftp-mkdir.php                             17-Jul-2024 20:07                6859
function.ftp-mlsd.php                              17-Jul-2024 20:07                9062
function.ftp-nb-continue.php                       17-Jul-2024 20:07                5527
function.ftp-nb-fget.php                           17-Jul-2024 20:07               10509
function.ftp-nb-fput.php                           17-Jul-2024 20:07               10302
function.ftp-nb-get.php                            17-Jul-2024 20:07               14097
function.ftp-nb-put.php                            17-Jul-2024 20:07               11720
function.ftp-nlist.php                             17-Jul-2024 20:07                7082
function.ftp-pasv.php                              17-Jul-2024 20:07                7174
function.ftp-put.php                               17-Jul-2024 20:07                9052
function.ftp-pwd.php                               17-Jul-2024 20:07                5979
function.ftp-quit.php                              17-Jul-2024 20:07                1707
function.ftp-raw.php                               17-Jul-2024 20:07                5522
function.ftp-rawlist.php                           17-Jul-2024 20:07                8127
function.ftp-rename.php                            17-Jul-2024 20:07                7182
function.ftp-rmdir.php                             17-Jul-2024 20:07                6474
function.ftp-set-option.php                        17-Jul-2024 20:07                7149
function.ftp-site.php                              17-Jul-2024 20:07                6562
function.ftp-size.php                              17-Jul-2024 20:07                6720
function.ftp-ssl-connect.php                       17-Jul-2024 20:07                8665
function.ftp-systype.php                           17-Jul-2024 20:07                5520
function.ftruncate.php                             17-Jul-2024 20:07                6470
function.func-get-arg.php                          17-Jul-2024 20:07               11010
function.func-get-args.php                         17-Jul-2024 20:07               11592
function.func-num-args.php                         17-Jul-2024 20:07                5789
function.function-exists.php                       17-Jul-2024 20:07                5992
function.fwrite.php                                17-Jul-2024 20:07               14456
function.gc-collect-cycles.php                     17-Jul-2024 20:07                2514
function.gc-disable.php                            17-Jul-2024 20:07                2519
function.gc-enable.php                             17-Jul-2024 20:07                2497
function.gc-enabled.php                            17-Jul-2024 20:07                3350
function.gc-mem-caches.php                         17-Jul-2024 20:07                2463
function.gc-status.php                             17-Jul-2024 20:07                8625
function.gd-info.php                               17-Jul-2024 20:07                9015
function.geoip-asnum-by-name.php                   17-Jul-2024 20:07                4200
function.geoip-continent-code-by-name.php          17-Jul-2024 20:07                5695
function.geoip-country-code-by-name.php            17-Jul-2024 20:07                5374
function.geoip-country-code3-by-name.php           17-Jul-2024 20:07                4998
function.geoip-country-name-by-name.php            17-Jul-2024 20:07                4941
function.geoip-database-info.php                   17-Jul-2024 20:07                4225
function.geoip-db-avail.php                        17-Jul-2024 20:07                4498
function.geoip-db-filename.php                     17-Jul-2024 20:07                4136
function.geoip-db-get-all-info.php                 17-Jul-2024 20:07                6672
function.geoip-domain-by-name.php                  17-Jul-2024 20:07                4407
function.geoip-id-by-name.php                      17-Jul-2024 20:07                5467
function.geoip-isp-by-name.php                     17-Jul-2024 20:07                4383
function.geoip-netspeedcell-by-name.php            17-Jul-2024 20:07                5058
function.geoip-org-by-name.php                     17-Jul-2024 20:07                4383
function.geoip-record-by-name.php                  17-Jul-2024 20:07                7712
function.geoip-region-by-name.php                  17-Jul-2024 20:07                4997
function.geoip-region-name-by-code.php             17-Jul-2024 20:07                7169
function.geoip-setup-custom-directory.php          17-Jul-2024 20:07                4239
function.geoip-time-zone-by-country-and-region.php 17-Jul-2024 20:07                7315
function.get-browser.php                           17-Jul-2024 20:07                8261
function.get-called-class.php                      17-Jul-2024 20:07                5989
function.get-cfg-var.php                           17-Jul-2024 20:07                3716
function.get-class-methods.php                     17-Jul-2024 20:07                6769
function.get-class-vars.php                        17-Jul-2024 20:07                9583
function.get-class.php                             17-Jul-2024 20:07               12328
function.get-current-user.php                      17-Jul-2024 20:07                4225
function.get-debug-type.php                        17-Jul-2024 20:07                9362
function.get-declared-classes.php                  17-Jul-2024 20:07                5115
function.get-declared-interfaces.php               17-Jul-2024 20:07                4247
function.get-declared-traits.php                   17-Jul-2024 20:07                2833
function.get-defined-constants.php                 17-Jul-2024 20:07                7284
function.get-defined-functions.php                 17-Jul-2024 20:07                6946
function.get-defined-vars.php                      17-Jul-2024 20:07                6051
function.get-extension-funcs.php                   17-Jul-2024 20:07                5505
function.get-headers.php                           17-Jul-2024 20:07                9206
function.get-html-translation-table.php            17-Jul-2024 20:07               13442
function.get-include-path.php                      17-Jul-2024 20:07                4335
function.get-included-files.php                    17-Jul-2024 20:07                5834
function.get-loaded-extensions.php                 17-Jul-2024 20:07                5407
function.get-magic-quotes-gpc.php                  17-Jul-2024 20:07                4089
function.get-magic-quotes-runtime.php              17-Jul-2024 20:07                3608
function.get-mangled-object-vars.php               17-Jul-2024 20:07                8042
function.get-meta-tags.php                         17-Jul-2024 20:07                7840
function.get-object-vars.php                       17-Jul-2024 20:07                6031
function.get-parent-class.php                      17-Jul-2024 20:07                7466
function.get-required-files.php                    17-Jul-2024 20:07                1847
function.get-resource-id.php                       17-Jul-2024 20:07                4776
function.get-resource-type.php                     17-Jul-2024 20:07                5259
function.get-resources.php                         17-Jul-2024 20:07                7841
function.getallheaders.php                         17-Jul-2024 20:07                4582
function.getcwd.php                                17-Jul-2024 20:07                5167
function.getdate.php                               17-Jul-2024 20:07                9319
function.getenv.php                                17-Jul-2024 20:07                8537
function.gethostbyaddr.php                         17-Jul-2024 20:07                4307
function.gethostbyname.php                         17-Jul-2024 20:07                4440
function.gethostbynamel.php                        17-Jul-2024 20:07                4965
function.gethostname.php                           17-Jul-2024 20:07                3880
function.getimagesize.php                          17-Jul-2024 20:07               16205
function.getimagesizefromstring.php                17-Jul-2024 20:07                5648
function.getlastmod.php                            17-Jul-2024 20:07                5038
function.getmxrr.php                               17-Jul-2024 20:07                5688
function.getmygid.php                              17-Jul-2024 20:07                3400
function.getmyinode.php                            17-Jul-2024 20:07                3411
function.getmypid.php                              17-Jul-2024 20:07                3703
function.getmyuid.php                              17-Jul-2024 20:07                3342
function.getopt.php                                17-Jul-2024 20:07               14973
function.getprotobyname.php                        17-Jul-2024 20:07                4692
function.getprotobynumber.php                      17-Jul-2024 20:07                3321
function.getrandmax.php                            17-Jul-2024 20:07                2942
function.getrusage.php                             17-Jul-2024 20:07               11071
function.getservbyname.php                         17-Jul-2024 20:07                6430
function.getservbyport.php                         17-Jul-2024 20:07                3809
function.gettext.php                               17-Jul-2024 20:07                5832
function.gettimeofday.php                          17-Jul-2024 20:07                4871
function.gettype.php                               17-Jul-2024 20:07                8588
function.glob.php                                  17-Jul-2024 20:07               10442
function.gmdate.php                                17-Jul-2024 20:07                7588
function.gmmktime.php                              17-Jul-2024 20:07               10767
function.gmp-abs.php                               17-Jul-2024 20:07                4550
function.gmp-add.php                               17-Jul-2024 20:07                4965
function.gmp-and.php                               17-Jul-2024 20:07                5416
function.gmp-binomial.php                          17-Jul-2024 20:07                4111
function.gmp-clrbit.php                            17-Jul-2024 20:07                5478
function.gmp-cmp.php                               17-Jul-2024 20:07                5828
function.gmp-com.php                               17-Jul-2024 20:07                4046
function.gmp-div-q.php                             17-Jul-2024 20:07               10394
function.gmp-div-qr.php                            17-Jul-2024 20:07                6964
function.gmp-div-r.php                             17-Jul-2024 20:07                6344
function.gmp-div.php                               17-Jul-2024 20:07                1699
function.gmp-divexact.php                          17-Jul-2024 20:07                6055
function.gmp-export.php                            17-Jul-2024 20:07                5686
function.gmp-fact.php                              17-Jul-2024 20:07                4915
function.gmp-gcd.php                               17-Jul-2024 20:07                5342
function.gmp-gcdext.php                            17-Jul-2024 20:07                9528
function.gmp-hamdist.php                           17-Jul-2024 20:07                6693
function.gmp-import.php                            17-Jul-2024 20:07                6005
function.gmp-init.php                              17-Jul-2024 20:07                5642
function.gmp-intval.php                            17-Jul-2024 20:07                5409
function.gmp-invert.php                            17-Jul-2024 20:07                5550
function.gmp-jacobi.php                            17-Jul-2024 20:07                5853
function.gmp-kronecker.php                         17-Jul-2024 20:07                4188
function.gmp-lcm.php                               17-Jul-2024 20:07                3956
function.gmp-legendre.php                          17-Jul-2024 20:07                5872
function.gmp-mod.php                               17-Jul-2024 20:07                5087
function.gmp-mul.php                               17-Jul-2024 20:07                5169
function.gmp-neg.php                               17-Jul-2024 20:07                4502
function.gmp-nextprime.php                         17-Jul-2024 20:07                5155
function.gmp-or.php                                17-Jul-2024 20:07                5628
function.gmp-perfect-power.php                     17-Jul-2024 20:07                3463
function.gmp-perfect-square.php                    17-Jul-2024 20:07                5703
function.gmp-popcount.php                          17-Jul-2024 20:07                4997
function.gmp-pow.php                               17-Jul-2024 20:07                5855
function.gmp-powm.php                              17-Jul-2024 20:07                6119
function.gmp-prob-prime.php                        17-Jul-2024 20:07                5967
function.gmp-random-bits.php                       17-Jul-2024 20:07                5928
function.gmp-random-range.php                      17-Jul-2024 20:07                7293
function.gmp-random-seed.php                       17-Jul-2024 20:07                7614
function.gmp-random.php                            17-Jul-2024 20:07                6341
function.gmp-root.php                              17-Jul-2024 20:07                3308
function.gmp-rootrem.php                           17-Jul-2024 20:07                3474
function.gmp-scan0.php                             17-Jul-2024 20:07                5662
function.gmp-scan1.php                             17-Jul-2024 20:07                5674
function.gmp-setbit.php                            17-Jul-2024 20:07               11602
function.gmp-sign.php                              17-Jul-2024 20:07                5146
function.gmp-sqrt.php                              17-Jul-2024 20:07                5074
function.gmp-sqrtrem.php                           17-Jul-2024 20:07                6454
function.gmp-strval.php                            17-Jul-2024 20:07                4846
function.gmp-sub.php                               17-Jul-2024 20:07                5241
function.gmp-testbit.php                           17-Jul-2024 20:07                6107
function.gmp-xor.php                               17-Jul-2024 20:07                5634
function.gmstrftime.php                            17-Jul-2024 20:07                8845
function.gnupg-adddecryptkey.php                   17-Jul-2024 20:07                5376
function.gnupg-addencryptkey.php                   17-Jul-2024 20:07                4925
function.gnupg-addsignkey.php                      17-Jul-2024 20:07                5398
function.gnupg-cleardecryptkeys.php                17-Jul-2024 20:07                4474
function.gnupg-clearencryptkeys.php                17-Jul-2024 20:07                4479
function.gnupg-clearsignkeys.php                   17-Jul-2024 20:07                4421
function.gnupg-decrypt.php                         17-Jul-2024 20:07                6141
function.gnupg-decryptverify.php                   17-Jul-2024 20:07                7293
function.gnupg-deletekey.php                       17-Jul-2024 20:07                5217
function.gnupg-encrypt.php                         17-Jul-2024 20:07                6044
function.gnupg-encryptsign.php                     17-Jul-2024 20:07                6944
function.gnupg-export.php                          17-Jul-2024 20:07                5237
function.gnupg-getengineinfo.php                   17-Jul-2024 20:07                5593
function.gnupg-geterror.php                        17-Jul-2024 20:07                4395
function.gnupg-geterrorinfo.php                    17-Jul-2024 20:07                5696
function.gnupg-getprotocol.php                     17-Jul-2024 20:07                4483
function.gnupg-gettrustlist.php                    17-Jul-2024 20:07                5305
function.gnupg-import.php                          17-Jul-2024 20:07                5502
function.gnupg-init.php                            17-Jul-2024 20:07                7311
function.gnupg-keyinfo.php                         17-Jul-2024 20:07                5429
function.gnupg-listsignatures.php                  17-Jul-2024 20:07                5529
function.gnupg-setarmor.php                        17-Jul-2024 20:07                5690
function.gnupg-seterrormode.php                    17-Jul-2024 20:07                5740
function.gnupg-setsignmode.php                     17-Jul-2024 20:07                5825
function.gnupg-sign.php                            17-Jul-2024 20:07                6286
function.gnupg-verify.php                          17-Jul-2024 20:07                8534
function.grapheme-extract.php                      17-Jul-2024 20:07                9015
function.grapheme-stripos.php                      17-Jul-2024 20:07                8230
function.grapheme-stristr.php                      17-Jul-2024 20:07                7854
function.grapheme-strlen.php                       17-Jul-2024 20:07                5570
function.grapheme-strpos.php                       17-Jul-2024 20:07                7902
function.grapheme-strripos.php                     17-Jul-2024 20:07                7688
function.grapheme-strrpos.php                      17-Jul-2024 20:07                7352
function.grapheme-strstr.php                       17-Jul-2024 20:07                7503
function.grapheme-substr.php                       17-Jul-2024 20:07                8090
function.gregoriantojd.php                         17-Jul-2024 20:07                7568
function.gzclose.php                               17-Jul-2024 20:07                4290
function.gzcompress.php                            17-Jul-2024 20:07                6053
function.gzdecode.php                              17-Jul-2024 20:07                3788
function.gzdeflate.php                             17-Jul-2024 20:07                5698
function.gzencode.php                              17-Jul-2024 20:07                7005
function.gzeof.php                                 17-Jul-2024 20:07                4168
function.gzfile.php                                17-Jul-2024 20:07                4811
function.gzgetc.php                                17-Jul-2024 20:07                4717
function.gzgets.php                                17-Jul-2024 20:07                6156
function.gzgetss.php                               17-Jul-2024 20:07                6102
function.gzinflate.php                             17-Jul-2024 20:07                5423
function.gzopen.php                                17-Jul-2024 20:07                5741
function.gzpassthru.php                            17-Jul-2024 20:07                4774
function.gzputs.php                                17-Jul-2024 20:07                1666
function.gzread.php                                17-Jul-2024 20:07                6655
function.gzrewind.php                              17-Jul-2024 20:07                3315
function.gzseek.php                                17-Jul-2024 20:07                6375
function.gztell.php                                17-Jul-2024 20:07                3475
function.gzuncompress.php                          17-Jul-2024 20:07                5383
function.gzwrite.php                               17-Jul-2024 20:07                6660
function.halt-compiler.php                         17-Jul-2024 20:07                5026
function.hash-algos.php                            17-Jul-2024 20:07                5851
function.hash-copy.php                             17-Jul-2024 20:07                5566
function.hash-equals.php                           17-Jul-2024 20:07                7256
function.hash-file.php                             17-Jul-2024 20:07                7118
function.hash-final.php                            17-Jul-2024 20:07                4957
function.hash-hkdf.php                             17-Jul-2024 20:07                9894
function.hash-hmac-algos.php                       17-Jul-2024 20:07                5214
function.hash-hmac-file.php                        17-Jul-2024 20:07                8520
function.hash-hmac.php                             17-Jul-2024 20:07                7614
function.hash-init.php                             17-Jul-2024 20:07               10503
function.hash-pbkdf2.php                           17-Jul-2024 20:07               12548
function.hash-update-file.php                      17-Jul-2024 20:07                5766
function.hash-update-stream.php                    17-Jul-2024 20:07                7139
function.hash-update.php                           17-Jul-2024 20:07                4443
function.hash.php                                  17-Jul-2024 20:07                6976
function.header-register-callback.php              17-Jul-2024 20:07                6659
function.header-remove.php                         17-Jul-2024 20:07                6671
function.header.php                                17-Jul-2024 20:07               18611
function.headers-list.php                          17-Jul-2024 20:07                5833
function.headers-sent.php                          17-Jul-2024 20:07                7899
function.hebrev.php                                17-Jul-2024 20:07                3473
function.hebrevc.php                               17-Jul-2024 20:07                3812
function.hex2bin.php                               17-Jul-2024 20:07                4979
function.hexdec.php                                17-Jul-2024 20:07                6389
function.highlight-file.php                        17-Jul-2024 20:07                5859
function.highlight-string.php                      17-Jul-2024 20:07                6820
function.hrtime.php                                17-Jul-2024 20:07                5147
function.html-entity-decode.php                    17-Jul-2024 20:07               14422
function.htmlentities.php                          17-Jul-2024 20:07               17233
function.htmlspecialchars-decode.php               17-Jul-2024 20:07                9266
function.htmlspecialchars.php                      17-Jul-2024 20:07               22254
function.http-build-query.php                      17-Jul-2024 20:07               19670
function.http-response-code.php                    17-Jul-2024 20:07                6900
function.hypot.php                                 17-Jul-2024 20:07                3027
function.ibase-add-user.php                        17-Jul-2024 20:07                5173
function.ibase-affected-rows.php                   17-Jul-2024 20:07                3444
function.ibase-backup.php                          17-Jul-2024 20:07               10478
function.ibase-blob-add.php                        17-Jul-2024 20:07                3979
function.ibase-blob-cancel.php                     17-Jul-2024 20:07                3696
function.ibase-blob-close.php                      17-Jul-2024 20:07                3966
function.ibase-blob-create.php                     17-Jul-2024 20:07                4044
function.ibase-blob-echo.php                       17-Jul-2024 20:07                4223
function.ibase-blob-get.php                        17-Jul-2024 20:07                6564
function.ibase-blob-import.php                     17-Jul-2024 20:07                7979
function.ibase-blob-info.php                       17-Jul-2024 20:07                3515
function.ibase-blob-open.php                       17-Jul-2024 20:07                4439
function.ibase-close.php                           17-Jul-2024 20:07                3798
function.ibase-commit-ret.php                      17-Jul-2024 20:07                3323
function.ibase-commit.php                          17-Jul-2024 20:07                3124
function.ibase-connect.php                         17-Jul-2024 20:07               10507
function.ibase-db-info.php                         17-Jul-2024 20:07                2709
function.ibase-delete-user.php                     17-Jul-2024 20:07                3589
function.ibase-drop-db.php                         17-Jul-2024 20:07                3696
function.ibase-errcode.php                         17-Jul-2024 20:07                2670
function.ibase-errmsg.php                          17-Jul-2024 20:07                2663
function.ibase-execute.php                         17-Jul-2024 20:07                6948
function.ibase-fetch-assoc.php                     17-Jul-2024 20:07                4719
function.ibase-fetch-object.php                    17-Jul-2024 20:07                6644
function.ibase-fetch-row.php                       17-Jul-2024 20:07                4536
function.ibase-field-info.php                      17-Jul-2024 20:07                6940
function.ibase-free-event-handler.php              17-Jul-2024 20:07                3534
function.ibase-free-query.php                      17-Jul-2024 20:07                2839
function.ibase-free-result.php                     17-Jul-2024 20:07                2931
function.ibase-gen-id.php                          17-Jul-2024 20:07                2820
function.ibase-maintain-db.php                     17-Jul-2024 20:07                3138
function.ibase-modify-user.php                     17-Jul-2024 20:07                5178
function.ibase-name-result.php                     17-Jul-2024 20:07                5785
function.ibase-num-fields.php                      17-Jul-2024 20:07                6401
function.ibase-num-params.php                      17-Jul-2024 20:07                3434
function.ibase-param-info.php                      17-Jul-2024 20:07                3686
function.ibase-pconnect.php                        17-Jul-2024 20:07                7913
function.ibase-prepare.php                         17-Jul-2024 20:07                4664
function.ibase-query.php                           17-Jul-2024 20:07                7215
function.ibase-restore.php                         17-Jul-2024 20:07               10745
function.ibase-rollback-ret.php                    17-Jul-2024 20:07                3364
function.ibase-rollback.php                        17-Jul-2024 20:07                3169
function.ibase-server-info.php                     17-Jul-2024 20:07                9827
function.ibase-service-attach.php                  17-Jul-2024 20:07               11031
function.ibase-service-detach.php                  17-Jul-2024 20:07                6147
function.ibase-set-event-handler.php               17-Jul-2024 20:07                7856
function.ibase-trans.php                           17-Jul-2024 20:07                5890
function.ibase-wait-event.php                      17-Jul-2024 20:07                4335
function.iconv-get-encoding.php                    17-Jul-2024 20:07                5596
function.iconv-mime-decode-headers.php             17-Jul-2024 20:07               10052
function.iconv-mime-decode.php                     17-Jul-2024 20:07                8262
function.iconv-mime-encode.php                     17-Jul-2024 20:07               11992
function.iconv-set-encoding.php                    17-Jul-2024 20:07                4939
function.iconv-strlen.php                          17-Jul-2024 20:07                4988
function.iconv-strpos.php                          17-Jul-2024 20:07                7439
function.iconv-strrpos.php                         17-Jul-2024 20:07                6681
function.iconv-substr.php                          17-Jul-2024 20:07                8004
function.iconv.php                                 17-Jul-2024 20:07                8804
function.idate.php                                 17-Jul-2024 20:07               11086
function.idn-to-ascii.php                          17-Jul-2024 20:07                7798
function.idn-to-utf8.php                           17-Jul-2024 20:07                7806
function.igbinary-serialize.php                    17-Jul-2024 20:07                9839
function.igbinary-unserialize.php                  17-Jul-2024 20:07                9933
function.ignore-user-abort.php                     17-Jul-2024 20:07                7186
function.image-type-to-extension.php               17-Jul-2024 20:07                5397
function.image-type-to-mime-type.php               17-Jul-2024 20:07                8995
function.image2wbmp.php                            17-Jul-2024 20:07                6389
function.imageaffine.php                           17-Jul-2024 20:07                4806
function.imageaffinematrixconcat.php               17-Jul-2024 20:07                6617
function.imageaffinematrixget.php                  17-Jul-2024 20:07                6688
function.imagealphablending.php                    17-Jul-2024 20:07                7965
function.imageantialias.php                        17-Jul-2024 20:07               10624
function.imagearc.php                              17-Jul-2024 20:07               13629
function.imageavif.php                             17-Jul-2024 20:07                6027
function.imagebmp.php                              17-Jul-2024 20:07                8214
function.imagechar.php                             17-Jul-2024 20:07               10079
function.imagecharup.php                           17-Jul-2024 20:07                9924
function.imagecolorallocate.php                    17-Jul-2024 20:07                9907
function.imagecolorallocatealpha.php               17-Jul-2024 20:07               18035
function.imagecolorat.php                          17-Jul-2024 20:07               10120
function.imagecolorclosest.php                     17-Jul-2024 20:07               11922
function.imagecolorclosestalpha.php                17-Jul-2024 20:07               12476
function.imagecolorclosesthwb.php                  17-Jul-2024 20:07                6546
function.imagecolordeallocate.php                  17-Jul-2024 20:07                5918
function.imagecolorexact.php                       17-Jul-2024 20:07                8441
function.imagecolorexactalpha.php                  17-Jul-2024 20:07                9375
function.imagecolormatch.php                       17-Jul-2024 20:07                8424
function.imagecolorresolve.php                     17-Jul-2024 20:07                7634
function.imagecolorresolvealpha.php                17-Jul-2024 20:07                8308
function.imagecolorset.php                         17-Jul-2024 20:07                8862
function.imagecolorsforindex.php                   17-Jul-2024 20:07                7315
function.imagecolorstotal.php                      17-Jul-2024 20:07                5747
function.imagecolortransparent.php                 17-Jul-2024 20:07                9035
function.imageconvolution.php                      17-Jul-2024 20:07               11865
function.imagecopy.php                             17-Jul-2024 20:07                9358
function.imagecopymerge.php                        17-Jul-2024 20:07                9607
function.imagecopymergegray.php                    17-Jul-2024 20:07               10039
function.imagecopyresampled.php                    17-Jul-2024 20:07               18935
function.imagecopyresized.php                      17-Jul-2024 20:07               13762
function.imagecreate.php                           17-Jul-2024 20:07                8214
function.imagecreatefromavif.php                   17-Jul-2024 20:07                2915
function.imagecreatefrombmp.php                    17-Jul-2024 20:07                5506
function.imagecreatefromgd.php                     17-Jul-2024 20:07                6049
function.imagecreatefromgd2.php                    17-Jul-2024 20:07                6326
function.imagecreatefromgd2part.php                17-Jul-2024 20:07                8874
function.imagecreatefromgif.php                    17-Jul-2024 20:07                9541
function.imagecreatefromjpeg.php                   17-Jul-2024 20:07                9229
function.imagecreatefrompng.php                    17-Jul-2024 20:07                9189
function.imagecreatefromstring.php                 17-Jul-2024 20:07                7942
function.imagecreatefromtga.php                    17-Jul-2024 20:07                3553
function.imagecreatefromwbmp.php                   17-Jul-2024 20:07                9284
function.imagecreatefromwebp.php                   17-Jul-2024 20:07                5597
function.imagecreatefromxbm.php                    17-Jul-2024 20:07                5445
function.imagecreatefromxpm.php                    17-Jul-2024 20:07                6089
function.imagecreatetruecolor.php                  17-Jul-2024 20:07                7124
function.imagecrop.php                             17-Jul-2024 20:07                7879
function.imagecropauto.php                         17-Jul-2024 20:07               11603
function.imagedashedline.php                       17-Jul-2024 20:07               12668
function.imagedestroy.php                          17-Jul-2024 20:07                5129
function.imageellipse.php                          17-Jul-2024 20:07                9627
function.imagefill.php                             17-Jul-2024 20:07                7641
function.imagefilledarc.php                        17-Jul-2024 20:07               18876
function.imagefilledellipse.php                    17-Jul-2024 20:07                9848
function.imagefilledpolygon.php                    17-Jul-2024 20:07               12053
function.imagefilledrectangle.php                  17-Jul-2024 20:07                8437
function.imagefilltoborder.php                     17-Jul-2024 20:07               11353
function.imagefilter.php                           17-Jul-2024 20:07               33707
function.imageflip.php                             17-Jul-2024 20:07                9850
function.imagefontheight.php                       17-Jul-2024 20:07                6458
function.imagefontwidth.php                        17-Jul-2024 20:07                6421
function.imageftbbox.php                           17-Jul-2024 20:07               13915
function.imagefttext.php                           17-Jul-2024 20:07               15430
function.imagegammacorrect.php                     17-Jul-2024 20:07                6032
function.imagegd.php                               17-Jul-2024 20:07               10655
function.imagegd2.php                              17-Jul-2024 20:07               11640
function.imagegetclip.php                          17-Jul-2024 20:07                6126
function.imagegetinterpolation.php                 17-Jul-2024 20:07                3759
function.imagegif.php                              17-Jul-2024 20:07               16454
function.imagegrabscreen.php                       17-Jul-2024 20:07                4818
function.imagegrabwindow.php                       17-Jul-2024 20:07                9946
function.imageinterlace.php                        17-Jul-2024 20:07                7200
function.imageistruecolor.php                      17-Jul-2024 20:07                7391
function.imagejpeg.php                             17-Jul-2024 20:07               14940
function.imagelayereffect.php                      17-Jul-2024 20:07               11973
function.imageline.php                             17-Jul-2024 20:07               15579
function.imageloadfont.php                         17-Jul-2024 20:07                9306
function.imageopenpolygon.php                      17-Jul-2024 20:07               10541
function.imagepalettecopy.php                      17-Jul-2024 20:07                7437
function.imagepalettetotruecolor.php               17-Jul-2024 20:07                9813
function.imagepng.php                              17-Jul-2024 20:07                8875
function.imagepolygon.php                          17-Jul-2024 20:07               10700
function.imagerectangle.php                        17-Jul-2024 20:07               10600
function.imageresolution.php                       17-Jul-2024 20:07                7959
function.imagerotate.php                           17-Jul-2024 20:07                8981
function.imagesavealpha.php                        17-Jul-2024 20:07                7638
function.imagescale.php                            17-Jul-2024 20:07                6858
function.imagesetbrush.php                         17-Jul-2024 20:07                9318
function.imagesetclip.php                          17-Jul-2024 20:07                5320
function.imagesetinterpolation.php                 17-Jul-2024 20:07               11648
function.imagesetpixel.php                         17-Jul-2024 20:07               11492
function.imagesetstyle.php                         17-Jul-2024 20:07               12312
function.imagesetthickness.php                     17-Jul-2024 20:07                8463
function.imagesettile.php                          17-Jul-2024 20:07                8366
function.imagestring.php                           17-Jul-2024 20:07               10256
function.imagestringup.php                         17-Jul-2024 20:07                9435
function.imagesx.php                               17-Jul-2024 20:07                5058
function.imagesy.php                               17-Jul-2024 20:07                5078
function.imagetruecolortopalette.php               17-Jul-2024 20:07                6782
function.imagettfbbox.php                          17-Jul-2024 20:07               19011
function.imagettftext.php                          17-Jul-2024 20:07               17516
function.imagetypes.php                            17-Jul-2024 20:07                4992
function.imagewbmp.php                             17-Jul-2024 20:07               15080
function.imagewebp.php                             17-Jul-2024 20:07                7587
function.imagexbm.php                              17-Jul-2024 20:07               11794
function.imap-8bit.php                             17-Jul-2024 20:07                3167
function.imap-alerts.php                           17-Jul-2024 20:07                3249
function.imap-append.php                           17-Jul-2024 20:07                9624
function.imap-base64.php                           17-Jul-2024 20:07                3544
function.imap-binary.php                           17-Jul-2024 20:07                3133
function.imap-body.php                             17-Jul-2024 20:07                5617
function.imap-bodystruct.php                       17-Jul-2024 20:07                4712
function.imap-check.php                            17-Jul-2024 20:07                6028
function.imap-clearflag-full.php                   17-Jul-2024 20:07                6458
function.imap-close.php                            17-Jul-2024 20:07                4971
function.imap-create.php                           17-Jul-2024 20:07                1770
function.imap-createmailbox.php                    17-Jul-2024 20:07               13831
function.imap-delete.php                           17-Jul-2024 20:07               10498
function.imap-deletemailbox.php                    17-Jul-2024 20:07                4934
function.imap-errors.php                           17-Jul-2024 20:07                3436
function.imap-expunge.php                          17-Jul-2024 20:07                3609
function.imap-fetch-overview.php                   17-Jul-2024 20:07               11301
function.imap-fetchbody.php                        17-Jul-2024 20:07                6211
function.imap-fetchheader.php                      17-Jul-2024 20:07                5862
function.imap-fetchmime.php                        17-Jul-2024 20:07                6400
function.imap-fetchstructure.php                   17-Jul-2024 20:07                9714
function.imap-fetchtext.php                        17-Jul-2024 20:07                1751
function.imap-gc.php                               17-Jul-2024 20:07                5851
function.imap-get-quota.php                        17-Jul-2024 20:07               12208
function.imap-get-quotaroot.php                    17-Jul-2024 20:07                9156
function.imap-getacl.php                           17-Jul-2024 20:07                5876
function.imap-getmailboxes.php                     17-Jul-2024 20:07               12098
function.imap-getsubscribed.php                    17-Jul-2024 20:07                7830
function.imap-header.php                           17-Jul-2024 20:07                1962
function.imap-headerinfo.php                       17-Jul-2024 20:07               11766
function.imap-headers.php                          17-Jul-2024 20:07                3492
function.imap-is-open.php                          17-Jul-2024 20:07                4218
function.imap-last-error.php                       17-Jul-2024 20:07                3165
function.imap-list.php                             17-Jul-2024 20:07                8611
function.imap-listmailbox.php                      17-Jul-2024 20:07                1756
function.imap-listscan.php                         17-Jul-2024 20:07                6886
function.imap-listsubscribed.php                   17-Jul-2024 20:07                1777
function.imap-lsub.php                             17-Jul-2024 20:07                5933
function.imap-mail-compose.php                     17-Jul-2024 20:07               16585
function.imap-mail-copy.php                        17-Jul-2024 20:07                6262
function.imap-mail-move.php                        17-Jul-2024 20:07                6645
function.imap-mail.php                             17-Jul-2024 20:07                7399
function.imap-mailboxmsginfo.php                   17-Jul-2024 20:07                9271
function.imap-mime-header-decode.php               17-Jul-2024 20:07                6487
function.imap-msgno.php                            17-Jul-2024 20:07                4175
function.imap-mutf7-to-utf8.php                    17-Jul-2024 20:07                3357
function.imap-num-msg.php                          17-Jul-2024 20:07                4032
function.imap-num-recent.php                       17-Jul-2024 20:07                3839
function.imap-open.php                             17-Jul-2024 20:07               21764
function.imap-ping.php                             17-Jul-2024 20:07                4916
function.imap-qprint.php                           17-Jul-2024 20:07                3179
function.imap-rename.php                           17-Jul-2024 20:07                1773
function.imap-renamemailbox.php                    17-Jul-2024 20:07                5574
function.imap-reopen.php                           17-Jul-2024 20:07                8773
function.imap-rfc822-parse-adrlist.php             17-Jul-2024 20:07                7877
function.imap-rfc822-parse-headers.php             17-Jul-2024 20:07                3726
function.imap-rfc822-write-address.php             17-Jul-2024 20:07                5402
function.imap-savebody.php                         17-Jul-2024 20:07                6599
function.imap-scan.php                             17-Jul-2024 20:07                1738
function.imap-scanmailbox.php                      17-Jul-2024 20:07                1768
function.imap-search.php                           17-Jul-2024 20:07               13547
function.imap-set-quota.php                        17-Jul-2024 20:07                6753
function.imap-setacl.php                           17-Jul-2024 20:07                5491
function.imap-setflag-full.php                     17-Jul-2024 20:07                8630
function.imap-sort.php                             17-Jul-2024 20:07                8553
function.imap-status.php                           17-Jul-2024 20:07               10742
function.imap-subscribe.php                        17-Jul-2024 20:07                4442
function.imap-thread.php                           17-Jul-2024 20:07                7894
function.imap-timeout.php                          17-Jul-2024 20:07                4789
function.imap-uid.php                              17-Jul-2024 20:07                4588
function.imap-undelete.php                         17-Jul-2024 20:07                4978
function.imap-unsubscribe.php                      17-Jul-2024 20:07                4519
function.imap-utf7-decode.php                      17-Jul-2024 20:07                3756
function.imap-utf7-encode.php                      17-Jul-2024 20:07                3273
function.imap-utf8-to-mutf7.php                    17-Jul-2024 20:07                3360
function.imap-utf8.php                             17-Jul-2024 20:07                4248
function.implode.php                               17-Jul-2024 20:07                7714
function.in-array.php                              17-Jul-2024 20:07               11661
function.include-once.php                          17-Jul-2024 20:07                2136
function.include.php                               17-Jul-2024 20:07               19416
function.inet-ntop.php                             17-Jul-2024 20:07                6283
function.inet-pton.php                             17-Jul-2024 20:07                4840
function.inflate-add.php                           17-Jul-2024 20:07                6266
function.inflate-get-read-len.php                  17-Jul-2024 20:07                3427
function.inflate-get-status.php                    17-Jul-2024 20:07                3361
function.inflate-init.php                          17-Jul-2024 20:07                7085
function.ini-alter.php                             17-Jul-2024 20:07                1706
function.ini-get-all.php                           17-Jul-2024 20:07                9954
function.ini-get.php                               17-Jul-2024 20:07               10282
function.ini-parse-quantity.php                    17-Jul-2024 20:07                7569
function.ini-restore.php                           17-Jul-2024 20:07                6296
function.ini-set.php                               17-Jul-2024 20:07                6558
function.inotify-add-watch.php                     17-Jul-2024 20:07                4420
function.inotify-init.php                          17-Jul-2024 20:07                8901
function.inotify-queue-len.php                     17-Jul-2024 20:07                3793
function.inotify-read.php                          17-Jul-2024 20:07                4392
function.inotify-rm-watch.php                      17-Jul-2024 20:07                3652
function.intdiv.php                                17-Jul-2024 20:07                7451
function.interface-exists.php                      17-Jul-2024 20:07                5337
function.intl-error-name.php                       17-Jul-2024 20:07                5031
function.intl-get-error-code.php                   17-Jul-2024 20:07                4527
function.intl-get-error-message.php                17-Jul-2024 20:07                4538
function.intl-is-failure.php                       17-Jul-2024 20:07                5497
function.intval.php                                17-Jul-2024 20:07               13494
function.ip2long.php                               17-Jul-2024 20:07                9083
function.iptcembed.php                             17-Jul-2024 20:07               11738
function.iptcparse.php                             17-Jul-2024 20:07                4630
function.is-a.php                                  17-Jul-2024 20:07                6933
function.is-array.php                              17-Jul-2024 20:07                5605
function.is-bool.php                               17-Jul-2024 20:07                5388
function.is-callable.php                           17-Jul-2024 20:07               10648
function.is-countable.php                          17-Jul-2024 20:07                6168
function.is-dir.php                                17-Jul-2024 20:07                6481
function.is-double.php                             17-Jul-2024 20:07                1703
function.is-executable.php                         17-Jul-2024 20:07                6379
function.is-file.php                               17-Jul-2024 20:07                5973
function.is-finite.php                             17-Jul-2024 20:07                6252
function.is-float.php                              17-Jul-2024 20:07                6442
function.is-infinite.php                           17-Jul-2024 20:07                5423
function.is-int.php                                17-Jul-2024 20:07                6513
function.is-integer.php                            17-Jul-2024 20:07                1696
function.is-iterable.php                           17-Jul-2024 20:07                5765
function.is-link.php                               17-Jul-2024 20:07                5643
function.is-long.php                               17-Jul-2024 20:07                1677
function.is-nan.php                                17-Jul-2024 20:07                6432
function.is-null.php                               17-Jul-2024 20:07                5948
function.is-numeric.php                            17-Jul-2024 20:07               11858
function.is-object.php                             17-Jul-2024 20:07                7020
function.is-readable.php                           17-Jul-2024 20:07                6196
function.is-real.php                               17-Jul-2024 20:07                1876
function.is-resource.php                           17-Jul-2024 20:07                5116
function.is-scalar.php                             17-Jul-2024 20:07                8056
function.is-soap-fault.php                         17-Jul-2024 20:07                8162
function.is-string.php                             17-Jul-2024 20:07                6606
function.is-subclass-of.php                        17-Jul-2024 20:07               12153
function.is-tainted.php                            17-Jul-2024 20:07                2377
function.is-uploaded-file.php                      17-Jul-2024 20:07                6649
function.is-writable.php                           17-Jul-2024 20:07                5785
function.is-writeable.php                          17-Jul-2024 20:07                1751
function.isset.php                                 17-Jul-2024 20:07               16035
function.iterator-apply.php                        17-Jul-2024 20:07                6685
function.iterator-count.php                        17-Jul-2024 20:07                8671
function.iterator-to-array.php                     17-Jul-2024 20:07                7701
function.jddayofweek.php                           17-Jul-2024 20:07                3757
function.jdmonthname.php                           17-Jul-2024 20:07                4963
function.jdtofrench.php                            17-Jul-2024 20:07                3036
function.jdtogregorian.php                         17-Jul-2024 20:07                3086
function.jdtojewish.php                            17-Jul-2024 20:07                7325
function.jdtojulian.php                            17-Jul-2024 20:07                3047
function.jdtounix.php                              17-Jul-2024 20:07                4362
function.jewishtojd.php                            17-Jul-2024 20:07                4500
function.join.php                                  17-Jul-2024 20:07                1663
function.jpeg2wbmp.php                             17-Jul-2024 20:07                6689
function.json-decode.php                           17-Jul-2024 20:07               20185
function.json-encode.php                           17-Jul-2024 20:07               30864
function.json-last-error-msg.php                   17-Jul-2024 20:07                3085
function.json-last-error.php                       17-Jul-2024 20:07               13917
function.json-validate.php                         17-Jul-2024 20:07                8541
function.juliantojd.php                            17-Jul-2024 20:07                4391
function.key-exists.php                            17-Jul-2024 20:07                1737
function.key.php                                   17-Jul-2024 20:07                7891
function.krsort.php                                17-Jul-2024 20:07                8750
function.ksort.php                                 17-Jul-2024 20:07               10730
function.lcfirst.php                               17-Jul-2024 20:07                5832
function.lcg-value.php                             17-Jul-2024 20:07                4943
function.lchgrp.php                                17-Jul-2024 20:07                5874
function.lchown.php                                17-Jul-2024 20:07                5772
function.ldap-8859-to-t61.php                      17-Jul-2024 20:07                3389
function.ldap-add-ext.php                          17-Jul-2024 20:07                5780
function.ldap-add.php                              17-Jul-2024 20:07               10433
function.ldap-bind-ext.php                         17-Jul-2024 20:07                6058
function.ldap-bind.php                             17-Jul-2024 20:07                9597
function.ldap-close.php                            17-Jul-2024 20:07                1721
function.ldap-compare.php                          17-Jul-2024 20:07               10340
function.ldap-connect-wallet.php                   17-Jul-2024 20:07                4472
function.ldap-connect.php                          17-Jul-2024 20:07                9818
function.ldap-control-paged-result-response.php    17-Jul-2024 20:07                5908
function.ldap-control-paged-result.php             17-Jul-2024 20:07               14528
function.ldap-count-entries.php                    17-Jul-2024 20:07                5757
function.ldap-count-references.php                 17-Jul-2024 20:07                4762
function.ldap-delete-ext.php                       17-Jul-2024 20:07                5310
function.ldap-delete.php                           17-Jul-2024 20:07                5332
function.ldap-dn2ufn.php                           17-Jul-2024 20:07                2779
function.ldap-err2str.php                          17-Jul-2024 20:07                4662
function.ldap-errno.php                            17-Jul-2024 20:07                7543
function.ldap-error.php                            17-Jul-2024 20:07                4523
function.ldap-escape.php                           17-Jul-2024 20:07                6378
function.ldap-exop-passwd.php                      17-Jul-2024 20:07               10551
function.ldap-exop-refresh.php                     17-Jul-2024 20:07                5169
function.ldap-exop-sync.php                        17-Jul-2024 20:07                5609
function.ldap-exop-whoami.php                      17-Jul-2024 20:07                3943
function.ldap-exop.php                             17-Jul-2024 20:07               12506
function.ldap-explode-dn.php                       17-Jul-2024 20:07                3685
function.ldap-first-attribute.php                  17-Jul-2024 20:07                5462
function.ldap-first-entry.php                      17-Jul-2024 20:07                5822
function.ldap-first-reference.php                  17-Jul-2024 20:07                2355
function.ldap-free-result.php                      17-Jul-2024 20:07                4147
function.ldap-get-attributes.php                   17-Jul-2024 20:07                8238
function.ldap-get-dn.php                           17-Jul-2024 20:07                4324
function.ldap-get-entries.php                      17-Jul-2024 20:07                6149
function.ldap-get-option.php                       17-Jul-2024 20:07               16728
function.ldap-get-values-len.php                   17-Jul-2024 20:07                5521
function.ldap-get-values.php                       17-Jul-2024 20:07                8642
function.ldap-list.php                             17-Jul-2024 20:07               15461
function.ldap-mod-add.php                          17-Jul-2024 20:07                6831
function.ldap-mod-del.php                          17-Jul-2024 20:07                6380
function.ldap-mod-replace.php                      17-Jul-2024 20:07                6776
function.ldap-mod_add-ext.php                      17-Jul-2024 20:07                5779
function.ldap-mod_del-ext.php                      17-Jul-2024 20:07                5795
function.ldap-mod_replace-ext.php                  17-Jul-2024 20:07                5857
function.ldap-modify-batch.php                     17-Jul-2024 20:07               19041
function.ldap-modify.php                           17-Jul-2024 20:07                2121
function.ldap-next-attribute.php                   17-Jul-2024 20:07                5241
function.ldap-next-entry.php                       17-Jul-2024 20:07                5822
function.ldap-next-reference.php                   17-Jul-2024 20:07                2282
function.ldap-parse-exop.php                       17-Jul-2024 20:07                6003
function.ldap-parse-reference.php                  17-Jul-2024 20:07                2424
function.ldap-parse-result.php                     17-Jul-2024 20:07                9958
function.ldap-read.php                             17-Jul-2024 20:07               12776
function.ldap-rename-ext.php                       17-Jul-2024 20:07                6129
function.ldap-rename.php                           17-Jul-2024 20:07                7225
function.ldap-sasl-bind.php                        17-Jul-2024 20:07                7165
function.ldap-search.php                           17-Jul-2024 20:07               15669
function.ldap-set-option.php                       17-Jul-2024 20:07               19323
function.ldap-set-rebind-proc.php                  17-Jul-2024 20:07                3222
function.ldap-sort.php                             17-Jul-2024 20:07                7207
function.ldap-start-tls.php                        17-Jul-2024 20:07                2038
function.ldap-t61-to-8859.php                      17-Jul-2024 20:07                2190
function.ldap-unbind.php                           17-Jul-2024 20:07                3858
function.levenshtein.php                           17-Jul-2024 20:07               12215
function.libxml-clear-errors.php                   17-Jul-2024 20:07                2845
function.libxml-disable-entity-loader.php          17-Jul-2024 20:07                4945
function.libxml-get-errors.php                     17-Jul-2024 20:07               10700
function.libxml-get-external-entity-loader.php     17-Jul-2024 20:07                3487
function.libxml-get-last-error.php                 17-Jul-2024 20:07                3221
function.libxml-set-external-entity-loader.php     17-Jul-2024 20:07               10552
function.libxml-set-streams-context.php            17-Jul-2024 20:07                5081
function.libxml-use-internal-errors.php            17-Jul-2024 20:07                6688
function.link.php                                  17-Jul-2024 20:07                5854
function.linkinfo.php                              17-Jul-2024 20:07                4505
function.list.php                                  17-Jul-2024 20:07               16582
function.localeconv.php                            17-Jul-2024 20:07                9517
function.localtime.php                             17-Jul-2024 20:07                9146
function.log.php                                   17-Jul-2024 20:07                3994
function.log10.php                                 17-Jul-2024 20:07                2704
function.log1p.php                                 17-Jul-2024 20:07                3390
function.long2ip.php                               17-Jul-2024 20:07                4380
function.lstat.php                                 17-Jul-2024 20:07                6377
function.ltrim.php                                 17-Jul-2024 20:07                9488
function.lzf-compress.php                          17-Jul-2024 20:07                2979
function.lzf-decompress.php                        17-Jul-2024 20:07                3071
function.lzf-optimized-for.php                     17-Jul-2024 20:07                2252
function.mail.php                                  17-Jul-2024 20:07               25554
function.mailparse-determine-best-xfer-encoding..> 17-Jul-2024 20:07                4295
function.mailparse-msg-create.php                  17-Jul-2024 20:07                3389
function.mailparse-msg-extract-part-file.php       17-Jul-2024 20:07                5368
function.mailparse-msg-extract-part.php            17-Jul-2024 20:07                4096
function.mailparse-msg-extract-whole-part-file.php 17-Jul-2024 20:07                4126
function.mailparse-msg-free.php                    17-Jul-2024 20:07                3663
function.mailparse-msg-get-part-data.php           17-Jul-2024 20:07                2576
function.mailparse-msg-get-part.php                17-Jul-2024 20:07                2859
function.mailparse-msg-get-structure.php           17-Jul-2024 20:07                2596
function.mailparse-msg-parse-file.php              17-Jul-2024 20:07                4273
function.mailparse-msg-parse.php                   17-Jul-2024 20:07                3586
function.mailparse-rfc822-parse-addresses.php      17-Jul-2024 20:07                5702
function.mailparse-stream-encode.php               17-Jul-2024 20:07                5953
function.mailparse-uudecode-all.php                17-Jul-2024 20:07                6936
function.max.php                                   17-Jul-2024 20:07               12109
function.mb-check-encoding.php                     17-Jul-2024 20:07                5478
function.mb-chr.php                                17-Jul-2024 20:07                6996
function.mb-convert-case.php                       17-Jul-2024 20:07               11785
function.mb-convert-encoding.php                   17-Jul-2024 20:07               11961
function.mb-convert-kana.php                       17-Jul-2024 20:07               10213
function.mb-convert-variables.php                  17-Jul-2024 20:07                6659
function.mb-decode-mimeheader.php                  17-Jul-2024 20:07                3312
function.mb-decode-numericentity.php               17-Jul-2024 20:07               34010
function.mb-detect-encoding.php                    17-Jul-2024 20:07               16169
function.mb-detect-order.php                       17-Jul-2024 20:07                8917
function.mb-encode-mimeheader.php                  17-Jul-2024 20:07                9702
function.mb-encode-numericentity.php               17-Jul-2024 20:07               12770
function.mb-encoding-aliases.php                   17-Jul-2024 20:07                6398
function.mb-ereg-match.php                         17-Jul-2024 20:07                5613
function.mb-ereg-replace-callback.php              17-Jul-2024 20:07               12508
function.mb-ereg-replace.php                       17-Jul-2024 20:07                7179
function.mb-ereg-search-getpos.php                 17-Jul-2024 20:07                3862
function.mb-ereg-search-getregs.php                17-Jul-2024 20:07                4341
function.mb-ereg-search-init.php                   17-Jul-2024 20:07                6147
function.mb-ereg-search-pos.php                    17-Jul-2024 20:07                6008
function.mb-ereg-search-regs.php                   17-Jul-2024 20:07                5760
function.mb-ereg-search-setpos.php                 17-Jul-2024 20:07                4547
function.mb-ereg-search.php                        17-Jul-2024 20:07                5701
function.mb-ereg.php                               17-Jul-2024 20:07                6485
function.mb-eregi-replace.php                      17-Jul-2024 20:07                7063
function.mb-eregi.php                              17-Jul-2024 20:07                6529
function.mb-get-info.php                           17-Jul-2024 20:07                6237
function.mb-http-input.php                         17-Jul-2024 20:07                5060
function.mb-http-output.php                        17-Jul-2024 20:07                4900
function.mb-internal-encoding.php                  17-Jul-2024 20:07                6851
function.mb-language.php                           17-Jul-2024 20:07                6596
function.mb-list-encodings.php                     17-Jul-2024 20:07                5048
function.mb-ord.php                                17-Jul-2024 20:07                6832
function.mb-output-handler.php                     17-Jul-2024 20:07                5211
function.mb-parse-str.php                          17-Jul-2024 20:07                4679
function.mb-preferred-mime-name.php                17-Jul-2024 20:07                4567
function.mb-regex-encoding.php                     17-Jul-2024 20:07                4609
function.mb-regex-set-options.php                  17-Jul-2024 20:07                8663
function.mb-scrub.php                              17-Jul-2024 20:07                4169
function.mb-send-mail.php                          17-Jul-2024 20:07                9630
function.mb-split.php                              17-Jul-2024 20:07                4788
function.mb-str-pad.php                            17-Jul-2024 20:07                8622
function.mb-str-split.php                          17-Jul-2024 20:07                5214
function.mb-strcut.php                             17-Jul-2024 20:07                7328
function.mb-strimwidth.php                         17-Jul-2024 20:07                7998
function.mb-stripos.php                            17-Jul-2024 20:07                6426
function.mb-stristr.php                            17-Jul-2024 20:07                6843
function.mb-strlen.php                             17-Jul-2024 20:07                5148
function.mb-strpos.php                             17-Jul-2024 20:07                6499
function.mb-strrchr.php                            17-Jul-2024 20:07                6651
function.mb-strrichr.php                           17-Jul-2024 20:07                6739
function.mb-strripos.php                           17-Jul-2024 20:07                6353
function.mb-strrpos.php                            17-Jul-2024 20:07                6823
function.mb-strstr.php                             17-Jul-2024 20:07                6598
function.mb-strtolower.php                         17-Jul-2024 20:07                7099
function.mb-strtoupper.php                         17-Jul-2024 20:07                7107
function.mb-strwidth.php                           17-Jul-2024 20:07                9154
function.mb-substitute-character.php               17-Jul-2024 20:07                7343
function.mb-substr-count.php                       17-Jul-2024 20:07                5932
function.mb-substr.php                             17-Jul-2024 20:07                6505
function.mcrypt-create-iv.php                      17-Jul-2024 20:07                6958
function.mcrypt-decrypt.php                        17-Jul-2024 20:07                5863
function.mcrypt-enc-get-algorithms-name.php        17-Jul-2024 20:07                5293
function.mcrypt-enc-get-block-size.php             17-Jul-2024 20:07                2996
function.mcrypt-enc-get-iv-size.php                17-Jul-2024 20:07                3132
function.mcrypt-enc-get-key-size.php               17-Jul-2024 20:07                3024
function.mcrypt-enc-get-modes-name.php             17-Jul-2024 20:07                5207
function.mcrypt-enc-get-supported-key-sizes.php    17-Jul-2024 20:07                4949
function.mcrypt-enc-is-block-algorithm-mode.php    17-Jul-2024 20:07                3577
function.mcrypt-enc-is-block-algorithm.php         17-Jul-2024 20:07                3256
function.mcrypt-enc-is-block-mode.php              17-Jul-2024 20:07                3499
function.mcrypt-enc-self-test.php                  17-Jul-2024 20:07                3070
function.mcrypt-encrypt.php                        17-Jul-2024 20:07               13584
function.mcrypt-generic-deinit.php                 17-Jul-2024 20:07                4006
function.mcrypt-generic-init.php                   17-Jul-2024 20:07                5195
function.mcrypt-generic.php                        17-Jul-2024 20:07                5767
function.mcrypt-get-block-size.php                 17-Jul-2024 20:07                6590
function.mcrypt-get-cipher-name.php                17-Jul-2024 20:07                5040
function.mcrypt-get-iv-size.php                    17-Jul-2024 20:07                6337
function.mcrypt-get-key-size.php                   17-Jul-2024 20:07                6725
function.mcrypt-list-algorithms.php                17-Jul-2024 20:07                4731
function.mcrypt-list-modes.php                     17-Jul-2024 20:07                4568
function.mcrypt-module-close.php                   17-Jul-2024 20:07                3426
function.mcrypt-module-get-algo-block-size.php     17-Jul-2024 20:07                3526
function.mcrypt-module-get-algo-key-size.php       17-Jul-2024 20:07                3556
function.mcrypt-module-get-supported-key-sizes.php 17-Jul-2024 20:07                4493
function.mcrypt-module-is-block-algorithm-mode.php 17-Jul-2024 20:07                4434
function.mcrypt-module-is-block-algorithm.php      17-Jul-2024 20:07                3959
function.mcrypt-module-is-block-mode.php           17-Jul-2024 20:07                4680
function.mcrypt-module-open.php                    17-Jul-2024 20:07               13816
function.mcrypt-module-self-test.php               17-Jul-2024 20:07                4962
function.md5-file.php                              17-Jul-2024 20:07                5221
function.md5.php                                   17-Jul-2024 20:07                5116
function.mdecrypt-generic.php                      17-Jul-2024 20:07               10771
function.memcache-debug.php                        17-Jul-2024 20:07                3742
function.memory-get-peak-usage.php                 17-Jul-2024 20:07                3688
function.memory-get-usage.php                      17-Jul-2024 20:07                5513
function.memory-reset-peak-usage.php               17-Jul-2024 20:07                4956
function.metaphone.php                             17-Jul-2024 20:07                8279
function.method-exists.php                         17-Jul-2024 20:07                6575
function.mhash-count.php                           17-Jul-2024 20:07                4603
function.mhash-get-block-size.php                  17-Jul-2024 20:07                4560
function.mhash-get-hash-name.php                   17-Jul-2024 20:07                4515
function.mhash-keygen-s2k.php                      17-Jul-2024 20:07                5691
function.mhash.php                                 17-Jul-2024 20:07                4841
function.microtime.php                             17-Jul-2024 20:07                7803
function.mime-content-type.php                     17-Jul-2024 20:07                5088
function.min.php                                   17-Jul-2024 20:07               12636
function.mkdir.php                                 17-Jul-2024 20:07                9427
function.mktime.php                                17-Jul-2024 20:07               18298
function.money-format.php                          17-Jul-2024 20:07               17307
function.mongodb.bson-fromjson.php                 17-Jul-2024 20:07                5875
function.mongodb.bson-fromphp.php                  17-Jul-2024 20:07                6217
function.mongodb.bson-tocanonicalextendedjson.php  17-Jul-2024 20:07               13916
function.mongodb.bson-tojson.php                   17-Jul-2024 20:07               14991
function.mongodb.bson-tophp.php                    17-Jul-2024 20:07                9100
function.mongodb.bson-torelaxedextendedjson.php    17-Jul-2024 20:07               13613
function.mongodb.driver.monitoring.addsubscribe..> 17-Jul-2024 20:07                5079
function.mongodb.driver.monitoring.removesubscr..> 17-Jul-2024 20:07                4936
function.move-uploaded-file.php                    17-Jul-2024 20:07                8328
function.mqseries-back.php                         17-Jul-2024 20:07                6485
function.mqseries-begin.php                        17-Jul-2024 20:07                7450
function.mqseries-close.php                        17-Jul-2024 20:07                6668
function.mqseries-cmit.php                         17-Jul-2024 20:07                6415
function.mqseries-conn.php                         17-Jul-2024 20:07                5993
function.mqseries-connx.php                        17-Jul-2024 20:07               12706
function.mqseries-disc.php                         17-Jul-2024 20:07                5695
function.mqseries-get.php                          17-Jul-2024 20:07               12313
function.mqseries-inq.php                          17-Jul-2024 20:07                9371
function.mqseries-open.php                         17-Jul-2024 20:07                7304
function.mqseries-put.php                          17-Jul-2024 20:07               12592
function.mqseries-put1.php                         17-Jul-2024 20:07                6328
function.mqseries-set.php                          17-Jul-2024 20:07                6254
function.mqseries-strerror.php                     17-Jul-2024 20:07                4281
function.msg-get-queue.php                         17-Jul-2024 20:07                5667
function.msg-queue-exists.php                      17-Jul-2024 20:07                3439
function.msg-receive.php                           17-Jul-2024 20:07               11463
function.msg-remove-queue.php                      17-Jul-2024 20:07                4628
function.msg-send.php                              17-Jul-2024 20:07                9589
function.msg-set-queue.php                         17-Jul-2024 20:07                5286
function.msg-stat-queue.php                        17-Jul-2024 20:07                6659
function.mt-getrandmax.php                         17-Jul-2024 20:07                3202
function.mt-rand.php                               17-Jul-2024 20:07               10171
function.mt-srand.php                              17-Jul-2024 20:07                8165
function.mysql-affected-rows.php                   17-Jul-2024 20:07               11768
function.mysql-client-encoding.php                 17-Jul-2024 20:07                5887
function.mysql-close.php                           17-Jul-2024 20:07                7164
function.mysql-connect.php                         17-Jul-2024 20:07               16539
function.mysql-create-db.php                       17-Jul-2024 20:07                8259
function.mysql-data-seek.php                       17-Jul-2024 20:07               11668
function.mysql-db-name.php                         17-Jul-2024 20:07                7656
function.mysql-db-query.php                        17-Jul-2024 20:07                9649
function.mysql-drop-db.php                         17-Jul-2024 20:07                8719
function.mysql-errno.php                           17-Jul-2024 20:07                7947
function.mysql-error.php                           17-Jul-2024 20:07                7922
function.mysql-escape-string.php                   17-Jul-2024 20:07                6383
function.mysql-fetch-array.php                     17-Jul-2024 20:07                8129
function.mysql-fetch-assoc.php                     17-Jul-2024 20:07               11175
function.mysql-fetch-field.php                     17-Jul-2024 20:07               20529
function.mysql-fetch-lengths.php                   17-Jul-2024 20:07                7546
function.mysql-fetch-object.php                    17-Jul-2024 20:07               11664
function.mysql-fetch-row.php                       17-Jul-2024 20:07                9013
function.mysql-field-flags.php                     17-Jul-2024 20:07                8431
function.mysql-field-len.php                       17-Jul-2024 20:07                6930
function.mysql-field-name.php                      17-Jul-2024 20:07               12702
function.mysql-field-seek.php                      17-Jul-2024 20:07                5037
function.mysql-field-table.php                     17-Jul-2024 20:07                7546
function.mysql-field-type.php                      17-Jul-2024 20:07               17810
function.mysql-free-result.php                     17-Jul-2024 20:07                8068
function.mysql-get-client-info.php                 17-Jul-2024 20:07                5060
function.mysql-get-host-info.php                   17-Jul-2024 20:07                6871
function.mysql-get-proto-info.php                  17-Jul-2024 20:07                6461
function.mysql-get-server-info.php                 17-Jul-2024 20:07                6943
function.mysql-info.php                            17-Jul-2024 20:07                6093
function.mysql-insert-id.php                       17-Jul-2024 20:07                8115
function.mysql-list-dbs.php                        17-Jul-2024 20:07                8553
function.mysql-list-fields.php                     17-Jul-2024 20:07                8660
function.mysql-list-processes.php                  17-Jul-2024 20:07                7477
function.mysql-list-tables.php                     17-Jul-2024 20:07                9370
function.mysql-num-fields.php                      17-Jul-2024 20:07                6504
function.mysql-num-rows.php                        17-Jul-2024 20:07                7902
function.mysql-pconnect.php                        17-Jul-2024 20:07                8127
function.mysql-ping.php                            17-Jul-2024 20:07                7673
function.mysql-query.php                           17-Jul-2024 20:07               13645
function.mysql-real-escape-string.php              17-Jul-2024 20:07               15032
function.mysql-result.php                          17-Jul-2024 20:07                9514
function.mysql-select-db.php                       17-Jul-2024 20:07               10312
function.mysql-set-charset.php                     17-Jul-2024 20:07                5736
function.mysql-stat.php                            17-Jul-2024 20:07                9128
function.mysql-tablename.php                       17-Jul-2024 20:07                7930
function.mysql-thread-id.php                       17-Jul-2024 20:07                6454
function.mysql-unbuffered-query.php                17-Jul-2024 20:07                6841
function.mysql-xdevapi-expression.php              17-Jul-2024 20:07                4784
function.mysql-xdevapi-getsession.php              17-Jul-2024 20:07               13078
function.mysqli-connect.php                        17-Jul-2024 20:07                2320
function.mysqli-escape-string.php                  17-Jul-2024 20:07                1960
function.mysqli-execute.php                        17-Jul-2024 20:07                2551
function.mysqli-get-client-stats.php               17-Jul-2024 20:07                8380
function.mysqli-get-links-stats.php                17-Jul-2024 20:07                3276
function.mysqli-report.php                         17-Jul-2024 20:07                1762
function.mysqli-set-opt.php                        17-Jul-2024 20:07                1886
function.natcasesort.php                           17-Jul-2024 20:07                7648
function.natsort.php                               17-Jul-2024 20:07               10824
function.net-get-interfaces.php                    17-Jul-2024 20:07                4623
function.next.php                                  17-Jul-2024 20:07                9512
function.ngettext.php                              17-Jul-2024 20:07                5795
function.nl-langinfo.php                           17-Jul-2024 20:07               18315
function.nl2br.php                                 17-Jul-2024 20:07                6670
function.number-format.php                         17-Jul-2024 20:07                8572
function.oauth-get-sbs.php                         17-Jul-2024 20:07                3159
function.oauth-urlencode.php                       17-Jul-2024 20:07                2653
function.ob-clean.php                              17-Jul-2024 20:07                4462
function.ob-end-clean.php                          17-Jul-2024 20:07                5634
function.ob-end-flush.php                          17-Jul-2024 20:07                5548
function.ob-flush.php                              17-Jul-2024 20:07                4586
function.ob-get-clean.php                          17-Jul-2024 20:07                6496
function.ob-get-contents.php                       17-Jul-2024 20:07                4753
function.ob-get-flush.php                          17-Jul-2024 20:07                6504
function.ob-get-length.php                         17-Jul-2024 20:07                4692
function.ob-get-level.php                          17-Jul-2024 20:07                3564
function.ob-get-status.php                         17-Jul-2024 20:07                9993
function.ob-gzhandler.php                          17-Jul-2024 20:07                5747
function.ob-iconv-handler.php                      17-Jul-2024 20:07                5069
function.ob-implicit-flush.php                     17-Jul-2024 20:07                5137
function.ob-list-handlers.php                      17-Jul-2024 20:07               13759
function.ob-start.php                              17-Jul-2024 20:07               15058
function.ob-tidyhandler.php                        17-Jul-2024 20:07                4404
function.oci-bind-array-by-name.php                17-Jul-2024 20:07               13930
function.oci-bind-by-name.php                      17-Jul-2024 20:07               78446
function.oci-cancel.php                            17-Jul-2024 20:07                2777
function.oci-client-version.php                    17-Jul-2024 20:07                4024
function.oci-close.php                             17-Jul-2024 20:07               18219
function.oci-commit.php                            17-Jul-2024 20:07               10736
function.oci-connect.php                           17-Jul-2024 20:07               34935
function.oci-define-by-name.php                    17-Jul-2024 20:07               23777
function.oci-error.php                             17-Jul-2024 20:07               11703
function.oci-execute.php                           17-Jul-2024 20:07               21036
function.oci-fetch-all.php                         17-Jul-2024 20:07               24157
function.oci-fetch-array.php                       17-Jul-2024 20:07               64374
function.oci-fetch-assoc.php                       17-Jul-2024 20:07                8859
function.oci-fetch-object.php                      17-Jul-2024 20:07               18207
function.oci-fetch-row.php                         17-Jul-2024 20:07                8800
function.oci-fetch.php                             17-Jul-2024 20:07               13441
function.oci-field-is-null.php                     17-Jul-2024 20:07                7893
function.oci-field-name.php                        17-Jul-2024 20:07                9786
function.oci-field-precision.php                   17-Jul-2024 20:07                8648
function.oci-field-scale.php                       17-Jul-2024 20:07                8633
function.oci-field-size.php                        17-Jul-2024 20:07               10263
function.oci-field-type-raw.php                    17-Jul-2024 20:07                7962
function.oci-field-type.php                        17-Jul-2024 20:07               10664
function.oci-free-descriptor.php                   17-Jul-2024 20:07                3553
function.oci-free-statement.php                    17-Jul-2024 20:07                3031
function.oci-get-implicit-resultset.php            17-Jul-2024 20:07               28202
function.oci-internal-debug.php                    17-Jul-2024 20:07                3106
function.oci-lob-copy.php                          17-Jul-2024 20:07                4616
function.oci-lob-is-equal.php                      17-Jul-2024 20:07                3310
function.oci-new-collection.php                    17-Jul-2024 20:07                5090
function.oci-new-connect.php                       17-Jul-2024 20:07               16319
function.oci-new-cursor.php                        17-Jul-2024 20:07                7748
function.oci-new-descriptor.php                    17-Jul-2024 20:07               18227
function.oci-num-fields.php                        17-Jul-2024 20:07                6912
function.oci-num-rows.php                          17-Jul-2024 20:07                7885
function.oci-parse.php                             17-Jul-2024 20:07               12467
function.oci-password-change.php                   17-Jul-2024 20:07               13317
function.oci-pconnect.php                          17-Jul-2024 20:07               14698
function.oci-register-taf-callback.php             17-Jul-2024 20:07                5811
function.oci-result.php                            17-Jul-2024 20:07                8525
function.oci-rollback.php                          17-Jul-2024 20:07               14037
function.oci-server-version.php                    17-Jul-2024 20:07                4761
function.oci-set-action.php                        17-Jul-2024 20:07                8383
function.oci-set-call-timout.php                   17-Jul-2024 20:07                5989
function.oci-set-client-identifier.php             17-Jul-2024 20:07                8135
function.oci-set-client-info.php                   17-Jul-2024 20:07                8305
function.oci-set-db-operation.php                  17-Jul-2024 20:07                7806
function.oci-set-edition.php                       17-Jul-2024 20:07                9773
function.oci-set-module-name.php                   17-Jul-2024 20:07                8499
function.oci-set-prefetch-lob.php                  17-Jul-2024 20:07                8875
function.oci-set-prefetch.php                      17-Jul-2024 20:07               20190
function.oci-statement-type.php                    17-Jul-2024 20:07                7060
function.oci-unregister-taf-callback.php           17-Jul-2024 20:07                3662
function.ocibindbyname.php                         17-Jul-2024 20:07                1976
function.ocicancel.php                             17-Jul-2024 20:07                1918
function.ocicloselob.php                           17-Jul-2024 20:07                1917
function.ocicollappend.php                         17-Jul-2024 20:07                1982
function.ocicollassign.php                         17-Jul-2024 20:07                1987
function.ocicollassignelem.php                     17-Jul-2024 20:07                2032
function.ocicollgetelem.php                        17-Jul-2024 20:07                1999
function.ocicollmax.php                            17-Jul-2024 20:07                1951
function.ocicollsize.php                           17-Jul-2024 20:07                1954
function.ocicolltrim.php                           17-Jul-2024 20:07                1964
function.ocicolumnisnull.php                       17-Jul-2024 20:07                1988
function.ocicolumnname.php                         17-Jul-2024 20:07                1980
function.ocicolumnprecision.php                    17-Jul-2024 20:07                2023
function.ocicolumnscale.php                        17-Jul-2024 20:07                1987
function.ocicolumnsize.php                         17-Jul-2024 20:07                1968
function.ocicolumntype.php                         17-Jul-2024 20:07                1972
function.ocicolumntyperaw.php                      17-Jul-2024 20:07                1995
function.ocicommit.php                             17-Jul-2024 20:07                1932
function.ocidefinebyname.php                       17-Jul-2024 20:07                1978
function.ocierror.php                              17-Jul-2024 20:07                1909
function.ociexecute.php                            17-Jul-2024 20:07                1913
function.ocifetch.php                              17-Jul-2024 20:07                1903
function.ocifetchinto.php                          17-Jul-2024 20:07                2654
function.ocifetchstatement.php                     17-Jul-2024 20:07                1996
function.ocifreecollection.php                     17-Jul-2024 20:07                2014
function.ocifreecursor.php                         17-Jul-2024 20:07                1986
function.ocifreedesc.php                           17-Jul-2024 20:07                1930
function.ocifreestatement.php                      17-Jul-2024 20:07                2005
function.ociinternaldebug.php                      17-Jul-2024 20:07                2019
function.ociloadlob.php                            17-Jul-2024 20:07                1915
function.ocilogoff.php                             17-Jul-2024 20:07                1902
function.ocilogon.php                              17-Jul-2024 20:07                1917
function.ocinewcollection.php                      17-Jul-2024 20:07                2003
function.ocinewcursor.php                          17-Jul-2024 20:07                1971
function.ocinewdescriptor.php                      17-Jul-2024 20:07                1993
function.ocinlogon.php                             17-Jul-2024 20:07                1942
function.ocinumcols.php                            17-Jul-2024 20:07                1927
function.ociparse.php                              17-Jul-2024 20:07                1897
function.ociplogon.php                             17-Jul-2024 20:07                1912
function.ociresult.php                             17-Jul-2024 20:07                1910
function.ocirollback.php                           17-Jul-2024 20:07                1932
function.ocirowcount.php                           17-Jul-2024 20:07                1934
function.ocisavelob.php                            17-Jul-2024 20:07                1915
function.ocisavelobfile.php                        17-Jul-2024 20:07                1953
function.ociserverversion.php                      17-Jul-2024 20:07                2007
function.ocisetprefetch.php                        17-Jul-2024 20:07                1993
function.ocistatementtype.php                      17-Jul-2024 20:07                2013
function.ociwritelobtofile.php                     17-Jul-2024 20:07                1994
function.ociwritetemporarylob.php                  17-Jul-2024 20:07                2017
function.octdec.php                                17-Jul-2024 20:07                5811
function.odbc-autocommit.php                       17-Jul-2024 20:07                5457
function.odbc-binmode.php                          17-Jul-2024 20:07                7313
function.odbc-close-all.php                        17-Jul-2024 20:07                2590
function.odbc-close.php                            17-Jul-2024 20:07                2904
function.odbc-columnprivileges.php                 17-Jul-2024 20:07                8713
function.odbc-columns.php                          17-Jul-2024 20:07               11677
function.odbc-commit.php                           17-Jul-2024 20:07                2743
function.odbc-connect.php                          17-Jul-2024 20:07                8876
function.odbc-connection-string-is-quoted.php      17-Jul-2024 20:07                3716
function.odbc-connection-string-quote.php          17-Jul-2024 20:07                5779
function.odbc-connection-string-should-quote.php   17-Jul-2024 20:07                3980
function.odbc-cursor.php                           17-Jul-2024 20:07                2742
function.odbc-data-source.php                      17-Jul-2024 20:07                6246
function.odbc-do.php                               17-Jul-2024 20:07                1700
function.odbc-error.php                            17-Jul-2024 20:07                4178
function.odbc-errormsg.php                         17-Jul-2024 20:07                4231
function.odbc-exec.php                             17-Jul-2024 20:07                4073
function.odbc-execute.php                          17-Jul-2024 20:07                7115
function.odbc-fetch-array.php                      17-Jul-2024 20:07                4362
function.odbc-fetch-into.php                       17-Jul-2024 20:07                5279
function.odbc-fetch-object.php                     17-Jul-2024 20:07                4368
function.odbc-fetch-row.php                        17-Jul-2024 20:07                4904
function.odbc-field-len.php                        17-Jul-2024 20:07                3488
function.odbc-field-name.php                       17-Jul-2024 20:07                3105
function.odbc-field-num.php                        17-Jul-2024 20:07                3125
function.odbc-field-precision.php                  17-Jul-2024 20:07                2224
function.odbc-field-scale.php                      17-Jul-2024 20:07                3120
function.odbc-field-type.php                       17-Jul-2024 20:07                3105
function.odbc-foreignkeys.php                      17-Jul-2024 20:07                9145
function.odbc-free-result.php                      17-Jul-2024 20:07                3407
function.odbc-gettypeinfo.php                      17-Jul-2024 20:07                4605
function.odbc-longreadlen.php                      17-Jul-2024 20:07                3916
function.odbc-next-result.php                      17-Jul-2024 20:07                9001
function.odbc-num-fields.php                       17-Jul-2024 20:07                2643
function.odbc-num-rows.php                         17-Jul-2024 20:07                3283
function.odbc-pconnect.php                         17-Jul-2024 20:07                4853
function.odbc-prepare.php                          17-Jul-2024 20:07                6442
function.odbc-primarykeys.php                      17-Jul-2024 20:07                7963
function.odbc-procedurecolumns.php                 17-Jul-2024 20:07               11904
function.odbc-procedures.php                       17-Jul-2024 20:07                9686
function.odbc-result-all.php                       17-Jul-2024 20:07                4189
function.odbc-result.php                           17-Jul-2024 20:07                5930
function.odbc-rollback.php                         17-Jul-2024 20:07                2762
function.odbc-setoption.php                        17-Jul-2024 20:07                7215
function.odbc-specialcolumns.php                   17-Jul-2024 20:07                8009
function.odbc-statistics.php                       17-Jul-2024 20:07               10085
function.odbc-tableprivileges.php                  17-Jul-2024 20:07                8309
function.odbc-tables.php                           17-Jul-2024 20:07               12609
function.opcache-compile-file.php                  17-Jul-2024 20:07                3867
function.opcache-get-configuration.php             17-Jul-2024 20:07                3254
function.opcache-get-status.php                    17-Jul-2024 20:07                3748
function.opcache-invalidate.php                    17-Jul-2024 20:07                4388
function.opcache-is-script-cached.php              17-Jul-2024 20:07                3451
function.opcache-reset.php                         17-Jul-2024 20:07                3373
function.openal-buffer-create.php                  17-Jul-2024 20:07                2875
function.openal-buffer-data.php                    17-Jul-2024 20:07                5023
function.openal-buffer-destroy.php                 17-Jul-2024 20:07                3215
function.openal-buffer-get.php                     17-Jul-2024 20:07                4017
function.openal-buffer-loadwav.php                 17-Jul-2024 20:07                3756
function.openal-context-create.php                 17-Jul-2024 20:07                3409
function.openal-context-current.php                17-Jul-2024 20:07                3270
function.openal-context-destroy.php                17-Jul-2024 20:07                3256
function.openal-context-process.php                17-Jul-2024 20:07                3644
function.openal-context-suspend.php                17-Jul-2024 20:07                3638
function.openal-device-close.php                   17-Jul-2024 20:07                3222
function.openal-device-open.php                    17-Jul-2024 20:07                3402
function.openal-listener-get.php                   17-Jul-2024 20:07                3453
function.openal-listener-set.php                   17-Jul-2024 20:07                3854
function.openal-source-create.php                  17-Jul-2024 20:07                3071
function.openal-source-destroy.php                 17-Jul-2024 20:07                3223
function.openal-source-get.php                     17-Jul-2024 20:07                5641
function.openal-source-pause.php                   17-Jul-2024 20:07                3524
function.openal-source-play.php                    17-Jul-2024 20:07                3523
function.openal-source-rewind.php                  17-Jul-2024 20:07                3533
function.openal-source-set.php                     17-Jul-2024 20:07                6382
function.openal-source-stop.php                    17-Jul-2024 20:07                3505
function.openal-stream.php                         17-Jul-2024 20:07                4465
function.opendir.php                               17-Jul-2024 20:07                7896
function.openlog.php                               17-Jul-2024 20:07               10360
function.openssl-cipher-iv-length.php              17-Jul-2024 20:07                4500
function.openssl-cipher-key-length.php             17-Jul-2024 20:07                4441
function.openssl-cms-decrypt.php                   17-Jul-2024 20:07                5749
function.openssl-cms-encrypt.php                   17-Jul-2024 20:07                6725
function.openssl-cms-read.php                      17-Jul-2024 20:07                3275
function.openssl-cms-sign.php                      17-Jul-2024 20:07                8394
function.openssl-cms-verify.php                    17-Jul-2024 20:07                7490
function.openssl-csr-export-to-file.php            17-Jul-2024 20:07                8497
function.openssl-csr-export.php                    17-Jul-2024 20:07                8407
function.openssl-csr-get-public-key.php            17-Jul-2024 20:07                8721
function.openssl-csr-get-subject.php               17-Jul-2024 20:07                9471
function.openssl-csr-new.php                       17-Jul-2024 20:07               21694
function.openssl-csr-sign.php                      17-Jul-2024 20:07               13804
function.openssl-decrypt.php                       17-Jul-2024 20:07                7983
function.openssl-dh-compute-key.php                17-Jul-2024 20:07               16162
function.openssl-digest.php                        17-Jul-2024 20:07                4652
function.openssl-encrypt.php                       17-Jul-2024 20:07               18219
function.openssl-error-string.php                  17-Jul-2024 20:07                3780
function.openssl-free-key.php                      17-Jul-2024 20:07                3713
function.openssl-get-cert-locations.php            17-Jul-2024 20:07                4004
function.openssl-get-cipher-methods.php            17-Jul-2024 20:07               14067
function.openssl-get-curve-names.php               17-Jul-2024 20:07                7117
function.openssl-get-md-methods.php                17-Jul-2024 20:07                6959
function.openssl-get-privatekey.php                17-Jul-2024 20:07                1925
function.openssl-get-publickey.php                 17-Jul-2024 20:07                1896
function.openssl-open.php                          17-Jul-2024 20:07               10294
function.openssl-pbkdf2.php                        17-Jul-2024 20:07                7631
function.openssl-pkcs12-export-to-file.php         17-Jul-2024 20:07                7601
function.openssl-pkcs12-export.php                 17-Jul-2024 20:07                7618
function.openssl-pkcs12-read.php                   17-Jul-2024 20:07                5735
function.openssl-pkcs7-decrypt.php                 17-Jul-2024 20:07                7841
function.openssl-pkcs7-encrypt.php                 17-Jul-2024 20:07               10721
function.openssl-pkcs7-read.php                    17-Jul-2024 20:07                6949
function.openssl-pkcs7-sign.php                    17-Jul-2024 20:07               12006
function.openssl-pkcs7-verify.php                  17-Jul-2024 20:07                8285
function.openssl-pkey-derive.php                   17-Jul-2024 20:07                8273
function.openssl-pkey-export-to-file.php           17-Jul-2024 20:07                6694
function.openssl-pkey-export.php                   17-Jul-2024 20:07                6591
function.openssl-pkey-free.php                     17-Jul-2024 20:07                3908
function.openssl-pkey-get-details.php              17-Jul-2024 20:07                9694
function.openssl-pkey-get-private.php              17-Jul-2024 20:07                6246
function.openssl-pkey-get-public.php               17-Jul-2024 20:07                5429
function.openssl-pkey-new.php                      17-Jul-2024 20:07                6985
function.openssl-private-decrypt.php               17-Jul-2024 20:07                6575
function.openssl-private-encrypt.php               17-Jul-2024 20:07                6764
function.openssl-public-decrypt.php                17-Jul-2024 20:07                6641
function.openssl-public-encrypt.php                17-Jul-2024 20:07                7003
function.openssl-random-pseudo-bytes.php           17-Jul-2024 20:07                9135
function.openssl-seal.php                          17-Jul-2024 20:07               11350
function.openssl-sign.php                          17-Jul-2024 20:07               12903
function.openssl-spki-export-challenge.php         17-Jul-2024 20:07                7632
function.openssl-spki-export.php                   17-Jul-2024 20:07                8331
function.openssl-spki-new.php                      17-Jul-2024 20:07                9161
function.openssl-spki-verify.php                   17-Jul-2024 20:07                7760
function.openssl-verify.php                        17-Jul-2024 20:07               13369
function.openssl-x509-check-private-key.php        17-Jul-2024 20:07                5878
function.openssl-x509-checkpurpose.php             17-Jul-2024 20:07                7360
function.openssl-x509-export-to-file.php           17-Jul-2024 20:07                5110
function.openssl-x509-export.php                   17-Jul-2024 20:07                5083
function.openssl-x509-fingerprint.php              17-Jul-2024 20:07                5442
function.openssl-x509-free.php                     17-Jul-2024 20:07                3913
function.openssl-x509-parse.php                    17-Jul-2024 20:07                4695
function.openssl-x509-read.php                     17-Jul-2024 20:07                4483
function.openssl-x509-verify.php                   17-Jul-2024 20:07               12491
function.ord.php                                   17-Jul-2024 20:07                7101
function.output-add-rewrite-var.php                17-Jul-2024 20:07                9244
function.output-reset-rewrite-vars.php             17-Jul-2024 20:07                6359
function.pack.php                                  17-Jul-2024 20:07               12515
function.parse-ini-file.php                        17-Jul-2024 20:07               20086
function.parse-ini-string.php                      17-Jul-2024 20:07                7312
function.parse-str.php                             17-Jul-2024 20:07               10099
function.parse-url.php                             17-Jul-2024 20:07               16529
function.passthru.php                              17-Jul-2024 20:07                7257
function.password-algos.php                        17-Jul-2024 20:07                3387
function.password-get-info.php                     17-Jul-2024 20:07                3479
function.password-hash.php                         17-Jul-2024 20:07               21772
function.password-needs-rehash.php                 17-Jul-2024 20:07                8003
function.password-verify.php                       17-Jul-2024 20:07                6738
function.pathinfo.php                              17-Jul-2024 20:07               14116
function.pclose.php                                17-Jul-2024 20:07                4758
function.pcntl-alarm.php                           17-Jul-2024 20:07                2949
function.pcntl-async-signals.php                   17-Jul-2024 20:07                4240
function.pcntl-errno.php                           17-Jul-2024 20:07                1788
function.pcntl-exec.php                            17-Jul-2024 20:07                3769
function.pcntl-fork.php                            17-Jul-2024 20:07                4914
function.pcntl-get-last-error.php                  17-Jul-2024 20:07                2739
function.pcntl-getpriority.php                     17-Jul-2024 20:07                5863
function.pcntl-rfork.php                           17-Jul-2024 20:07                7694
function.pcntl-setpriority.php                     17-Jul-2024 20:07                5678
function.pcntl-signal-dispatch.php                 17-Jul-2024 20:07                5613
function.pcntl-signal-get-handler.php              17-Jul-2024 20:07                6812
function.pcntl-signal.php                          17-Jul-2024 20:07               11270
function.pcntl-sigprocmask.php                     17-Jul-2024 20:07                6027
function.pcntl-sigtimedwait.php                    17-Jul-2024 20:07                5090
function.pcntl-sigwaitinfo.php                     17-Jul-2024 20:07                7459
function.pcntl-strerror.php                        17-Jul-2024 20:07                2955
function.pcntl-unshare.php                         17-Jul-2024 20:07                4649
function.pcntl-wait.php                            17-Jul-2024 20:07                7914
function.pcntl-waitpid.php                         17-Jul-2024 20:07                9114
function.pcntl-wexitstatus.php                     17-Jul-2024 20:07                3760
function.pcntl-wifexited.php                       17-Jul-2024 20:07                3485
function.pcntl-wifsignaled.php                     17-Jul-2024 20:07                3507
function.pcntl-wifstopped.php                      17-Jul-2024 20:07                3552
function.pcntl-wstopsig.php                        17-Jul-2024 20:07                3693
function.pcntl-wtermsig.php                        17-Jul-2024 20:07                3856
function.pfsockopen.php                            17-Jul-2024 20:07                5695
function.pg-affected-rows.php                      17-Jul-2024 20:07                6729
function.pg-cancel-query.php                       17-Jul-2024 20:07                7430
function.pg-client-encoding.php                    17-Jul-2024 20:07                6778
function.pg-close.php                              17-Jul-2024 20:07                6850
function.pg-connect-poll.php                       17-Jul-2024 20:07                4108
function.pg-connect.php                            17-Jul-2024 20:07               10675
function.pg-connection-busy.php                    17-Jul-2024 20:07                5711
function.pg-connection-reset.php                   17-Jul-2024 20:07                5738
function.pg-connection-status.php                  17-Jul-2024 20:07                5557
function.pg-consume-input.php                      17-Jul-2024 20:07                3677
function.pg-convert.php                            17-Jul-2024 20:07                9680
function.pg-copy-from.php                          17-Jul-2024 20:07                8029
function.pg-copy-to.php                            17-Jul-2024 20:07                7429
function.pg-dbname.php                             17-Jul-2024 20:07                5350
function.pg-delete.php                             17-Jul-2024 20:07                9661
function.pg-end-copy.php                           17-Jul-2024 20:07                7376
function.pg-escape-bytea.php                       17-Jul-2024 20:07                7795
function.pg-escape-identifier.php                  17-Jul-2024 20:07                7834
function.pg-escape-literal.php                     17-Jul-2024 20:07                8199
function.pg-escape-string.php                      17-Jul-2024 20:07                7621
function.pg-execute.php                            17-Jul-2024 20:07               10369
function.pg-fetch-all-columns.php                  17-Jul-2024 20:07                7091
function.pg-fetch-all.php                          17-Jul-2024 20:07                9154
function.pg-fetch-array.php                        17-Jul-2024 20:07               12733
function.pg-fetch-assoc.php                        17-Jul-2024 20:07                9504
function.pg-fetch-object.php                       17-Jul-2024 20:07               11647
function.pg-fetch-result.php                       17-Jul-2024 20:07                9251
function.pg-fetch-row.php                          17-Jul-2024 20:07                9972
function.pg-field-is-null.php                      17-Jul-2024 20:07                8523
function.pg-field-name.php                         17-Jul-2024 20:07                8892
function.pg-field-num.php                          17-Jul-2024 20:07                6491
function.pg-field-prtlen.php                       17-Jul-2024 20:07               10777
function.pg-field-size.php                         17-Jul-2024 20:07                9135
function.pg-field-table.php                        17-Jul-2024 20:07                8670
function.pg-field-type-oid.php                     17-Jul-2024 20:07                7438
function.pg-field-type.php                         17-Jul-2024 20:07                7154
function.pg-flush.php                              17-Jul-2024 20:07                3645
function.pg-free-result.php                        17-Jul-2024 20:07                7306
function.pg-get-notify.php                         17-Jul-2024 20:07                7544
function.pg-get-pid.php                            17-Jul-2024 20:07                5084
function.pg-get-result.php                         17-Jul-2024 20:07                8611
function.pg-host.php                               17-Jul-2024 20:07                6341
function.pg-insert.php                             17-Jul-2024 20:07               11474
function.pg-last-error.php                         17-Jul-2024 20:07                7425
function.pg-last-notice.php                        17-Jul-2024 20:07                8386
function.pg-last-oid.php                           17-Jul-2024 20:07                7388
function.pg-lo-close.php                           17-Jul-2024 20:07                7113
function.pg-lo-create.php                          17-Jul-2024 20:07                8494
function.pg-lo-export.php                          17-Jul-2024 20:07                8197
function.pg-lo-import.php                          17-Jul-2024 20:07                7347
function.pg-lo-open.php                            17-Jul-2024 20:07                8887
function.pg-lo-read-all.php                        17-Jul-2024 20:07                6322
function.pg-lo-read.php                            17-Jul-2024 20:07                7105
function.pg-lo-seek.php                            17-Jul-2024 20:07                7935
function.pg-lo-tell.php                            17-Jul-2024 20:07                6827
function.pg-lo-truncate.php                        17-Jul-2024 20:07                6651
function.pg-lo-unlink.php                          17-Jul-2024 20:07                7177
function.pg-lo-write.php                           17-Jul-2024 20:07                8112
function.pg-meta-data.php                          17-Jul-2024 20:07                7536
function.pg-num-fields.php                         17-Jul-2024 20:07                5930
function.pg-num-rows.php                           17-Jul-2024 20:07                5899
function.pg-options.php                            17-Jul-2024 20:07                5678
function.pg-parameter-status.php                   17-Jul-2024 20:07                8506
function.pg-pconnect.php                           17-Jul-2024 20:07                9451
function.pg-ping.php                               17-Jul-2024 20:07                6117
function.pg-port.php                               17-Jul-2024 20:07                5843
function.pg-prepare.php                            17-Jul-2024 20:07               10332
function.pg-put-line.php                           17-Jul-2024 20:07                8616
function.pg-query-params.php                       17-Jul-2024 20:07               10814
function.pg-query.php                              17-Jul-2024 20:07               12002
function.pg-result-error-field.php                 17-Jul-2024 20:07                9731
function.pg-result-error.php                       17-Jul-2024 20:07                8031
function.pg-result-seek.php                        17-Jul-2024 20:07                7255
function.pg-result-status.php                      17-Jul-2024 20:07                8633
function.pg-select.php                             17-Jul-2024 20:07               11977
function.pg-send-execute.php                       17-Jul-2024 20:07               10440
function.pg-send-prepare.php                       17-Jul-2024 20:07               10884
function.pg-send-query-params.php                  17-Jul-2024 20:07                8111
function.pg-send-query.php                         17-Jul-2024 20:07                9685
function.pg-set-client-encoding.php                17-Jul-2024 20:07                8769
function.pg-set-error-context-visibility.php       17-Jul-2024 20:07                7088
function.pg-set-error-verbosity.php                17-Jul-2024 20:07                8983
function.pg-socket.php                             17-Jul-2024 20:07                3796
function.pg-trace.php                              17-Jul-2024 20:07                9072
function.pg-transaction-status.php                 17-Jul-2024 20:07                6666
function.pg-tty.php                                17-Jul-2024 20:07                6113
function.pg-unescape-bytea.php                     17-Jul-2024 20:07                6308
function.pg-untrace.php                            17-Jul-2024 20:07                6804
function.pg-update.php                             17-Jul-2024 20:07               10616
function.pg-version.php                            17-Jul-2024 20:07                6569
function.php-ini-loaded-file.php                   17-Jul-2024 20:07                4584
function.php-ini-scanned-files.php                 17-Jul-2024 20:07                6111
function.php-sapi-name.php                         17-Jul-2024 20:07                5812
function.php-strip-whitespace.php                  17-Jul-2024 20:07                4562
function.php-uname.php                             17-Jul-2024 20:07                8874
function.phpcredits.php                            17-Jul-2024 20:07                7986
function.phpdbg-break-file.php                     17-Jul-2024 20:07                3742
function.phpdbg-break-function.php                 17-Jul-2024 20:07                3481
function.phpdbg-break-method.php                   17-Jul-2024 20:07                3815
function.phpdbg-break-next.php                     17-Jul-2024 20:07                3110
function.phpdbg-clear.php                          17-Jul-2024 20:07                3340
function.phpdbg-color.php                          17-Jul-2024 20:07                3681
function.phpdbg-end-oplog.php                      17-Jul-2024 20:07                2608
function.phpdbg-exec.php                           17-Jul-2024 20:07                3098
function.phpdbg-get-executable.php                 17-Jul-2024 20:07                2551
function.phpdbg-prompt.php                         17-Jul-2024 20:07                2824
function.phpdbg-start-oplog.php                    17-Jul-2024 20:07                2238
function.phpinfo.php                               17-Jul-2024 20:07                9042
function.phpversion.php                            17-Jul-2024 20:07               10849
function.pi.php                                    17-Jul-2024 20:07                3060
function.png2wbmp.php                              17-Jul-2024 20:07                6669
function.popen.php                                 17-Jul-2024 20:07                8315
function.pos.php                                   17-Jul-2024 20:07                1635
function.posix-access.php                          17-Jul-2024 20:07                6659
function.posix-ctermid.php                         17-Jul-2024 20:07                4485
function.posix-eaccess.php                         17-Jul-2024 20:07                7448
function.posix-errno.php                           17-Jul-2024 20:07                1794
function.posix-fpathconf.php                       17-Jul-2024 20:07                6945
function.posix-get-last-error.php                  17-Jul-2024 20:07                4178
function.posix-getcwd.php                          17-Jul-2024 20:07                4314
function.posix-getegid.php                         17-Jul-2024 20:07                5243
function.posix-geteuid.php                         17-Jul-2024 20:07                5233
function.posix-getgid.php                          17-Jul-2024 20:07                4673
function.posix-getgrgid.php                        17-Jul-2024 20:07                6474
function.posix-getgrnam.php                        17-Jul-2024 20:07                6431
function.posix-getgroups.php                       17-Jul-2024 20:07                4169
function.posix-getlogin.php                        17-Jul-2024 20:07                3644
function.posix-getpgid.php                         17-Jul-2024 20:07                4674
function.posix-getpgrp.php                         17-Jul-2024 20:07                2585
function.posix-getpid.php                          17-Jul-2024 20:07                3658
function.posix-getppid.php                         17-Jul-2024 20:07                3009
function.posix-getpwnam.php                        17-Jul-2024 20:07                6823
function.posix-getpwuid.php                        17-Jul-2024 20:07                6822
function.posix-getrlimit.php                       17-Jul-2024 20:07                8446
function.posix-getsid.php                          17-Jul-2024 20:07                4794
function.posix-getuid.php                          17-Jul-2024 20:07                3385
function.posix-initgroups.php                      17-Jul-2024 20:07                3317
function.posix-isatty.php                          17-Jul-2024 20:07                4510
function.posix-kill.php                            17-Jul-2024 20:07                3498
function.posix-mkfifo.php                          17-Jul-2024 20:07                3570
function.posix-mknod.php                           17-Jul-2024 20:07                7489
function.posix-pathconf.php                        17-Jul-2024 20:07                6275
function.posix-setegid.php                         17-Jul-2024 20:07                5146
function.posix-seteuid.php                         17-Jul-2024 20:07                3547
function.posix-setgid.php                          17-Jul-2024 20:07                5360
function.posix-setpgid.php                         17-Jul-2024 20:07                3419
function.posix-setrlimit.php                       17-Jul-2024 20:07                4618
function.posix-setsid.php                          17-Jul-2024 20:07                2511
function.posix-setuid.php                          17-Jul-2024 20:07                5506
function.posix-strerror.php                        17-Jul-2024 20:07                4823
function.posix-sysconf.php                         17-Jul-2024 20:07                4079
function.posix-times.php                           17-Jul-2024 20:07                4669
function.posix-ttyname.php                         17-Jul-2024 20:07                5349
function.posix-uname.php                           17-Jul-2024 20:07                4808
function.pow.php                                   17-Jul-2024 20:07                6610
function.preg-filter.php                           17-Jul-2024 20:07                9843
function.preg-grep.php                             17-Jul-2024 20:07                5873
function.preg-last-error-msg.php                   17-Jul-2024 20:07                4053
function.preg-last-error.php                       17-Jul-2024 20:07                5111
function.preg-match-all.php                        17-Jul-2024 20:07               25062
function.preg-match.php                            17-Jul-2024 20:07               23276
function.preg-quote.php                            17-Jul-2024 20:07                8396
function.preg-replace-callback-array.php           17-Jul-2024 20:07               10486
function.preg-replace-callback.php                 17-Jul-2024 20:07               16464
function.preg-replace.php                          17-Jul-2024 20:07               24246
function.preg-split.php                            17-Jul-2024 20:07               12582
function.prev.php                                  17-Jul-2024 20:07                9630
function.print-r.php                               17-Jul-2024 20:07                9082
function.print.php                                 17-Jul-2024 20:07               12305
function.printf.php                                17-Jul-2024 20:07               26914
function.proc-close.php                            17-Jul-2024 20:07                3661
function.proc-get-status.php                       17-Jul-2024 20:07                6721
function.proc-nice.php                             17-Jul-2024 20:07                7752
function.proc-open.php                             17-Jul-2024 20:07               21955
function.proc-terminate.php                        17-Jul-2024 20:07                4650
function.property-exists.php                       17-Jul-2024 20:07                8461
function.ps-add-bookmark.php                       17-Jul-2024 20:07                5078
function.ps-add-launchlink.php                     17-Jul-2024 20:07                5793
function.ps-add-locallink.php                      17-Jul-2024 20:07                6577
function.ps-add-note.php                           17-Jul-2024 20:07                7303
function.ps-add-pdflink.php                        17-Jul-2024 20:07                6950
function.ps-add-weblink.php                        17-Jul-2024 20:07                5879
function.ps-arc.php                                17-Jul-2024 20:07                5338
function.ps-arcn.php                               17-Jul-2024 20:07                5344
function.ps-begin-page.php                         17-Jul-2024 20:07                7001
function.ps-begin-pattern.php                      17-Jul-2024 20:07               13442
function.ps-begin-template.php                     17-Jul-2024 20:07               11426
function.ps-circle.php                             17-Jul-2024 20:07                4857
function.ps-clip.php                               17-Jul-2024 20:07                3136
function.ps-close-image.php                        17-Jul-2024 20:07                4031
function.ps-close.php                              17-Jul-2024 20:07                3774
function.ps-closepath-stroke.php                   17-Jul-2024 20:07                3209
function.ps-closepath.php                          17-Jul-2024 20:07                3370
function.ps-continue-text.php                      17-Jul-2024 20:07                4182
function.ps-curveto.php                            17-Jul-2024 20:07                5213
function.ps-delete.php                             17-Jul-2024 20:07                3653
function.ps-end-page.php                           17-Jul-2024 20:07                3379
function.ps-end-pattern.php                        17-Jul-2024 20:07                3310
function.ps-end-template.php                       17-Jul-2024 20:07                3317
function.ps-fill-stroke.php                        17-Jul-2024 20:07                3415
function.ps-fill.php                               17-Jul-2024 20:07                3348
function.ps-findfont.php                           17-Jul-2024 20:07                7226
function.ps-get-buffer.php                         17-Jul-2024 20:07                3240
function.ps-get-parameter.php                      17-Jul-2024 20:07                7999
function.ps-get-value.php                          17-Jul-2024 20:07                9509
function.ps-hyphenate.php                          17-Jul-2024 20:07                7382
function.ps-include-file.php                       17-Jul-2024 20:07                3190
function.ps-lineto.php                             17-Jul-2024 20:07                8342
function.ps-makespotcolor.php                      17-Jul-2024 20:07               10253
function.ps-moveto.php                             17-Jul-2024 20:07                3947
function.ps-new.php                                17-Jul-2024 20:07                3060
function.ps-open-file.php                          17-Jul-2024 20:07                3788
function.ps-open-image-file.php                    17-Jul-2024 20:07                5001
function.ps-open-image.php                         17-Jul-2024 20:07                7088
function.ps-open-memory-image.php                  17-Jul-2024 20:07                2874
function.ps-place-image.php                        17-Jul-2024 20:07                5348
function.ps-rect.php                               17-Jul-2024 20:07                5068
function.ps-restore.php                            17-Jul-2024 20:07                3492
function.ps-rotate.php                             17-Jul-2024 20:07               12213
function.ps-save.php                               17-Jul-2024 20:07                3239
function.ps-scale.php                              17-Jul-2024 20:07                3856
function.ps-set-border-color.php                   17-Jul-2024 20:07                4974
function.ps-set-border-dash.php                    17-Jul-2024 20:07                4562
function.ps-set-border-style.php                   17-Jul-2024 20:07                4626
function.ps-set-info.php                           17-Jul-2024 20:07                6100
function.ps-set-parameter.php                      17-Jul-2024 20:07                4036
function.ps-set-text-pos.php                       17-Jul-2024 20:07                9419
function.ps-set-value.php                          17-Jul-2024 20:07                4848
function.ps-setcolor.php                           17-Jul-2024 20:07                6055
function.ps-setdash.php                            17-Jul-2024 20:07                3743
function.ps-setflat.php                            17-Jul-2024 20:07                3177
function.ps-setfont.php                            17-Jul-2024 20:07                4161
function.ps-setgray.php                            17-Jul-2024 20:07                3416
function.ps-setlinecap.php                         17-Jul-2024 20:07                3942
function.ps-setlinejoin.php                        17-Jul-2024 20:07                3960
function.ps-setlinewidth.php                       17-Jul-2024 20:07                3824
function.ps-setmiterlimit.php                      17-Jul-2024 20:07                4244
function.ps-setoverprintmode.php                   17-Jul-2024 20:07                3214
function.ps-setpolydash.php                        17-Jul-2024 20:07                7838
function.ps-shading-pattern.php                    17-Jul-2024 20:07                4350
function.ps-shading.php                            17-Jul-2024 20:07                7285
function.ps-shfill.php                             17-Jul-2024 20:07                4065
function.ps-show-boxed.php                         17-Jul-2024 20:07               12829
function.ps-show-xy.php                            17-Jul-2024 20:07                4344
function.ps-show-xy2.php                           17-Jul-2024 20:07                3191
function.ps-show.php                               17-Jul-2024 20:07                5849
function.ps-show2.php                              17-Jul-2024 20:07                3415
function.ps-string-geometry.php                    17-Jul-2024 20:07                4948
function.ps-stringwidth.php                        17-Jul-2024 20:07                4425
function.ps-stroke.php                             17-Jul-2024 20:07                3545
function.ps-symbol-name.php                        17-Jul-2024 20:07                3953
function.ps-symbol-width.php                       17-Jul-2024 20:07                4497
function.ps-symbol.php                             17-Jul-2024 20:07                3811
function.ps-translate.php                          17-Jul-2024 20:07               14232
function.pspell-add-to-personal.php                17-Jul-2024 20:07                6469
function.pspell-add-to-session.php                 17-Jul-2024 20:07                4114
function.pspell-check.php                          17-Jul-2024 20:07                5041
function.pspell-clear-session.php                  17-Jul-2024 20:07                5881
function.pspell-config-create.php                  17-Jul-2024 20:07                8053
function.pspell-config-data-dir.php                17-Jul-2024 20:07                3394
function.pspell-config-dict-dir.php                17-Jul-2024 20:07                3393
function.pspell-config-ignore.php                  17-Jul-2024 20:07                5765
function.pspell-config-mode.php                    17-Jul-2024 20:07                6609
function.pspell-config-personal.php                17-Jul-2024 20:07                6555
function.pspell-config-repl.php                    17-Jul-2024 20:07                6858
function.pspell-config-runtogether.php             17-Jul-2024 20:07                6418
function.pspell-config-save-repl.php               17-Jul-2024 20:07                5350
function.pspell-new-config.php                     17-Jul-2024 20:07                6401
function.pspell-new-personal.php                   17-Jul-2024 20:07               10997
function.pspell-new.php                            17-Jul-2024 20:07                9530
function.pspell-save-wordlist.php                  17-Jul-2024 20:07                6077
function.pspell-store-replacement.php              17-Jul-2024 20:07                7752
function.pspell-suggest.php                        17-Jul-2024 20:07                5577
function.putenv.php                                17-Jul-2024 20:07                3988
function.quoted-printable-decode.php               17-Jul-2024 20:07                5123
function.quoted-printable-encode.php               17-Jul-2024 20:07                5106
function.quotemeta.php                             17-Jul-2024 20:07                5722
function.rad2deg.php                               17-Jul-2024 20:07                3527
function.radius-acct-open.php                      17-Jul-2024 20:07                3229
function.radius-add-server.php                     17-Jul-2024 20:07                7798
function.radius-auth-open.php                      17-Jul-2024 20:07                3242
function.radius-close.php                          17-Jul-2024 20:07                2694
function.radius-config.php                         17-Jul-2024 20:07                4105
function.radius-create-request.php                 17-Jul-2024 20:07                5351
function.radius-cvt-addr.php                       17-Jul-2024 20:07                6214
function.radius-cvt-int.php                        17-Jul-2024 20:07                5614
function.radius-cvt-string.php                     17-Jul-2024 20:07                5668
function.radius-demangle-mppe-key.php              17-Jul-2024 20:07                3257
function.radius-demangle.php                       17-Jul-2024 20:07                2988
function.radius-get-attr.php                       17-Jul-2024 20:07                6468
function.radius-get-tagged-attr-data.php           17-Jul-2024 20:07                6566
function.radius-get-tagged-attr-tag.php            17-Jul-2024 20:07                6619
function.radius-get-vendor-attr.php                17-Jul-2024 20:07                8209
function.radius-put-addr.php                       17-Jul-2024 20:07                5640
function.radius-put-attr.php                       17-Jul-2024 20:07                8866
function.radius-put-int.php                        17-Jul-2024 20:07                7603
function.radius-put-string.php                     17-Jul-2024 20:07                7983
function.radius-put-vendor-addr.php                17-Jul-2024 20:07                5589
function.radius-put-vendor-attr.php                17-Jul-2024 20:07                7845
function.radius-put-vendor-int.php                 17-Jul-2024 20:07                6361
function.radius-put-vendor-string.php              17-Jul-2024 20:07                6754
function.radius-request-authenticator.php          17-Jul-2024 20:07                3179
function.radius-salt-encrypt-attr.php              17-Jul-2024 20:07                4277
function.radius-send-request.php                   17-Jul-2024 20:07                4019
function.radius-server-secret.php                  17-Jul-2024 20:07                2716
function.radius-strerror.php                       17-Jul-2024 20:07                2601
function.rand.php                                  17-Jul-2024 20:07               10077
function.random-bytes.php                          17-Jul-2024 20:07                9507
function.random-int.php                            17-Jul-2024 20:07                9230
function.range.php                                 17-Jul-2024 20:07               16605
function.rar-wrapper-cache-stats.php               17-Jul-2024 20:07                2315
function.rawurldecode.php                          17-Jul-2024 20:07                4618
function.rawurlencode.php                          17-Jul-2024 20:07                6230
function.read-exif-data.php                        17-Jul-2024 20:07                2461
function.readdir.php                               17-Jul-2024 20:07                9894
function.readfile.php                              17-Jul-2024 20:07                9737
function.readgzfile.php                            17-Jul-2024 20:07                4551
function.readline-add-history.php                  17-Jul-2024 20:07                2778
function.readline-callback-handler-install.php     17-Jul-2024 20:07                9285
function.readline-callback-handler-remove.php      17-Jul-2024 20:07                3817
function.readline-callback-read-char.php           17-Jul-2024 20:07                3753
function.readline-clear-history.php                17-Jul-2024 20:07                2506
function.readline-completion-function.php          17-Jul-2024 20:07                2979
function.readline-info.php                         17-Jul-2024 20:07                4830
function.readline-list-history.php                 17-Jul-2024 20:07                2299
function.readline-on-new-line.php                  17-Jul-2024 20:07                2598
function.readline-read-history.php                 17-Jul-2024 20:07                3484
function.readline-redisplay.php                    17-Jul-2024 20:07                2239
function.readline-write-history.php                17-Jul-2024 20:07                3456
function.readline.php                              17-Jul-2024 20:07                5112
function.readlink.php                              17-Jul-2024 20:07                4520
function.realpath-cache-get.php                    17-Jul-2024 20:07                4163
function.realpath-cache-size.php                   17-Jul-2024 20:07                3693
function.realpath.php                              17-Jul-2024 20:07                8390
function.recode-file.php                           17-Jul-2024 20:07                5876
function.recode-string.php                         17-Jul-2024 20:07                5201
function.recode.php                                17-Jul-2024 20:07                1727
function.register-shutdown-function.php            17-Jul-2024 20:07                7292
function.register-tick-function.php                17-Jul-2024 20:07                5448
function.rename.php                                17-Jul-2024 20:07                6004
function.require-once.php                          17-Jul-2024 20:07                1801
function.require.php                               17-Jul-2024 20:07                2032
function.reset.php                                 17-Jul-2024 20:07                9448
function.restore-error-handler.php                 17-Jul-2024 20:07                5742
function.restore-exception-handler.php             17-Jul-2024 20:07                6490
function.restore-include-path.php                  17-Jul-2024 20:07                5052
function.return.php                                17-Jul-2024 20:07                4129
function.rewind.php                                17-Jul-2024 20:07                6292
function.rewinddir.php                             17-Jul-2024 20:07                3522
function.rmdir.php                                 17-Jul-2024 20:07                5200
function.rnp-backend-string.php                    17-Jul-2024 20:07                2242
function.rnp-backend-version.php                   17-Jul-2024 20:07                2178
function.rnp-decrypt.php                           17-Jul-2024 20:07                3237
function.rnp-dump-packets-to-json.php              17-Jul-2024 20:07                3151
function.rnp-dump-packets.php                      17-Jul-2024 20:07                3105
function.rnp-ffi-create.php                        17-Jul-2024 20:07                3200
function.rnp-ffi-destroy.php                       17-Jul-2024 20:07                2436
function.rnp-ffi-set-pass-provider.php             17-Jul-2024 20:07                6730
function.rnp-import-keys.php                       17-Jul-2024 20:07                3489
function.rnp-import-signatures.php                 17-Jul-2024 20:07                3479
function.rnp-key-export-autocrypt.php              17-Jul-2024 20:07                4540
function.rnp-key-export-revocation.php             17-Jul-2024 20:07                5185
function.rnp-key-export.php                        17-Jul-2024 20:07                3459
function.rnp-key-get-info.php                      17-Jul-2024 20:07                7972
function.rnp-key-remove.php                        17-Jul-2024 20:07                3599
function.rnp-key-revoke.php                        17-Jul-2024 20:07                4831
function.rnp-list-keys.php                         17-Jul-2024 20:07                3142
function.rnp-load-keys-from-path.php               17-Jul-2024 20:07                3838
function.rnp-load-keys.php                         17-Jul-2024 20:07                3794
function.rnp-locate-key.php                        17-Jul-2024 20:07                3562
function.rnp-op-encrypt.php                        17-Jul-2024 20:07                7924
function.rnp-op-generate-key.php                   17-Jul-2024 20:07                7543
function.rnp-op-sign-cleartext.php                 17-Jul-2024 20:07                5193
function.rnp-op-sign-detached.php                  17-Jul-2024 20:07                5072
function.rnp-op-sign.php                           17-Jul-2024 20:07                6153
function.rnp-op-verify-detached.php                17-Jul-2024 20:07                7077
function.rnp-op-verify.php                         17-Jul-2024 20:07                6816
function.rnp-save-keys-to-path.php                 17-Jul-2024 20:07                3852
function.rnp-save-keys.php                         17-Jul-2024 20:07                3825
function.rnp-supported-features.php                17-Jul-2024 20:07                2919
function.rnp-version-string-full.php               17-Jul-2024 20:07                2263
function.rnp-version-string.php                    17-Jul-2024 20:07                2160
function.round.php                                 17-Jul-2024 20:07               23890
function.rpmaddtag.php                             17-Jul-2024 20:07                3318
function.rpmdbinfo.php                             17-Jul-2024 20:07                5212
function.rpmdbsearch.php                           17-Jul-2024 20:07                6112
function.rpmgetsymlink.php                         17-Jul-2024 20:07                2963
function.rpminfo.php                               17-Jul-2024 20:07                5394
function.rpmvercmp.php                             17-Jul-2024 20:07                4885
function.rrd-create.php                            17-Jul-2024 20:07                2924
function.rrd-error.php                             17-Jul-2024 20:07                2096
function.rrd-fetch.php                             17-Jul-2024 20:07                2901
function.rrd-first.php                             17-Jul-2024 20:07                2879
function.rrd-graph.php                             17-Jul-2024 20:07                3088
function.rrd-info.php                              17-Jul-2024 20:07                2501
function.rrd-last.php                              17-Jul-2024 20:07                2417
function.rrd-lastupdate.php                        17-Jul-2024 20:07                2610
function.rrd-restore.php                           17-Jul-2024 20:07                3334
function.rrd-tune.php                              17-Jul-2024 20:07                2989
function.rrd-update.php                            17-Jul-2024 20:07                3055
function.rrd-version.php                           17-Jul-2024 20:07                2163
function.rrd-xport.php                             17-Jul-2024 20:07                2674
function.rrdc-disconnect.php                       17-Jul-2024 20:07                2458
function.rsort.php                                 17-Jul-2024 20:07                9331
function.rtrim.php                                 17-Jul-2024 20:07                9468
function.runkit7-constant-add.php                  17-Jul-2024 20:07                4409
function.runkit7-constant-redefine.php             17-Jul-2024 20:07                4309
function.runkit7-constant-remove.php               17-Jul-2024 20:07                3619
function.runkit7-function-add.php                  17-Jul-2024 20:07                9696
function.runkit7-function-copy.php                 17-Jul-2024 20:07                5478
function.runkit7-function-redefine.php             17-Jul-2024 20:07               10098
function.runkit7-function-remove.php               17-Jul-2024 20:07                4061
function.runkit7-function-rename.php               17-Jul-2024 20:07                4338
function.runkit7-import.php                        17-Jul-2024 20:07                3826
function.runkit7-method-add.php                    17-Jul-2024 20:07               11737
function.runkit7-method-copy.php                   17-Jul-2024 20:07                7038
function.runkit7-method-redefine.php               17-Jul-2024 20:07               12173
function.runkit7-method-remove.php                 17-Jul-2024 20:07                6403
function.runkit7-method-rename.php                 17-Jul-2024 20:07                6565
function.runkit7-object-id.php                     17-Jul-2024 20:07                3745
function.runkit7-superglobals.php                  17-Jul-2024 20:07                2613
function.runkit7-zval-inspect.php                  17-Jul-2024 20:07                5085
function.sapi-windows-cp-conv.php                  17-Jul-2024 20:07                4731
function.sapi-windows-cp-get.php                   17-Jul-2024 20:07                3448
function.sapi-windows-cp-is-utf8.php               17-Jul-2024 20:07                2718
function.sapi-windows-cp-set.php                   17-Jul-2024 20:07                3062
function.sapi-windows-generate-ctrl-event.php      17-Jul-2024 20:07                7817
function.sapi-windows-set-ctrl-handler.php         17-Jul-2024 20:07                7610
function.sapi-windows-vt100-support.php            17-Jul-2024 20:07               11150
function.scandir.php                               17-Jul-2024 20:07                8515
function.scoutapm-get-calls.php                    17-Jul-2024 20:07                4431
function.scoutapm-list-instrumented-functions.php  17-Jul-2024 20:07                3771
function.seaslog-get-author.php                    17-Jul-2024 20:07                3096
function.seaslog-get-version.php                   17-Jul-2024 20:07                3083
function.sem-acquire.php                           17-Jul-2024 20:07                5272
function.sem-get.php                               17-Jul-2024 20:07                7119
function.sem-release.php                           17-Jul-2024 20:07                4286
function.sem-remove.php                            17-Jul-2024 20:07                4252
function.serialize.php                             17-Jul-2024 20:07               10142
function.session-abort.php                         17-Jul-2024 20:07                4157
function.session-cache-expire.php                  17-Jul-2024 20:07                7520
function.session-cache-limiter.php                 17-Jul-2024 20:07                8865
function.session-commit.php                        17-Jul-2024 20:07                1839
function.session-create-id.php                     17-Jul-2024 20:07                9851
function.session-decode.php                        17-Jul-2024 20:07                3739
function.session-destroy.php                       17-Jul-2024 20:07                8819
function.session-encode.php                        17-Jul-2024 20:07                3820
function.session-gc.php                            17-Jul-2024 20:07                7598
function.session-get-cookie-params.php             17-Jul-2024 20:07                5304
function.session-id.php                            17-Jul-2024 20:07                5984
function.session-module-name.php                   17-Jul-2024 20:07                4375
function.session-name.php                          17-Jul-2024 20:07                7738
function.session-regenerate-id.php                 17-Jul-2024 20:07               15798
function.session-register-shutdown.php             17-Jul-2024 20:07                2721
function.session-reset.php                         17-Jul-2024 20:07                4247
function.session-save-path.php                     17-Jul-2024 20:07                4747
function.session-set-cookie-params.php             17-Jul-2024 20:07               10519
function.session-set-save-handler.php              17-Jul-2024 20:07               22983
function.session-start.php                         17-Jul-2024 20:07               14370
function.session-status.php                        17-Jul-2024 20:07                3252
function.session-unset.php                         17-Jul-2024 20:07                4811
function.session-write-close.php                   17-Jul-2024 20:07                4061
function.set-error-handler.php                     17-Jul-2024 20:07               25410
function.set-exception-handler.php                 17-Jul-2024 20:07                6869
function.set-file-buffer.php                       17-Jul-2024 20:07                1804
function.set-include-path.php                      17-Jul-2024 20:07                6115
function.set-time-limit.php                        17-Jul-2024 20:07                4485
function.setcookie.php                             17-Jul-2024 20:07               25208
function.setlocale.php                             17-Jul-2024 20:07               14559
function.setrawcookie.php                          17-Jul-2024 20:07                6225
function.settype.php                               17-Jul-2024 20:07                6296
function.sha1-file.php                             17-Jul-2024 20:07                5681
function.sha1.php                                  17-Jul-2024 20:07                5131
function.shell-exec.php                            17-Jul-2024 20:07                5654
function.shm-attach.php                            17-Jul-2024 20:07                6001
function.shm-detach.php                            17-Jul-2024 20:07                4513
function.shm-get-var.php                           17-Jul-2024 20:07                4342
function.shm-has-var.php                           17-Jul-2024 20:07                4365
function.shm-put-var.php                           17-Jul-2024 20:07                5418
function.shm-remove-var.php                        17-Jul-2024 20:07                4256
function.shm-remove.php                            17-Jul-2024 20:07                3983
function.shmop-close.php                           17-Jul-2024 20:07                4774
function.shmop-delete.php                          17-Jul-2024 20:07                4252
function.shmop-open.php                            17-Jul-2024 20:07                9524
function.shmop-read.php                            17-Jul-2024 20:07                6713
function.shmop-size.php                            17-Jul-2024 20:07                4267
function.shmop-write.php                           17-Jul-2024 20:07                6183
function.show-source.php                           17-Jul-2024 20:07                1762
function.shuffle.php                               17-Jul-2024 20:07                6879
function.simdjson-decode.php                       17-Jul-2024 20:07               17017
function.simdjson-is-valid.php                     17-Jul-2024 20:07               10464
function.simdjson-key-count.php                    17-Jul-2024 20:07                4804
function.simdjson-key-exists.php                   17-Jul-2024 20:07                4599
function.simdjson-key-value.php                    17-Jul-2024 20:07                7328
function.similar-text.php                          17-Jul-2024 20:07                7187
function.simplexml-import-dom.php                  17-Jul-2024 20:07                6359
function.simplexml-load-file.php                   17-Jul-2024 20:07               10175
function.simplexml-load-string.php                 17-Jul-2024 20:07                9907
function.sin.php                                   17-Jul-2024 20:07                4514
function.sinh.php                                  17-Jul-2024 20:07                3139
function.sizeof.php                                17-Jul-2024 20:07                1655
function.sleep.php                                 17-Jul-2024 20:07                6980
function.snmp-get-quick-print.php                  17-Jul-2024 20:07                3615
function.snmp-get-valueretrieval.php               17-Jul-2024 20:07                4425
function.snmp-read-mib.php                         17-Jul-2024 20:07                4886
function.snmp-set-enum-print.php                   17-Jul-2024 20:07                5357
function.snmp-set-oid-numeric-print.php            17-Jul-2024 20:07                2332
function.snmp-set-oid-output-format.php            17-Jul-2024 20:07                7787
function.snmp-set-quick-print.php                  17-Jul-2024 20:07                7006
function.snmp-set-valueretrieval.php               17-Jul-2024 20:07                9485
function.snmp2-get.php                             17-Jul-2024 20:07                5797
function.snmp2-getnext.php                         17-Jul-2024 20:07                6165
function.snmp2-real-walk.php                       17-Jul-2024 20:07                6604
function.snmp2-set.php                             17-Jul-2024 20:07               10888
function.snmp2-walk.php                            17-Jul-2024 20:07                7089
function.snmp3-get.php                             17-Jul-2024 20:07                8890
function.snmp3-getnext.php                         17-Jul-2024 20:07                9218
function.snmp3-real-walk.php                       17-Jul-2024 20:07                9896
function.snmp3-set.php                             17-Jul-2024 20:07               13669
function.snmp3-walk.php                            17-Jul-2024 20:07               10363
function.snmpget.php                               17-Jul-2024 20:07                5719
function.snmpgetnext.php                           17-Jul-2024 20:07                6031
function.snmprealwalk.php                          17-Jul-2024 20:07                6355
function.snmpset.php                               17-Jul-2024 20:07               10842
function.snmpwalk.php                              17-Jul-2024 20:07                6972
function.snmpwalkoid.php                           17-Jul-2024 20:07                7701
function.socket-accept.php                         17-Jul-2024 20:07                6700
function.socket-addrinfo-bind.php                  17-Jul-2024 20:07                5382
function.socket-addrinfo-connect.php               17-Jul-2024 20:07                5151
function.socket-addrinfo-explain.php               17-Jul-2024 20:07                4426
function.socket-addrinfo-lookup.php                17-Jul-2024 20:07                5980
function.socket-atmark.php                         17-Jul-2024 20:07                4943
function.socket-bind.php                           17-Jul-2024 20:07               10858
function.socket-clear-error.php                    17-Jul-2024 20:07                4602
function.socket-close.php                          17-Jul-2024 20:07                4551
function.socket-cmsg-space.php                     17-Jul-2024 20:07                3724
function.socket-connect.php                        17-Jul-2024 20:07                7804
function.socket-create-listen.php                  17-Jul-2024 20:07                7000
function.socket-create-pair.php                    17-Jul-2024 20:07               19495
function.socket-create.php                         17-Jul-2024 20:07               12025
function.socket-export-stream.php                  17-Jul-2024 20:07                3485
function.socket-get-option.php                     17-Jul-2024 20:07               30099
function.socket-get-status.php                     17-Jul-2024 20:07                1838
function.socket-getopt.php                         17-Jul-2024 20:07                1818
function.socket-getpeername.php                    17-Jul-2024 20:07                8316
function.socket-getsockname.php                    17-Jul-2024 20:07                7611
function.socket-import-stream.php                  17-Jul-2024 20:07                5123
function.socket-last-error.php                     17-Jul-2024 20:07                7219
function.socket-listen.php                         17-Jul-2024 20:07                7001
function.socket-read.php                           17-Jul-2024 20:07                7963
function.socket-recv.php                           17-Jul-2024 20:07               16499
function.socket-recvfrom.php                       17-Jul-2024 20:07               13606
function.socket-recvmsg.php                        17-Jul-2024 20:07                4380
function.socket-select.php                         17-Jul-2024 20:07               14886
function.socket-send.php                           17-Jul-2024 20:07                6718
function.socket-sendmsg.php                        17-Jul-2024 20:07                4513
function.socket-sendto.php                         17-Jul-2024 20:07               10011
function.socket-set-block.php                      17-Jul-2024 20:07                6090
function.socket-set-blocking.php                   17-Jul-2024 20:07                1858
function.socket-set-nonblock.php                   17-Jul-2024 20:07                6476
function.socket-set-option.php                     17-Jul-2024 20:07               11300
function.socket-set-timeout.php                    17-Jul-2024 20:07                1826
function.socket-setopt.php                         17-Jul-2024 20:07                1812
function.socket-shutdown.php                       17-Jul-2024 20:07                4918
function.socket-strerror.php                       17-Jul-2024 20:07                7019
function.socket-write.php                          17-Jul-2024 20:07                7151
function.socket-wsaprotocol-info-export.php        17-Jul-2024 20:07                5003
function.socket-wsaprotocol-info-import.php        17-Jul-2024 20:07                4370
function.socket-wsaprotocol-info-release.php       17-Jul-2024 20:07                3566
function.sodium-add.php                            17-Jul-2024 20:07                3178
function.sodium-base642bin.php                     17-Jul-2024 20:07                4885
function.sodium-bin2base64.php                     17-Jul-2024 20:07                4415
function.sodium-bin2hex.php                        17-Jul-2024 20:07                2792
function.sodium-compare.php                        17-Jul-2024 20:07                3416
function.sodium-crypto-aead-aes256gcm-decrypt.php  17-Jul-2024 20:07                4795
function.sodium-crypto-aead-aes256gcm-encrypt.php  17-Jul-2024 20:07                4596
function.sodium-crypto-aead-aes256gcm-is-availa..> 17-Jul-2024 20:07                2826
function.sodium-crypto-aead-aes256gcm-keygen.php   17-Jul-2024 20:07                2816
function.sodium-crypto-aead-chacha20poly1305-de..> 17-Jul-2024 20:07                4660
function.sodium-crypto-aead-chacha20poly1305-en..> 17-Jul-2024 20:07                4476
function.sodium-crypto-aead-chacha20poly1305-ie..> 17-Jul-2024 20:07                4890
function.sodium-crypto-aead-chacha20poly1305-ie..> 17-Jul-2024 20:07                4642
function.sodium-crypto-aead-chacha20poly1305-ie..> 17-Jul-2024 20:07                3010
function.sodium-crypto-aead-chacha20poly1305-ke..> 17-Jul-2024 20:07                2945
function.sodium-crypto-aead-xchacha20poly1305-i..> 17-Jul-2024 20:07                5068
function.sodium-crypto-aead-xchacha20poly1305-i..> 17-Jul-2024 20:07                4860
function.sodium-crypto-aead-xchacha20poly1305-i..> 17-Jul-2024 20:07                2986
function.sodium-crypto-auth-keygen.php             17-Jul-2024 20:07                2637
function.sodium-crypto-auth-verify.php             17-Jul-2024 20:07                3981
function.sodium-crypto-auth.php                    17-Jul-2024 20:07                3448
function.sodium-crypto-box-keypair-from-secretk..> 17-Jul-2024 20:07                3527
function.sodium-crypto-box-keypair.php             17-Jul-2024 20:07                2918
function.sodium-crypto-box-open.php                17-Jul-2024 20:07                4095
function.sodium-crypto-box-publickey-from-secre..> 17-Jul-2024 20:07                3358
function.sodium-crypto-box-publickey.php           17-Jul-2024 20:07                3071
function.sodium-crypto-box-seal-open.php           17-Jul-2024 20:07                6151
function.sodium-crypto-box-seal.php                17-Jul-2024 20:07                7273
function.sodium-crypto-box-secretkey.php           17-Jul-2024 20:07                3038
function.sodium-crypto-box-seed-keypair.php        17-Jul-2024 20:07                3097
function.sodium-crypto-box.php                     17-Jul-2024 20:07                4414
function.sodium-crypto-core-ristretto255-add.php   17-Jul-2024 20:07                6081
function.sodium-crypto-core-ristretto255-from-h..> 17-Jul-2024 20:07                5441
function.sodium-crypto-core-ristretto255-is-val..> 17-Jul-2024 20:07                5606
function.sodium-crypto-core-ristretto255-random..> 17-Jul-2024 20:07                5578
function.sodium-crypto-core-ristretto255-scalar..> 17-Jul-2024 20:07                6348
function.sodium-crypto-core-ristretto255-scalar..> 17-Jul-2024 20:07                3599
function.sodium-crypto-core-ristretto255-scalar..> 17-Jul-2024 20:07                5440
function.sodium-crypto-core-ristretto255-scalar..> 17-Jul-2024 20:07                3858
function.sodium-crypto-core-ristretto255-scalar..> 17-Jul-2024 20:07                5424
function.sodium-crypto-core-ristretto255-scalar..> 17-Jul-2024 20:07                5737
function.sodium-crypto-core-ristretto255-scalar..> 17-Jul-2024 20:07                3543
function.sodium-crypto-core-ristretto255-scalar..> 17-Jul-2024 20:07                6339
function.sodium-crypto-core-ristretto255-sub.php   17-Jul-2024 20:07                6118
function.sodium-crypto-generichash-final.php       17-Jul-2024 20:07                6898
function.sodium-crypto-generichash-init.php        17-Jul-2024 20:07                6944
function.sodium-crypto-generichash-keygen.php      17-Jul-2024 20:07                2447
function.sodium-crypto-generichash-update.php      17-Jul-2024 20:07                6579
function.sodium-crypto-generichash.php             17-Jul-2024 20:07                3853
function.sodium-crypto-kdf-derive-from-key.php     17-Jul-2024 20:07                4064
function.sodium-crypto-kdf-keygen.php              17-Jul-2024 20:07                2549
function.sodium-crypto-kx-client-session-keys.php  17-Jul-2024 20:07                3480
function.sodium-crypto-kx-keypair.php              17-Jul-2024 20:07                5002
function.sodium-crypto-kx-publickey.php            17-Jul-2024 20:07                2890
function.sodium-crypto-kx-secretkey.php            17-Jul-2024 20:07                2901
function.sodium-crypto-kx-seed-keypair.php         17-Jul-2024 20:07                2802
function.sodium-crypto-kx-server-session-keys.php  17-Jul-2024 20:07                3546
function.sodium-crypto-pwhash-scryptsalsa208sha..> 17-Jul-2024 20:07                3407
function.sodium-crypto-pwhash-scryptsalsa208sha..> 17-Jul-2024 20:07                3610
function.sodium-crypto-pwhash-scryptsalsa208sha..> 17-Jul-2024 20:07                6546
function.sodium-crypto-pwhash-str-needs-rehash.php 17-Jul-2024 20:07                4023
function.sodium-crypto-pwhash-str-verify.php       17-Jul-2024 20:07                4881
function.sodium-crypto-pwhash-str.php              17-Jul-2024 20:07                8695
function.sodium-crypto-pwhash.php                  17-Jul-2024 20:07               10516
function.sodium-crypto-scalarmult-base.php         17-Jul-2024 20:07                2065
function.sodium-crypto-scalarmult-ristretto255-..> 17-Jul-2024 20:07                3512
function.sodium-crypto-scalarmult-ristretto255.php 17-Jul-2024 20:07                3861
function.sodium-crypto-scalarmult.php              17-Jul-2024 20:07                3072
function.sodium-crypto-secretbox-keygen.php        17-Jul-2024 20:07                6230
function.sodium-crypto-secretbox-open.php          17-Jul-2024 20:07                8871
function.sodium-crypto-secretbox.php               17-Jul-2024 20:07                8863
function.sodium-crypto-secretstream-xchacha20po..> 17-Jul-2024 20:07               11025
function.sodium-crypto-secretstream-xchacha20po..> 17-Jul-2024 20:07               10359
function.sodium-crypto-secretstream-xchacha20po..> 17-Jul-2024 20:07                2713
function.sodium-crypto-secretstream-xchacha20po..> 17-Jul-2024 20:07                6227
function.sodium-crypto-secretstream-xchacha20po..> 17-Jul-2024 20:07                6436
function.sodium-crypto-secretstream-xchacha20po..> 17-Jul-2024 20:07                2976
function.sodium-crypto-shorthash-keygen.php        17-Jul-2024 20:07                2660
function.sodium-crypto-shorthash.php               17-Jul-2024 20:07                3281
function.sodium-crypto-sign-detached.php           17-Jul-2024 20:07                3274
function.sodium-crypto-sign-ed25519-pk-to-curve..> 17-Jul-2024 20:07                2961
function.sodium-crypto-sign-ed25519-sk-to-curve..> 17-Jul-2024 20:07                3114
function.sodium-crypto-sign-keypair-from-secret..> 17-Jul-2024 20:07                3353
function.sodium-crypto-sign-keypair.php            17-Jul-2024 20:07                2435
function.sodium-crypto-sign-open.php               17-Jul-2024 20:07                3364
function.sodium-crypto-sign-publickey-from-secr..> 17-Jul-2024 20:07                2916
function.sodium-crypto-sign-publickey.php          17-Jul-2024 20:07                2926
function.sodium-crypto-sign-secretkey.php          17-Jul-2024 20:07                2902
function.sodium-crypto-sign-seed-keypair.php       17-Jul-2024 20:07                3135
function.sodium-crypto-sign-verify-detached.php    17-Jul-2024 20:07                3661
function.sodium-crypto-sign.php                    17-Jul-2024 20:07                3352
function.sodium-crypto-stream-keygen.php           17-Jul-2024 20:07                2618
function.sodium-crypto-stream-xchacha20-keygen.php 17-Jul-2024 20:07                2776
function.sodium-crypto-stream-xchacha20-xor-ic.php 17-Jul-2024 20:07                9804
function.sodium-crypto-stream-xchacha20-xor.php    17-Jul-2024 20:07                4888
function.sodium-crypto-stream-xchacha20.php        17-Jul-2024 20:07                3808
function.sodium-crypto-stream-xor.php              17-Jul-2024 20:07                3691
function.sodium-crypto-stream.php                  17-Jul-2024 20:07                3527
function.sodium-hex2bin.php                        17-Jul-2024 20:07                3400
function.sodium-increment.php                      17-Jul-2024 20:07                2516
function.sodium-memcmp.php                         17-Jul-2024 20:07                3720
function.sodium-memzero.php                        17-Jul-2024 20:07                2608
function.sodium-pad.php                            17-Jul-2024 20:07                2849
function.sodium-unpad.php                          17-Jul-2024 20:07                2804
function.solr-get-version.php                      17-Jul-2024 20:07                3855
function.sort.php                                  17-Jul-2024 20:07               12086
function.soundex.php                               17-Jul-2024 20:07                7231
function.spl-autoload-call.php                     17-Jul-2024 20:07                2592
function.spl-autoload-extensions.php               17-Jul-2024 20:07                4859
function.spl-autoload-functions.php                17-Jul-2024 20:07                3188
function.spl-autoload-register.php                 17-Jul-2024 20:07               13242
function.spl-autoload-unregister.php               17-Jul-2024 20:07                3056
function.spl-autoload.php                          17-Jul-2024 20:07                4659
function.spl-classes.php                           17-Jul-2024 20:07                3770
function.spl-object-hash.php                       17-Jul-2024 20:07                4956
function.spl-object-id.php                         17-Jul-2024 20:07                4147
function.sprintf.php                               17-Jul-2024 20:07               27653
function.sqlsrv-begin-transaction.php              17-Jul-2024 20:07               11252
function.sqlsrv-cancel.php                         17-Jul-2024 20:07               10348
function.sqlsrv-client-info.php                    17-Jul-2024 20:07                6767
function.sqlsrv-close.php                          17-Jul-2024 20:07                5617
function.sqlsrv-commit.php                         17-Jul-2024 20:07               11132
function.sqlsrv-configure.php                      17-Jul-2024 20:07                4741
function.sqlsrv-connect.php                        17-Jul-2024 20:07               12238
function.sqlsrv-errors.php                         17-Jul-2024 20:07               10056
function.sqlsrv-execute.php                        17-Jul-2024 20:07               10171
function.sqlsrv-fetch-array.php                    17-Jul-2024 20:07               15647
function.sqlsrv-fetch-object.php                   17-Jul-2024 20:07               12393
function.sqlsrv-fetch.php                          17-Jul-2024 20:07               10840
function.sqlsrv-field-metadata.php                 17-Jul-2024 20:07                8878
function.sqlsrv-free-stmt.php                      17-Jul-2024 20:07                7749
function.sqlsrv-get-config.php                     17-Jul-2024 20:07                3344
function.sqlsrv-get-field.php                      17-Jul-2024 20:07               10212
function.sqlsrv-has-rows.php                       17-Jul-2024 20:07                6371
function.sqlsrv-next-result.php                    17-Jul-2024 20:07                9285
function.sqlsrv-num-fields.php                     17-Jul-2024 20:07                8205
function.sqlsrv-num-rows.php                       17-Jul-2024 20:07                7932
function.sqlsrv-prepare.php                        17-Jul-2024 20:07               14550
function.sqlsrv-query.php                          17-Jul-2024 20:07               11903
function.sqlsrv-rollback.php                       17-Jul-2024 20:07               10602
function.sqlsrv-rows-affected.php                  17-Jul-2024 20:07                7982
function.sqlsrv-send-stream-data.php               17-Jul-2024 20:07                8551
function.sqlsrv-server-info.php                    17-Jul-2024 20:07                6167
function.sqrt.php                                  17-Jul-2024 20:07                4541
function.srand.php                                 17-Jul-2024 20:07                6939
function.sscanf.php                                17-Jul-2024 20:07               11215
function.ssdeep-fuzzy-compare.php                  17-Jul-2024 20:07                3286
function.ssdeep-fuzzy-hash-filename.php            17-Jul-2024 20:07                3011
function.ssdeep-fuzzy-hash.php                     17-Jul-2024 20:07                2855
function.ssh2-auth-agent.php                       17-Jul-2024 20:07                4782
function.ssh2-auth-hostbased-file.php              17-Jul-2024 20:07                7762
function.ssh2-auth-none.php                        17-Jul-2024 20:07                4886
function.ssh2-auth-password.php                    17-Jul-2024 20:07                5045
function.ssh2-auth-pubkey-file.php                 17-Jul-2024 20:07                7263
function.ssh2-connect.php                          17-Jul-2024 20:07               15776
function.ssh2-disconnect.php                       17-Jul-2024 20:07                3112
function.ssh2-exec.php                             17-Jul-2024 20:07                7649
function.ssh2-fetch-stream.php                     17-Jul-2024 20:07                5558
function.ssh2-fingerprint.php                      17-Jul-2024 20:07                5557
function.ssh2-forward-accept.php                   17-Jul-2024 20:07                3055
function.ssh2-forward-listen.php                   17-Jul-2024 20:07                4494
function.ssh2-methods-negotiated.php               17-Jul-2024 20:07                8016
function.ssh2-poll.php                             17-Jul-2024 20:07                3535
function.ssh2-publickey-add.php                    17-Jul-2024 20:07                8376
function.ssh2-publickey-init.php                   17-Jul-2024 20:07                4617
function.ssh2-publickey-list.php                   17-Jul-2024 20:07                8769
function.ssh2-publickey-remove.php                 17-Jul-2024 20:07                4655
function.ssh2-scp-recv.php                         17-Jul-2024 20:07                5487
function.ssh2-scp-send.php                         17-Jul-2024 20:07                6098
function.ssh2-send-eof.php                         17-Jul-2024 20:07                3465
function.ssh2-sftp-chmod.php                       17-Jul-2024 20:07                5997
function.ssh2-sftp-lstat.php                       17-Jul-2024 20:07                7295
function.ssh2-sftp-mkdir.php                       17-Jul-2024 20:07                6870
function.ssh2-sftp-readlink.php                    17-Jul-2024 20:07                5357
function.ssh2-sftp-realpath.php                    17-Jul-2024 20:07                5579
function.ssh2-sftp-rename.php                      17-Jul-2024 20:07                5589
function.ssh2-sftp-rmdir.php                       17-Jul-2024 20:07                5573
function.ssh2-sftp-stat.php                        17-Jul-2024 20:07                7210
function.ssh2-sftp-symlink.php                     17-Jul-2024 20:07                5779
function.ssh2-sftp-unlink.php                      17-Jul-2024 20:07                5053
function.ssh2-sftp.php                             17-Jul-2024 20:07                5495
function.ssh2-shell.php                            17-Jul-2024 20:07                8110
function.ssh2-tunnel.php                           17-Jul-2024 20:07                5348
function.stat.php                                  17-Jul-2024 20:07               15825
function.stats-absolute-deviation.php              17-Jul-2024 20:07                2844
function.stats-cdf-beta.php                        17-Jul-2024 20:07                5211
function.stats-cdf-binomial.php                    17-Jul-2024 20:07                5196
function.stats-cdf-cauchy.php                      17-Jul-2024 20:07                5231
function.stats-cdf-chisquare.php                   17-Jul-2024 20:07                4550
function.stats-cdf-exponential.php                 17-Jul-2024 20:07                4581
function.stats-cdf-f.php                           17-Jul-2024 20:07                5136
function.stats-cdf-gamma.php                       17-Jul-2024 20:07                5195
function.stats-cdf-laplace.php                     17-Jul-2024 20:07                5216
function.stats-cdf-logistic.php                    17-Jul-2024 20:07                5251
function.stats-cdf-negative-binomial.php           17-Jul-2024 20:07                5339
function.stats-cdf-noncentral-chisquare.php        17-Jul-2024 20:07                5441
function.stats-cdf-noncentral-f.php                17-Jul-2024 20:07                6015
function.stats-cdf-noncentral-t.php                17-Jul-2024 20:07                5301
function.stats-cdf-normal.php                      17-Jul-2024 20:07                5233
function.stats-cdf-poisson.php                     17-Jul-2024 20:07                4515
function.stats-cdf-t.php                           17-Jul-2024 20:07                4443
function.stats-cdf-uniform.php                     17-Jul-2024 20:07                5196
function.stats-cdf-weibull.php                     17-Jul-2024 20:07                5233
function.stats-covariance.php                      17-Jul-2024 20:07                3044
function.stats-dens-beta.php                       17-Jul-2024 20:07                3530
function.stats-dens-cauchy.php                     17-Jul-2024 20:07                3588
function.stats-dens-chisquare.php                  17-Jul-2024 20:07                3258
function.stats-dens-exponential.php                17-Jul-2024 20:07                3248
function.stats-dens-f.php                          17-Jul-2024 20:07                3528
function.stats-dens-gamma.php                      17-Jul-2024 20:07                3581
function.stats-dens-laplace.php                    17-Jul-2024 20:07                3615
function.stats-dens-logistic.php                   17-Jul-2024 20:07                3627
function.stats-dens-normal.php                     17-Jul-2024 20:07                3598
function.stats-dens-pmf-binomial.php               17-Jul-2024 20:07                3652
function.stats-dens-pmf-hypergeometric.php         17-Jul-2024 20:07                4304
function.stats-dens-pmf-negative-binomial.php      17-Jul-2024 20:07                3781
function.stats-dens-pmf-poisson.php                17-Jul-2024 20:07                3249
function.stats-dens-t.php                          17-Jul-2024 20:07                3162
function.stats-dens-uniform.php                    17-Jul-2024 20:07                3563
function.stats-dens-weibull.php                    17-Jul-2024 20:07                3595
function.stats-harmonic-mean.php                   17-Jul-2024 20:07                2743
function.stats-kurtosis.php                        17-Jul-2024 20:07                2751
function.stats-rand-gen-beta.php                   17-Jul-2024 20:07                3057
function.stats-rand-gen-chisquare.php              17-Jul-2024 20:07                2730
function.stats-rand-gen-exponential.php            17-Jul-2024 20:07                2728
function.stats-rand-gen-f.php                      17-Jul-2024 20:07                3111
function.stats-rand-gen-funiform.php               17-Jul-2024 20:07                3038
function.stats-rand-gen-gamma.php                  17-Jul-2024 20:07                3124
function.stats-rand-gen-ibinomial-negative.php     17-Jul-2024 20:07                3204
function.stats-rand-gen-ibinomial.php              17-Jul-2024 20:07                3128
function.stats-rand-gen-int.php                    17-Jul-2024 20:07                2288
function.stats-rand-gen-ipoisson.php               17-Jul-2024 20:07                2703
function.stats-rand-gen-iuniform.php               17-Jul-2024 20:07                3105
function.stats-rand-gen-noncentral-chisquare.php   17-Jul-2024 20:07                3246
function.stats-rand-gen-noncentral-f.php           17-Jul-2024 20:07                3599
function.stats-rand-gen-noncentral-t.php           17-Jul-2024 20:07                3159
function.stats-rand-gen-normal.php                 17-Jul-2024 20:07                3072
function.stats-rand-gen-t.php                      17-Jul-2024 20:07                2622
function.stats-rand-get-seeds.php                  17-Jul-2024 20:07                2331
function.stats-rand-phrase-to-seeds.php            17-Jul-2024 20:07                2711
function.stats-rand-ranf.php                       17-Jul-2024 20:07                2332
function.stats-rand-setall.php                     17-Jul-2024 20:07                2980
function.stats-skew.php                            17-Jul-2024 20:07                2717
function.stats-standard-deviation.php              17-Jul-2024 20:07                3885
function.stats-stat-binomial-coef.php              17-Jul-2024 20:07                3017
function.stats-stat-correlation.php                17-Jul-2024 20:07                3224
function.stats-stat-factorial.php                  17-Jul-2024 20:07                2590
function.stats-stat-independent-t.php              17-Jul-2024 20:07                3305
function.stats-stat-innerproduct.php               17-Jul-2024 20:07                3166
function.stats-stat-paired-t.php                   17-Jul-2024 20:07                3103
function.stats-stat-percentile.php                 17-Jul-2024 20:07                2969
function.stats-stat-powersum.php                   17-Jul-2024 20:07                2961
function.stats-variance.php                        17-Jul-2024 20:07                3388
function.stomp-connect-error.php                   17-Jul-2024 20:07                3692
function.stomp-version.php                         17-Jul-2024 20:07                3123
function.str-contains.php                          17-Jul-2024 20:07                8235
function.str-decrement.php                         17-Jul-2024 20:07                6530
function.str-ends-with.php                         17-Jul-2024 20:07                8164
function.str-getcsv.php                            17-Jul-2024 20:07                9005
function.str-increment.php                         17-Jul-2024 20:07                6217
function.str-ireplace.php                          17-Jul-2024 20:07                9157
function.str-pad.php                               17-Jul-2024 20:07                8231
function.str-repeat.php                            17-Jul-2024 20:07                4649
function.str-replace.php                           17-Jul-2024 20:07               16711
function.str-rot13.php                             17-Jul-2024 20:07                3576
function.str-shuffle.php                           17-Jul-2024 20:07                5924
function.str-split.php                             17-Jul-2024 20:07                8535
function.str-starts-with.php                       17-Jul-2024 20:07                8188
function.str-word-count.php                        17-Jul-2024 20:07                8985
function.strcasecmp.php                            17-Jul-2024 20:07                6213
function.strchr.php                                17-Jul-2024 20:07                1678
function.strcmp.php                                17-Jul-2024 20:07                5991
function.strcoll.php                               17-Jul-2024 20:07                5058
function.strcspn.php                               17-Jul-2024 20:07               11281
function.stream-bucket-append.php                  17-Jul-2024 20:07                2272
function.stream-bucket-make-writeable.php          17-Jul-2024 20:07                4419
function.stream-bucket-new.php                     17-Jul-2024 20:07                2306
function.stream-bucket-prepend.php                 17-Jul-2024 20:07                6334
function.stream-context-create.php                 17-Jul-2024 20:07                7852
function.stream-context-get-default.php            17-Jul-2024 20:07                8900
function.stream-context-get-options.php            17-Jul-2024 20:07                4525
function.stream-context-get-params.php             17-Jul-2024 20:07                5541
function.stream-context-set-default.php            17-Jul-2024 20:07                6271
function.stream-context-set-option.php             17-Jul-2024 20:07                5507
function.stream-context-set-options.php            17-Jul-2024 20:07                6447
function.stream-context-set-params.php             17-Jul-2024 20:07                4699
function.stream-copy-to-stream.php                 17-Jul-2024 20:07                7742
function.stream-filter-append.php                  17-Jul-2024 20:07               10923
function.stream-filter-prepend.php                 17-Jul-2024 20:07                8225
function.stream-filter-register.php                17-Jul-2024 20:07               18417
function.stream-filter-remove.php                  17-Jul-2024 20:07                6664
function.stream-get-contents.php                   17-Jul-2024 20:07                9076
function.stream-get-filters.php                    17-Jul-2024 20:07                4037
function.stream-get-line.php                       17-Jul-2024 20:07                5211
function.stream-get-meta-data.php                  17-Jul-2024 20:07               14497
function.stream-get-transports.php                 17-Jul-2024 20:07                4014
function.stream-get-wrappers.php                   17-Jul-2024 20:07                4769
function.stream-is-local.php                       17-Jul-2024 20:07                4275
function.stream-isatty.php                         17-Jul-2024 20:07                3990
function.stream-notification-callback.php          17-Jul-2024 20:07               22402
function.stream-register-wrapper.php               17-Jul-2024 20:07                1940
function.stream-resolve-include-path.php           17-Jul-2024 20:07                4378
function.stream-select.php                         17-Jul-2024 20:07               16403
function.stream-set-blocking.php                   17-Jul-2024 20:07                4867
function.stream-set-chunk-size.php                 17-Jul-2024 20:07                4292
function.stream-set-read-buffer.php                17-Jul-2024 20:07                3753
function.stream-set-timeout.php                    17-Jul-2024 20:07                8099
function.stream-set-write-buffer.php               17-Jul-2024 20:07                5879
function.stream-socket-accept.php                  17-Jul-2024 20:07                7592
function.stream-socket-client.php                  17-Jul-2024 20:07               17780
function.stream-socket-enable-crypto.php           17-Jul-2024 20:07               13404
function.stream-socket-get-name.php                17-Jul-2024 20:07                3931
function.stream-socket-pair.php                    17-Jul-2024 20:07                9830
function.stream-socket-recvfrom.php                17-Jul-2024 20:07               10836
function.stream-socket-sendto.php                  17-Jul-2024 20:07                7525
function.stream-socket-server.php                  17-Jul-2024 20:07               15191
function.stream-socket-shutdown.php                17-Jul-2024 20:07                6632
function.stream-supports-lock.php                  17-Jul-2024 20:07                3244
function.stream-wrapper-register.php               17-Jul-2024 20:07                9354
function.stream-wrapper-restore.php                17-Jul-2024 20:07                2948
function.stream-wrapper-unregister.php             17-Jul-2024 20:07                3149
function.strftime.php                              17-Jul-2024 20:07               55323
function.strip-tags.php                            17-Jul-2024 20:07                9177
function.stripcslashes.php                         17-Jul-2024 20:07                4040
function.stripos.php                               17-Jul-2024 20:07               11709
function.stripslashes.php                          17-Jul-2024 20:07                7483
function.stristr.php                               17-Jul-2024 20:07               10445
function.strlen.php                                17-Jul-2024 20:07                4935
function.strnatcasecmp.php                         17-Jul-2024 20:07                7432
function.strnatcmp.php                             17-Jul-2024 20:07                8596
function.strncasecmp.php                           17-Jul-2024 20:07                6755
function.strncmp.php                               17-Jul-2024 20:07                6709
function.strpbrk.php                               17-Jul-2024 20:07                5258
function.strpos.php                                17-Jul-2024 20:07               13586
function.strptime.php                              17-Jul-2024 20:07               10827
function.strrchr.php                               17-Jul-2024 20:07                8447
function.strrev.php                                17-Jul-2024 20:07                3223
function.strripos.php                              17-Jul-2024 20:07               10476
function.strrpos.php                               17-Jul-2024 20:07               13130
function.strspn.php                                17-Jul-2024 20:07                9390
function.strstr.php                                17-Jul-2024 20:07                8647
function.strtok.php                                17-Jul-2024 20:07               13299
function.strtolower.php                            17-Jul-2024 20:07                5783
function.strtotime.php                             17-Jul-2024 20:07               12410
function.strtoupper.php                            17-Jul-2024 20:07                5778
function.strtr.php                                 17-Jul-2024 20:07               11427
function.strval.php                                17-Jul-2024 20:07                6196
function.substr-compare.php                        17-Jul-2024 20:07               10959
function.substr-count.php                          17-Jul-2024 20:07                9340
function.substr-replace.php                        17-Jul-2024 20:07               16027
function.substr.php                                17-Jul-2024 20:07               22271
function.svn-add.php                               17-Jul-2024 20:07                6244
function.svn-auth-get-parameter.php                17-Jul-2024 20:07                3956
function.svn-auth-set-parameter.php                17-Jul-2024 20:07                5401
function.svn-blame.php                             17-Jul-2024 20:07                4994
function.svn-cat.php                               17-Jul-2024 20:07                4829
function.svn-checkout.php                          17-Jul-2024 20:07                7354
function.svn-cleanup.php                           17-Jul-2024 20:07                5161
function.svn-client-version.php                    17-Jul-2024 20:07                3460
function.svn-commit.php                            17-Jul-2024 20:07                7809
function.svn-delete.php                            17-Jul-2024 20:07                4712
function.svn-diff.php                              17-Jul-2024 20:07               13391
function.svn-export.php                            17-Jul-2024 20:07                5389
function.svn-fs-abort-txn.php                      17-Jul-2024 20:07                3167
function.svn-fs-apply-text.php                     17-Jul-2024 20:07                2757
function.svn-fs-begin-txn2.php                     17-Jul-2024 20:07                2700
function.svn-fs-change-node-prop.php               17-Jul-2024 20:07                3228
function.svn-fs-check-path.php                     17-Jul-2024 20:07                2802
function.svn-fs-contents-changed.php               17-Jul-2024 20:07                3233
function.svn-fs-copy.php                           17-Jul-2024 20:07                4160
function.svn-fs-delete.php                         17-Jul-2024 20:07                3445
function.svn-fs-dir-entries.php                    17-Jul-2024 20:07                2815
function.svn-fs-file-contents.php                  17-Jul-2024 20:07                2838
function.svn-fs-file-length.php                    17-Jul-2024 20:07                2761
function.svn-fs-is-dir.php                         17-Jul-2024 20:07                3492
function.svn-fs-is-file.php                        17-Jul-2024 20:07                3480
function.svn-fs-make-dir.php                       17-Jul-2024 20:07                3469
function.svn-fs-make-file.php                      17-Jul-2024 20:07                3486
function.svn-fs-node-created-rev.php               17-Jul-2024 20:07                2804
function.svn-fs-node-prop.php                      17-Jul-2024 20:07                2902
function.svn-fs-props-changed.php                  17-Jul-2024 20:07                3220
function.svn-fs-revision-prop.php                  17-Jul-2024 20:07                2915
function.svn-fs-revision-root.php                  17-Jul-2024 20:07                2783
function.svn-fs-txn-root.php                       17-Jul-2024 20:07                2548
function.svn-fs-youngest-rev.php                   17-Jul-2024 20:07                2590
function.svn-import.php                            17-Jul-2024 20:07                6025
function.svn-log.php                               17-Jul-2024 20:07                9075
function.svn-ls.php                                17-Jul-2024 20:07                7329
function.svn-mkdir.php                             17-Jul-2024 20:07                3268
function.svn-repos-create.php                      17-Jul-2024 20:07                2968
function.svn-repos-fs-begin-txn-for-commit.php     17-Jul-2024 20:07                3288
function.svn-repos-fs-commit-txn.php               17-Jul-2024 20:07                2645
function.svn-repos-fs.php                          17-Jul-2024 20:07                2545
function.svn-repos-hotcopy.php                     17-Jul-2024 20:07                2914
function.svn-repos-open.php                        17-Jul-2024 20:07                2517
function.svn-repos-recover.php                     17-Jul-2024 20:07                2561
function.svn-revert.php                            17-Jul-2024 20:07                3631
function.svn-status.php                            17-Jul-2024 20:07               14686
function.svn-update.php                            17-Jul-2024 20:07                6166
function.swoole-async-dns-lookup.php               17-Jul-2024 20:07                3878
function.swoole-async-read.php                     17-Jul-2024 20:07                4489
function.swoole-async-readfile.php                 17-Jul-2024 20:07                3903
function.swoole-async-set.php                      17-Jul-2024 20:07                2433
function.swoole-async-write.php                    17-Jul-2024 20:07                3783
function.swoole-async-writefile.php                17-Jul-2024 20:07                3811
function.swoole-clear-error.php                    17-Jul-2024 20:07                2283
function.swoole-client-select.php                  17-Jul-2024 20:07                3521
function.swoole-cpu-num.php                        17-Jul-2024 20:07                2140
function.swoole-errno.php                          17-Jul-2024 20:07                2117
function.swoole-error-log.php                      17-Jul-2024 20:07                3584
function.swoole-event-add.php                      17-Jul-2024 20:07                3528
function.swoole-event-defer.php                    17-Jul-2024 20:07                2666
function.swoole-event-del.php                      17-Jul-2024 20:07                2632
function.swoole-event-exit.php                     17-Jul-2024 20:07                2183
function.swoole-event-set.php                      17-Jul-2024 20:07                3516
function.swoole-event-wait.php                     17-Jul-2024 20:07                2154
function.swoole-event-write.php                    17-Jul-2024 20:07                2904
function.swoole-get-local-ip.php                   17-Jul-2024 20:07                2211
function.swoole-last-error.php                     17-Jul-2024 20:07                2166
function.swoole-load-module.php                    17-Jul-2024 20:07                2324
function.swoole-select.php                         17-Jul-2024 20:07                3488
function.swoole-set-process-name.php               17-Jul-2024 20:07                2661
function.swoole-strerror.php                       17-Jul-2024 20:07                2615
function.swoole-timer-after.php                    17-Jul-2024 20:07                3039
function.swoole-timer-exists.php                   17-Jul-2024 20:07                2452
function.swoole-timer-tick.php                     17-Jul-2024 20:07                2916
function.swoole-version.php                        17-Jul-2024 20:07                2145
function.symlink.php                               17-Jul-2024 20:07                5554
function.sys-get-temp-dir.php                      17-Jul-2024 20:07                4044
function.sys-getloadavg.php                        17-Jul-2024 20:07                4147
function.syslog.php                                17-Jul-2024 20:07                9340
function.system.php                                17-Jul-2024 20:07                7387
function.taint.php                                 17-Jul-2024 20:07                2696
function.tan.php                                   17-Jul-2024 20:07                4215
function.tanh.php                                  17-Jul-2024 20:07                3136
function.tcpwrap-check.php                         17-Jul-2024 20:07                5843
function.tempnam.php                               17-Jul-2024 20:07                6951
function.textdomain.php                            17-Jul-2024 20:07                3260
function.tidy-access-count.php                     17-Jul-2024 20:07                6425
function.tidy-config-count.php                     17-Jul-2024 20:07                4341
function.tidy-error-count.php                      17-Jul-2024 20:07                5343
function.tidy-get-output.php                       17-Jul-2024 20:07                4296
function.tidy-warning-count.php                    17-Jul-2024 20:07                4910
function.time-nanosleep.php                        17-Jul-2024 20:07                8454
function.time-sleep-until.php                      17-Jul-2024 20:07                5709
function.time.php                                  17-Jul-2024 20:07                4469
function.timezone-abbreviations-list.php           17-Jul-2024 20:07                1939
function.timezone-identifiers-list.php             17-Jul-2024 20:07                1955
function.timezone-location-get.php                 17-Jul-2024 20:07                1911
function.timezone-name-from-abbr.php               17-Jul-2024 20:07                6263
function.timezone-name-get.php                     17-Jul-2024 20:07                1855
function.timezone-offset-get.php                   17-Jul-2024 20:07                1853
function.timezone-open.php                         17-Jul-2024 20:07                1841
function.timezone-transitions-get.php              17-Jul-2024 20:07                1914
function.timezone-version-get.php                  17-Jul-2024 20:07                4198
function.tmpfile.php                               17-Jul-2024 20:07                5367
function.token-get-all.php                         17-Jul-2024 20:07               11917
function.token-name.php                            17-Jul-2024 20:07                4153
function.touch.php                                 17-Jul-2024 20:07                7933
function.trader-acos.php                           17-Jul-2024 20:07                2489
function.trader-ad.php                             17-Jul-2024 20:07                3386
function.trader-add.php                            17-Jul-2024 20:07                2820
function.trader-adosc.php                          17-Jul-2024 20:07                4246
function.trader-adx.php                            17-Jul-2024 20:07                3478
function.trader-adxr.php                           17-Jul-2024 20:07                3489
function.trader-apo.php                            17-Jul-2024 20:07                3692
function.trader-aroon.php                          17-Jul-2024 20:07                3052
function.trader-aroonosc.php                       17-Jul-2024 20:07                3089
function.trader-asin.php                           17-Jul-2024 20:07                2507
function.trader-atan.php                           17-Jul-2024 20:07                2500
function.trader-atr.php                            17-Jul-2024 20:07                3468
function.trader-avgprice.php                       17-Jul-2024 20:07                3443
function.trader-bbands.php                         17-Jul-2024 20:07                4451
function.trader-beta.php                           17-Jul-2024 20:07                3025
function.trader-bop.php                            17-Jul-2024 20:07                3392
function.trader-cci.php                            17-Jul-2024 20:07                3473
function.trader-cdl2crows.php                      17-Jul-2024 20:07                3465
function.trader-cdl3blackcrows.php                 17-Jul-2024 20:07                3527
function.trader-cdl3inside.php                     17-Jul-2024 20:07                3508
function.trader-cdl3linestrike.php                 17-Jul-2024 20:07                3531
function.trader-cdl3outside.php                    17-Jul-2024 20:07                3523
function.trader-cdl3starsinsouth.php               17-Jul-2024 20:07                3572
function.trader-cdl3whitesoldiers.php              17-Jul-2024 20:07                3596
function.trader-cdlabandonedbaby.php               17-Jul-2024 20:07                3975
function.trader-cdladvanceblock.php                17-Jul-2024 20:07                3549
function.trader-cdlbelthold.php                    17-Jul-2024 20:07                3505
function.trader-cdlbreakaway.php                   17-Jul-2024 20:07                3519
function.trader-cdlclosingmarubozu.php             17-Jul-2024 20:07                3590
function.trader-cdlconcealbabyswall.php            17-Jul-2024 20:07                3613
function.trader-cdlcounterattack.php               17-Jul-2024 20:07                3577
function.trader-cdldarkcloudcover.php              17-Jul-2024 20:07                3969
function.trader-cdldoji.php                        17-Jul-2024 20:07                3462
function.trader-cdldojistar.php                    17-Jul-2024 20:07                3497
function.trader-cdldragonflydoji.php               17-Jul-2024 20:07                3552
function.trader-cdlengulfing.php                   17-Jul-2024 20:07                3537
function.trader-cdleveningdojistar.php             17-Jul-2024 20:07                3986
function.trader-cdleveningstar.php                 17-Jul-2024 20:07                3963
function.trader-cdlgapsidesidewhite.php            17-Jul-2024 20:07                3620
function.trader-cdlgravestonedoji.php              17-Jul-2024 20:07                3573
function.trader-cdlhammer.php                      17-Jul-2024 20:07                3488
function.trader-cdlhangingman.php                  17-Jul-2024 20:07                3509
function.trader-cdlharami.php                      17-Jul-2024 20:07                3490
function.trader-cdlharamicross.php                 17-Jul-2024 20:07                3532
function.trader-cdlhighwave.php                    17-Jul-2024 20:07                3506
function.trader-cdlhikkake.php                     17-Jul-2024 20:07                3495
function.trader-cdlhikkakemod.php                  17-Jul-2024 20:07                3536
function.trader-cdlhomingpigeon.php                17-Jul-2024 20:07                3557
function.trader-cdlidentical3crows.php             17-Jul-2024 20:07                3581
function.trader-cdlinneck.php                      17-Jul-2024 20:07                3507
function.trader-cdlinvertedhammer.php              17-Jul-2024 20:07                3555
function.trader-cdlkicking.php                     17-Jul-2024 20:07                3509
function.trader-cdlkickingbylength.php             17-Jul-2024 20:07                3615
function.trader-cdlladderbottom.php                17-Jul-2024 20:07                3565
function.trader-cdllongleggeddoji.php              17-Jul-2024 20:07                3570
function.trader-cdllongline.php                    17-Jul-2024 20:07                3514
function.trader-cdlmarubozu.php                    17-Jul-2024 20:07                3500
function.trader-cdlmatchinglow.php                 17-Jul-2024 20:07                3526
function.trader-cdlmathold.php                     17-Jul-2024 20:07                3909
function.trader-cdlmorningdojistar.php             17-Jul-2024 20:07                3982
function.trader-cdlmorningstar.php                 17-Jul-2024 20:07                3943
function.trader-cdlonneck.php                      17-Jul-2024 20:07                3487
function.trader-cdlpiercing.php                    17-Jul-2024 20:07                3504
function.trader-cdlrickshawman.php                 17-Jul-2024 20:07                3544
function.trader-cdlrisefall3methods.php            17-Jul-2024 20:07                3614
function.trader-cdlseparatinglines.php             17-Jul-2024 20:07                3596
function.trader-cdlshootingstar.php                17-Jul-2024 20:07                3555
function.trader-cdlshortline.php                   17-Jul-2024 20:07                3527
function.trader-cdlspinningtop.php                 17-Jul-2024 20:07                3542
function.trader-cdlstalledpattern.php              17-Jul-2024 20:07                3577
function.trader-cdlsticksandwich.php               17-Jul-2024 20:07                3558
function.trader-cdltakuri.php                      17-Jul-2024 20:07                3529
function.trader-cdltasukigap.php                   17-Jul-2024 20:07                3504
function.trader-cdlthrusting.php                   17-Jul-2024 20:07                3513
function.trader-cdltristar.php                     17-Jul-2024 20:07                3501
function.trader-cdlunique3river.php                17-Jul-2024 20:07                3552
function.trader-cdlupsidegap2crows.php             17-Jul-2024 20:07                3600
function.trader-cdlxsidegap3methods.php            17-Jul-2024 20:07                3599
function.trader-ceil.php                           17-Jul-2024 20:07                2524
function.trader-cmo.php                            17-Jul-2024 20:07                2741
function.trader-correl.php                         17-Jul-2024 20:07                3077
function.trader-cos.php                            17-Jul-2024 20:07                2490
function.trader-cosh.php                           17-Jul-2024 20:07                2506
function.trader-dema.php                           17-Jul-2024 20:07                2752
function.trader-div.php                            17-Jul-2024 20:07                2836
function.trader-dx.php                             17-Jul-2024 20:07                3454
function.trader-ema.php                            17-Jul-2024 20:07                2735
function.trader-errno.php                          17-Jul-2024 20:07                2210
function.trader-exp.php                            17-Jul-2024 20:07                2534
function.trader-floor.php                          17-Jul-2024 20:07                2516
function.trader-get-compat.php                     17-Jul-2024 20:07                2400
function.trader-get-unstable-period.php            17-Jul-2024 20:07                2741
function.trader-ht-dcperiod.php                    17-Jul-2024 20:07                2504
function.trader-ht-dcphase.php                     17-Jul-2024 20:07                2475
function.trader-ht-phasor.php                      17-Jul-2024 20:07                2456
function.trader-ht-sine.php                        17-Jul-2024 20:07                2435
function.trader-ht-trendline.php                   17-Jul-2024 20:07                2496
function.trader-ht-trendmode.php                   17-Jul-2024 20:07                2486
function.trader-kama.php                           17-Jul-2024 20:07                2790
function.trader-linearreg-angle.php                17-Jul-2024 20:07                2884
function.trader-linearreg-intercept.php            17-Jul-2024 20:07                2942
function.trader-linearreg-slope.php                17-Jul-2024 20:07                2894
function.trader-linearreg.php                      17-Jul-2024 20:07                2806
function.trader-ln.php                             17-Jul-2024 20:07                2492
function.trader-log10.php                          17-Jul-2024 20:07                2496
function.trader-ma.php                             17-Jul-2024 20:07                3156
function.trader-macd.php                           17-Jul-2024 20:07                3677
function.trader-macdext.php                        17-Jul-2024 20:07                5170
function.trader-macdfix.php                        17-Jul-2024 20:07                2836
function.trader-mama.php                           17-Jul-2024 20:07                3177
function.trader-mavp.php                           17-Jul-2024 20:07                4081
function.trader-max.php                            17-Jul-2024 20:07                2756
function.trader-maxindex.php                       17-Jul-2024 20:07                2813
function.trader-medprice.php                       17-Jul-2024 20:07                2719
function.trader-mfi.php                            17-Jul-2024 20:07                3811
function.trader-midpoint.php                       17-Jul-2024 20:07                2787
function.trader-midprice.php                       17-Jul-2024 20:07                3103
function.trader-min.php                            17-Jul-2024 20:07                2763
function.trader-minindex.php                       17-Jul-2024 20:07                2808
function.trader-minmax.php                         17-Jul-2024 20:07                2812
function.trader-minmaxindex.php                    17-Jul-2024 20:07                2863
function.trader-minus-di.php                       17-Jul-2024 20:07                3541
function.trader-minus-dm.php                       17-Jul-2024 20:07                3103
function.trader-mom.php                            17-Jul-2024 20:07                2727
function.trader-mult.php                           17-Jul-2024 20:07                2836
function.trader-natr.php                           17-Jul-2024 20:07                3479
function.trader-obv.php                            17-Jul-2024 20:07                2674
function.trader-plus-di.php                        17-Jul-2024 20:07                3512
function.trader-plus-dm.php                        17-Jul-2024 20:07                3090
function.trader-ppo.php                            17-Jul-2024 20:07                3696
function.trader-roc.php                            17-Jul-2024 20:07                2751
function.trader-rocp.php                           17-Jul-2024 20:07                2779
function.trader-rocr.php                           17-Jul-2024 20:07                2764
function.trader-rocr100.php                        17-Jul-2024 20:07                2804
function.trader-rsi.php                            17-Jul-2024 20:07                2732
function.trader-sar.php                            17-Jul-2024 20:07                3734
function.trader-sarext.php                         17-Jul-2024 20:07                7146
function.trader-set-compat.php                     17-Jul-2024 20:07                2642
function.trader-set-unstable-period.php            17-Jul-2024 20:07                3230
function.trader-sin.php                            17-Jul-2024 20:07                2514
function.trader-sinh.php                           17-Jul-2024 20:07                2502
function.trader-sma.php                            17-Jul-2024 20:07                2732
function.trader-sqrt.php                           17-Jul-2024 20:07                2495
function.trader-stddev.php                         17-Jul-2024 20:07                3076
function.trader-stoch.php                          17-Jul-2024 20:07                5346
function.trader-stochf.php                         17-Jul-2024 20:07                4453
function.trader-stochrsi.php                       17-Jul-2024 20:07                4209
function.trader-sub.php                            17-Jul-2024 20:07                2841
function.trader-sum.php                            17-Jul-2024 20:07                2714
function.trader-t3.php                             17-Jul-2024 20:07                3095
function.trader-tan.php                            17-Jul-2024 20:07                2483
function.trader-tanh.php                           17-Jul-2024 20:07                2507
function.trader-tema.php                           17-Jul-2024 20:07                2758
function.trader-trange.php                         17-Jul-2024 20:07                3001
function.trader-trima.php                          17-Jul-2024 20:07                2760
function.trader-trix.php                           17-Jul-2024 20:07                2770
function.trader-tsf.php                            17-Jul-2024 20:07                2739
function.trader-typprice.php                       17-Jul-2024 20:07                3024
function.trader-ultosc.php                         17-Jul-2024 20:07                4336
function.trader-var.php                            17-Jul-2024 20:07                3046
function.trader-wclprice.php                       17-Jul-2024 20:07                3029
function.trader-willr.php                          17-Jul-2024 20:07                3485
function.trader-wma.php                            17-Jul-2024 20:07                2756
function.trait-exists.php                          17-Jul-2024 20:07                3108
function.trigger-error.php                         17-Jul-2024 20:07                7680
function.trim.php                                  17-Jul-2024 20:07               12632
function.uasort.php                                17-Jul-2024 20:07               10138
function.ucfirst.php                               17-Jul-2024 20:07                6176
function.ucwords.php                               17-Jul-2024 20:07                9644
function.ui-draw-text-font-fontfamilies.php        17-Jul-2024 20:07                2410
function.ui-quit.php                               17-Jul-2024 20:07                2050
function.ui-run.php                                17-Jul-2024 20:07                2441
function.uksort.php                                17-Jul-2024 20:07                9635
function.umask.php                                 17-Jul-2024 20:07                5632
function.uniqid.php                                17-Jul-2024 20:07                7913
function.unixtojd.php                              17-Jul-2024 20:07                3927
function.unlink.php                                17-Jul-2024 20:07                6084
function.unpack.php                                17-Jul-2024 20:07               10522
function.unregister-tick-function.php              17-Jul-2024 20:07                3126
function.unserialize.php                           17-Jul-2024 20:07               16815
function.unset.php                                 17-Jul-2024 20:07               14772
function.untaint.php                               17-Jul-2024 20:07                2552
function.uopz-add-function.php                     17-Jul-2024 20:07                7158
function.uopz-allow-exit.php                       17-Jul-2024 20:07                4635
function.uopz-backup.php                           17-Jul-2024 20:07                4583
function.uopz-compose.php                          17-Jul-2024 20:07                6855
function.uopz-copy.php                             17-Jul-2024 20:07                5170
function.uopz-del-function.php                     17-Jul-2024 20:07                6598
function.uopz-delete.php                           17-Jul-2024 20:07                5963
function.uopz-extend.php                           17-Jul-2024 20:07                5036
function.uopz-flags.php                            17-Jul-2024 20:07               10943
function.uopz-function.php                         17-Jul-2024 20:07                7313
function.uopz-get-exit-status.php                  17-Jul-2024 20:07                4189
function.uopz-get-hook.php                         17-Jul-2024 20:07                5345
function.uopz-get-mock.php                         17-Jul-2024 20:07                4956
function.uopz-get-property.php                     17-Jul-2024 20:07                6212
function.uopz-get-return.php                       17-Jul-2024 20:07                4449
function.uopz-get-static.php                       17-Jul-2024 20:07                5174
function.uopz-implement.php                        17-Jul-2024 20:07                5061
function.uopz-overload.php                         17-Jul-2024 20:07                3936
function.uopz-redefine.php                         17-Jul-2024 20:07                5147
function.uopz-rename.php                           17-Jul-2024 20:07                6768
function.uopz-restore.php                          17-Jul-2024 20:07                4941
function.uopz-set-hook.php                         17-Jul-2024 20:07                5679
function.uopz-set-mock.php                         17-Jul-2024 20:07               10791
function.uopz-set-property.php                     17-Jul-2024 20:07                7516
function.uopz-set-return.php                       17-Jul-2024 20:07                9625
function.uopz-set-static.php                       17-Jul-2024 20:07                5767
function.uopz-undefine.php                         17-Jul-2024 20:07                4705
function.uopz-unset-hook.php                       17-Jul-2024 20:07                5572
function.uopz-unset-mock.php                       17-Jul-2024 20:07                5307
function.uopz-unset-return.php                     17-Jul-2024 20:07                4925
function.urldecode.php                             17-Jul-2024 20:07                6322
function.urlencode.php                             17-Jul-2024 20:07                9453
function.use-soap-error-handler.php                17-Jul-2024 20:07                3923
function.user-error.php                            17-Jul-2024 20:07                1731
function.usleep.php                                17-Jul-2024 20:07                6759
function.usort.php                                 17-Jul-2024 20:07               24775
function.utf8-decode.php                           17-Jul-2024 20:07               18427
function.utf8-encode.php                           17-Jul-2024 20:07               15068
function.var-dump.php                              17-Jul-2024 20:07                6724
function.var-export.php                            17-Jul-2024 20:07               16092
function.var-representation.php                    17-Jul-2024 20:07               13323
function.variant-abs.php                           17-Jul-2024 20:07                4016
function.variant-add.php                           17-Jul-2024 20:07                5349
function.variant-and.php                           17-Jul-2024 20:07                7441
function.variant-cast.php                          17-Jul-2024 20:07                3542
function.variant-cat.php                           17-Jul-2024 20:07                4558
function.variant-cmp.php                           17-Jul-2024 20:07                7860
function.variant-date-from-timestamp.php           17-Jul-2024 20:07                3665
function.variant-date-to-timestamp.php             17-Jul-2024 20:07                3775
function.variant-div.php                           17-Jul-2024 20:07                6260
function.variant-eqv.php                           17-Jul-2024 20:07                4294
function.variant-fix.php                           17-Jul-2024 20:07                5341
function.variant-get-type.php                      17-Jul-2024 20:07                3532
function.variant-idiv.php                          17-Jul-2024 20:07                5626
function.variant-imp.php                           17-Jul-2024 20:07                6995
function.variant-int.php                           17-Jul-2024 20:07                4839
function.variant-mod.php                           17-Jul-2024 20:07                4629
function.variant-mul.php                           17-Jul-2024 20:07                5741
function.variant-neg.php                           17-Jul-2024 20:07                3696
function.variant-not.php                           17-Jul-2024 20:07                3962
function.variant-or.php                            17-Jul-2024 20:07                7597
function.variant-pow.php                           17-Jul-2024 20:07                4467
function.variant-round.php                         17-Jul-2024 20:07                4372
function.variant-set-type.php                      17-Jul-2024 20:07                3668
function.variant-set.php                           17-Jul-2024 20:07                2904
function.variant-sub.php                           17-Jul-2024 20:07                5311
function.variant-xor.php                           17-Jul-2024 20:07                6336
function.version-compare.php                       17-Jul-2024 20:07               11253
function.vfprintf.php                              17-Jul-2024 20:07               19339
function.virtual.php                               17-Jul-2024 20:07                5099
function.vprintf.php                               17-Jul-2024 20:07               18744
function.vsprintf.php                              17-Jul-2024 20:07               18624
function.wddx-add-vars.php                         17-Jul-2024 20:07                3785
function.wddx-deserialize.php                      17-Jul-2024 20:07                3542
function.wddx-packet-end.php                       17-Jul-2024 20:07                2857
function.wddx-packet-start.php                     17-Jul-2024 20:07                3036
function.wddx-serialize-value.php                  17-Jul-2024 20:07                3266
function.wddx-serialize-vars.php                   17-Jul-2024 20:07                5995
function.win32-continue-service.php                17-Jul-2024 20:07                6700
function.win32-create-service.php                  17-Jul-2024 20:07               28823
function.win32-delete-service.php                  17-Jul-2024 20:07                7171
function.win32-get-last-control-message.php        17-Jul-2024 20:07                8541
function.win32-pause-service.php                   17-Jul-2024 20:07                6701
function.win32-query-service-status.php            17-Jul-2024 20:07                8793
function.win32-send-custom-control.php             17-Jul-2024 20:07                7365
function.win32-set-service-exit-code.php           17-Jul-2024 20:07                5877
function.win32-set-service-exit-mode.php           17-Jul-2024 20:07                6025
function.win32-set-service-status.php              17-Jul-2024 20:07                9302
function.win32-start-service-ctrl-dispatcher.php   17-Jul-2024 20:07               11345
function.win32-start-service.php                   17-Jul-2024 20:07                6705
function.win32-stop-service.php                    17-Jul-2024 20:07                6620
function.wincache-fcache-fileinfo.php              17-Jul-2024 20:07                9278
function.wincache-fcache-meminfo.php               17-Jul-2024 20:07                7093
function.wincache-lock.php                         17-Jul-2024 20:07                8546
function.wincache-ocache-fileinfo.php              17-Jul-2024 20:07                9942
function.wincache-ocache-meminfo.php               17-Jul-2024 20:07                7279
function.wincache-refresh-if-changed.php           17-Jul-2024 20:07                7849
function.wincache-rplist-fileinfo.php              17-Jul-2024 20:07                7648
function.wincache-rplist-meminfo.php               17-Jul-2024 20:07                7208
function.wincache-scache-info.php                  17-Jul-2024 20:07                9566
function.wincache-scache-meminfo.php               17-Jul-2024 20:07                6695
function.wincache-ucache-add.php                   17-Jul-2024 20:07               13578
function.wincache-ucache-cas.php                   17-Jul-2024 20:07                6501
function.wincache-ucache-clear.php                 17-Jul-2024 20:07                7587
function.wincache-ucache-dec.php                   17-Jul-2024 20:07                6440
function.wincache-ucache-delete.php                17-Jul-2024 20:07               11392
function.wincache-ucache-exists.php                17-Jul-2024 20:07                6194
function.wincache-ucache-get.php                   17-Jul-2024 20:07               10581
function.wincache-ucache-inc.php                   17-Jul-2024 20:07                6432
function.wincache-ucache-info.php                  17-Jul-2024 20:07               11387
function.wincache-ucache-meminfo.php               17-Jul-2024 20:07                6884
function.wincache-ucache-set.php                   17-Jul-2024 20:07               13644
function.wincache-unlock.php                       17-Jul-2024 20:07                7808
function.wordwrap.php                              17-Jul-2024 20:07                9134
function.xattr-get.php                             17-Jul-2024 20:07                6046
function.xattr-list.php                            17-Jul-2024 20:07                6500
function.xattr-remove.php                          17-Jul-2024 20:07                6295
function.xattr-set.php                             17-Jul-2024 20:07                8040
function.xattr-supported.php                       17-Jul-2024 20:07                5361
function.xdiff-file-bdiff-size.php                 17-Jul-2024 20:07                4869
function.xdiff-file-bdiff.php                      17-Jul-2024 20:07                5985
function.xdiff-file-bpatch.php                     17-Jul-2024 20:07                6542
function.xdiff-file-diff-binary.php                17-Jul-2024 20:07                6405
function.xdiff-file-diff.php                       17-Jul-2024 20:07                7422
function.xdiff-file-merge3.php                     17-Jul-2024 20:07                6834
function.xdiff-file-patch-binary.php               17-Jul-2024 20:07                6691
function.xdiff-file-patch.php                      17-Jul-2024 20:07                8953
function.xdiff-file-rabdiff.php                    17-Jul-2024 20:07                6541
function.xdiff-string-bdiff-size.php               17-Jul-2024 20:07                5187
function.xdiff-string-bdiff.php                    17-Jul-2024 20:07                3879
function.xdiff-string-bpatch.php                   17-Jul-2024 20:07                3977
function.xdiff-string-diff-binary.php              17-Jul-2024 20:07                4367
function.xdiff-string-diff.php                     17-Jul-2024 20:07                7661
function.xdiff-string-merge3.php                   17-Jul-2024 20:07                4826
function.xdiff-string-patch-binary.php             17-Jul-2024 20:07                4509
function.xdiff-string-patch.php                    17-Jul-2024 20:07                8308
function.xdiff-string-rabdiff.php                  17-Jul-2024 20:07                4466
function.xhprof-disable.php                        17-Jul-2024 20:07                3985
function.xhprof-enable.php                         17-Jul-2024 20:07                7076
function.xhprof-sample-disable.php                 17-Jul-2024 20:07                4664
function.xhprof-sample-enable.php                  17-Jul-2024 20:07                3434
function.xml-error-string.php                      17-Jul-2024 20:07                3441
function.xml-get-current-byte-index.php            17-Jul-2024 20:07                4410
function.xml-get-current-column-number.php         17-Jul-2024 20:07                4206
function.xml-get-current-line-number.php           17-Jul-2024 20:07                4030
function.xml-get-error-code.php                    17-Jul-2024 20:07                3730
function.xml-parse-into-struct.php                 17-Jul-2024 20:07               19094
function.xml-parse.php                             17-Jul-2024 20:07                8192
function.xml-parser-create-ns.php                  17-Jul-2024 20:07                5328
function.xml-parser-create.php                     17-Jul-2024 20:07                4853
function.xml-parser-free.php                       17-Jul-2024 20:07                3998
function.xml-parser-get-option.php                 17-Jul-2024 20:07                5869
function.xml-parser-set-option.php                 17-Jul-2024 20:07                7683
function.xml-set-character-data-handler.php        17-Jul-2024 20:07                5642
function.xml-set-default-handler.php               17-Jul-2024 20:07                5542
function.xml-set-element-handler.php               17-Jul-2024 20:07                8707
function.xml-set-end-namespace-decl-handler.php    17-Jul-2024 20:07                6439
function.xml-set-external-entity-ref-handler.php   17-Jul-2024 20:07                8322
function.xml-set-notation-decl-handler.php         17-Jul-2024 20:07                7637
function.xml-set-object.php                        17-Jul-2024 20:07                9191
function.xml-set-processing-instruction-handler..> 17-Jul-2024 20:07                6586
function.xml-set-start-namespace-decl-handler.php  17-Jul-2024 20:07                6810
function.xml-set-unparsed-entity-decl-handler.php  17-Jul-2024 20:07                8499
function.xmlrpc-decode-request.php                 17-Jul-2024 20:07                2747
function.xmlrpc-decode.php                         17-Jul-2024 20:07                3997
function.xmlrpc-encode-request.php                 17-Jul-2024 20:07                8431
function.xmlrpc-encode.php                         17-Jul-2024 20:07                2321
function.xmlrpc-get-type.php                       17-Jul-2024 20:07                6267
function.xmlrpc-is-fault.php                       17-Jul-2024 20:07                3865
function.xmlrpc-parse-method-descriptions.php      17-Jul-2024 20:07                2515
function.xmlrpc-server-add-introspection-data.php  17-Jul-2024 20:07                2716
function.xmlrpc-server-call-method.php             17-Jul-2024 20:07                3128
function.xmlrpc-server-create.php                  17-Jul-2024 20:07                2245
function.xmlrpc-server-destroy.php                 17-Jul-2024 20:07                2450
function.xmlrpc-server-register-introspection-c..> 17-Jul-2024 20:07                2791
function.xmlrpc-server-register-method.php         17-Jul-2024 20:07                2875
function.xmlrpc-set-type.php                       17-Jul-2024 20:07                5436
function.yaml-emit-file.php                        17-Jul-2024 20:07                6741
function.yaml-emit.php                             17-Jul-2024 20:07               12323
function.yaml-parse-file.php                       17-Jul-2024 20:07                6082
function.yaml-parse-url.php                        17-Jul-2024 20:07                6407
function.yaml-parse.php                            17-Jul-2024 20:07                9928
function.yaz-addinfo.php                           17-Jul-2024 20:07                3408
function.yaz-ccl-conf.php                          17-Jul-2024 20:07                5708
function.yaz-ccl-parse.php                         17-Jul-2024 20:07                6778
function.yaz-close.php                             17-Jul-2024 20:07                3568
function.yaz-connect.php                           17-Jul-2024 20:07                9124
function.yaz-database.php                          17-Jul-2024 20:07                3456
function.yaz-element.php                           17-Jul-2024 20:07                3890
function.yaz-errno.php                             17-Jul-2024 20:07                3646
function.yaz-error.php                             17-Jul-2024 20:07                3401
function.yaz-es-result.php                         17-Jul-2024 20:07                3319
function.yaz-es.php                                17-Jul-2024 20:07                7168
function.yaz-get-option.php                        17-Jul-2024 20:07                3396
function.yaz-hits.php                              17-Jul-2024 20:07                4890
function.yaz-itemorder.php                         17-Jul-2024 20:07                7069
function.yaz-present.php                           17-Jul-2024 20:07                3032
function.yaz-range.php                             17-Jul-2024 20:07                3630
function.yaz-record.php                            17-Jul-2024 20:07               14262
function.yaz-scan-result.php                       17-Jul-2024 20:07                4037
function.yaz-scan.php                              17-Jul-2024 20:07                9374
function.yaz-schema.php                            17-Jul-2024 20:07                3466
function.yaz-search.php                            17-Jul-2024 20:07                8727
function.yaz-set-option.php                        17-Jul-2024 20:07                7029
function.yaz-sort.php                              17-Jul-2024 20:07                5598
function.yaz-syntax.php                            17-Jul-2024 20:07                3424
function.yaz-wait.php                              17-Jul-2024 20:07                4167
function.zend-thread-id.php                        17-Jul-2024 20:07                3706
function.zend-version.php                          17-Jul-2024 20:07                3828
function.zip-close.php                             17-Jul-2024 20:07                3876
function.zip-entry-close.php                       17-Jul-2024 20:07                4102
function.zip-entry-compressedsize.php              17-Jul-2024 20:07                4384
function.zip-entry-compressionmethod.php           17-Jul-2024 20:07                4471
function.zip-entry-filesize.php                    17-Jul-2024 20:07                4313
function.zip-entry-name.php                        17-Jul-2024 20:07                4232
function.zip-entry-open.php                        17-Jul-2024 20:07                5733
function.zip-entry-read.php                        17-Jul-2024 20:07                5060
function.zip-open.php                              17-Jul-2024 20:07                4448
function.zip-read.php                              17-Jul-2024 20:07                4661
function.zlib-decode.php                           17-Jul-2024 20:07                3426
function.zlib-encode.php                           17-Jul-2024 20:07                5350
function.zlib-get-coding-type.php                  17-Jul-2024 20:07                2894
function.zookeeper-dispatch.php                    17-Jul-2024 20:07                8370
functional.parallel.php                            17-Jul-2024 20:07                2600
functions.anonymous.php                            17-Jul-2024 20:07               23313
functions.arguments.php                            17-Jul-2024 20:07               40931
functions.arrow.php                                17-Jul-2024 20:07                9684
functions.first_class_callable_syntax.php          17-Jul-2024 20:07               10947
functions.internal.php                             17-Jul-2024 20:07                7257
functions.returning-values.php                     17-Jul-2024 20:07                5955
functions.user-defined.php                         17-Jul-2024 20:07                8794
functions.variable-functions.php                   17-Jul-2024 20:07               11113
gearman.constants.php                              17-Jul-2024 20:07               23794
gearman.examples-reverse-bg.php                    17-Jul-2024 20:07               10709
gearman.examples-reverse-task.php                  17-Jul-2024 20:07               17358
gearman.examples-reverse.php                       17-Jul-2024 20:07               12782
gearman.examples.php                               17-Jul-2024 20:07                1609
gearman.installation.php                           17-Jul-2024 20:07                1525
gearman.requirements.php                           17-Jul-2024 20:07                1495
gearman.resources.php                              17-Jul-2024 20:07                1213
gearman.setup.php                                  17-Jul-2024 20:07                1502
gearmanclient.addoptions.php                       17-Jul-2024 20:07                3356
gearmanclient.addserver.php                        17-Jul-2024 20:07                5488
gearmanclient.addservers.php                       17-Jul-2024 20:07                4931
gearmanclient.addtask.php                          17-Jul-2024 20:07               15103
gearmanclient.addtaskbackground.php                17-Jul-2024 20:07               20892
gearmanclient.addtaskhigh.php                      17-Jul-2024 20:07               11619
gearmanclient.addtaskhighbackground.php            17-Jul-2024 20:07                6543
gearmanclient.addtasklow.php                       17-Jul-2024 20:07               11601
gearmanclient.addtasklowbackground.php             17-Jul-2024 20:07                6536
gearmanclient.addtaskstatus.php                    17-Jul-2024 20:07                9816
gearmanclient.clearcallbacks.php                   17-Jul-2024 20:07                4352
gearmanclient.clone.php                            17-Jul-2024 20:07                2655
gearmanclient.construct.php                        17-Jul-2024 20:07                2826
gearmanclient.context.php                          17-Jul-2024 20:07                2894
gearmanclient.data.php                             17-Jul-2024 20:07                3161
gearmanclient.do.php                               17-Jul-2024 20:07               22131
gearmanclient.dobackground.php                     17-Jul-2024 20:07                9629
gearmanclient.dohigh.php                           17-Jul-2024 20:07                5096
gearmanclient.dohighbackground.php                 17-Jul-2024 20:07                4923
gearmanclient.dojobhandle.php                      17-Jul-2024 20:07                2951
gearmanclient.dolow.php                            17-Jul-2024 20:07                5082
gearmanclient.dolowbackground.php                  17-Jul-2024 20:07                4905
gearmanclient.donormal.php                         17-Jul-2024 20:07               22699
gearmanclient.dostatus.php                         17-Jul-2024 20:07                8119
gearmanclient.echo.php                             17-Jul-2024 20:07                3003
gearmanclient.error.php                            17-Jul-2024 20:07                2886
gearmanclient.geterrno.php                         17-Jul-2024 20:07                2661
gearmanclient.jobstatus.php                        17-Jul-2024 20:07                8312
gearmanclient.ping.php                             17-Jul-2024 20:07                2976
gearmanclient.removeoptions.php                    17-Jul-2024 20:07                2704
gearmanclient.returncode.php                       17-Jul-2024 20:07                2311
gearmanclient.runtasks.php                         17-Jul-2024 20:07                3712
gearmanclient.setclientcallback.php                17-Jul-2024 20:07                5374
gearmanclient.setcompletecallback.php              17-Jul-2024 20:07                5258
gearmanclient.setcontext.php                       17-Jul-2024 20:07                3242
gearmanclient.setcreatedcallback.php               17-Jul-2024 20:07                4797
gearmanclient.setdata.php                          17-Jul-2024 20:07                3442
gearmanclient.setdatacallback.php                  17-Jul-2024 20:07                4782
gearmanclient.setexceptioncallback.php             17-Jul-2024 20:07                4702
gearmanclient.setfailcallback.php                  17-Jul-2024 20:07                4788
gearmanclient.setoptions.php                       17-Jul-2024 20:07                2690
gearmanclient.setstatuscallback.php                17-Jul-2024 20:07                4788
gearmanclient.settimeout.php                       17-Jul-2024 20:07                2734
gearmanclient.setwarningcallback.php               17-Jul-2024 20:07                4791
gearmanclient.setworkloadcallback.php              17-Jul-2024 20:07                4945
gearmanclient.timeout.php                          17-Jul-2024 20:07                2756
gearmanclient.wait.php                             17-Jul-2024 20:07                2803
gearmanjob.complete.php                            17-Jul-2024 20:07                3597
gearmanjob.construct.php                           17-Jul-2024 20:07                2345
gearmanjob.data.php                                17-Jul-2024 20:07                3557
gearmanjob.exception.php                           17-Jul-2024 20:07                3764
gearmanjob.fail.php                                17-Jul-2024 20:07                3675
gearmanjob.functionname.php                        17-Jul-2024 20:07                2932
gearmanjob.handle.php                              17-Jul-2024 20:07                2819
gearmanjob.returncode.php                          17-Jul-2024 20:07                2616
gearmanjob.sendcomplete.php                        17-Jul-2024 20:07                3316
gearmanjob.senddata.php                            17-Jul-2024 20:07                3283
gearmanjob.sendexception.php                       17-Jul-2024 20:07                3496
gearmanjob.sendfail.php                            17-Jul-2024 20:07                3392
gearmanjob.sendstatus.php                          17-Jul-2024 20:07                4011
gearmanjob.sendwarning.php                         17-Jul-2024 20:07                3492
gearmanjob.setreturn.php                           17-Jul-2024 20:07                2576
gearmanjob.status.php                              17-Jul-2024 20:07                4294
gearmanjob.unique.php                              17-Jul-2024 20:07                3056
gearmanjob.warning.php                             17-Jul-2024 20:07                3775
gearmanjob.workload.php                            17-Jul-2024 20:07                2814
gearmanjob.workloadsize.php                        17-Jul-2024 20:07                2632
gearmantask.construct.php                          17-Jul-2024 20:07                2370
gearmantask.create.php                             17-Jul-2024 20:07                2807
gearmantask.data.php                               17-Jul-2024 20:07                2793
gearmantask.datasize.php                           17-Jul-2024 20:07                2816
gearmantask.function.php                           17-Jul-2024 20:07                2657
gearmantask.functionname.php                       17-Jul-2024 20:07                2592
gearmantask.isknown.php                            17-Jul-2024 20:07                2468
gearmantask.isrunning.php                          17-Jul-2024 20:07                2468
gearmantask.jobhandle.php                          17-Jul-2024 20:07                2965
gearmantask.recvdata.php                           17-Jul-2024 20:07                3473
gearmantask.returncode.php                         17-Jul-2024 20:07                2643
gearmantask.senddata.php                           17-Jul-2024 20:07                3286
gearmantask.sendworkload.php                       17-Jul-2024 20:07                3435
gearmantask.taskdenominator.php                    17-Jul-2024 20:07                3009
gearmantask.tasknumerator.php                      17-Jul-2024 20:07                2981
gearmantask.unique.php                             17-Jul-2024 20:07                3226
gearmantask.uuid.php                               17-Jul-2024 20:07                3401
gearmanworker.addfunction.php                      17-Jul-2024 20:07                7917
gearmanworker.addoptions.php                       17-Jul-2024 20:07                3400
gearmanworker.addserver.php                        17-Jul-2024 20:07                5215
gearmanworker.addservers.php                       17-Jul-2024 20:07                4653
gearmanworker.clone.php                            17-Jul-2024 20:07                2326
gearmanworker.construct.php                        17-Jul-2024 20:07                2799
gearmanworker.echo.php                             17-Jul-2024 20:07                3036
gearmanworker.error.php                            17-Jul-2024 20:07                2853
gearmanworker.geterrno.php                         17-Jul-2024 20:07                2628
gearmanworker.options.php                          17-Jul-2024 20:07                2635
gearmanworker.register.php                         17-Jul-2024 20:07                3793
gearmanworker.removeoptions.php                    17-Jul-2024 20:07                3422
gearmanworker.returncode.php                       17-Jul-2024 20:07                2823
gearmanworker.setid.php                            17-Jul-2024 20:07                4093
gearmanworker.setoptions.php                       17-Jul-2024 20:07                3555
gearmanworker.settimeout.php                       17-Jul-2024 20:07                7811
gearmanworker.timeout.php                          17-Jul-2024 20:07                2735
gearmanworker.unregister.php                       17-Jul-2024 20:07                3357
gearmanworker.unregisterall.php                    17-Jul-2024 20:07                2999
gearmanworker.wait.php                             17-Jul-2024 20:07                7880
gearmanworker.work.php                             17-Jul-2024 20:07                5582
gender-gender.connect.php                          17-Jul-2024 20:07                2574
gender-gender.construct.php                        17-Jul-2024 20:07                2433
gender-gender.country.php                          17-Jul-2024 20:07                3826
gender-gender.get.php                              17-Jul-2024 20:07                2890
gender-gender.isnick.php                           17-Jul-2024 20:07                3494
gender-gender.similarnames.php                     17-Jul-2024 20:07                3003
gender.example.admin.php                           17-Jul-2024 20:07                8108
gender.examples.php                                17-Jul-2024 20:07                1385
gender.installation.php                            17-Jul-2024 20:07                1908
gender.setup.php                                   17-Jul-2024 20:07                1370
generator.current.php                              17-Jul-2024 20:07                2115
generator.getreturn.php                            17-Jul-2024 20:07                3802
generator.key.php                                  17-Jul-2024 20:07                3886
generator.next.php                                 17-Jul-2024 20:07                2425
generator.rewind.php                               17-Jul-2024 20:07                2179
generator.send.php                                 17-Jul-2024 20:07                5437
generator.throw.php                                17-Jul-2024 20:07                4980
generator.valid.php                                17-Jul-2024 20:07                2303
generator.wakeup.php                               17-Jul-2024 20:07                2176
geoip.configuration.php                            17-Jul-2024 20:07                2409
geoip.constants.php                                17-Jul-2024 20:07                6237
geoip.installation.php                             17-Jul-2024 20:07                1651
geoip.requirements.php                             17-Jul-2024 20:07                1658
geoip.resources.php                                17-Jul-2024 20:07                1179
geoip.setup.php                                    17-Jul-2024 20:07                1539
gettext.installation.php                           17-Jul-2024 20:07                1371
gettext.requirements.php                           17-Jul-2024 20:07                1356
gettext.resources.php                              17-Jul-2024 20:07                1176
gettext.setup.php                                  17-Jul-2024 20:07                1511
getting-started.php                                17-Jul-2024 20:07                1930
globiterator.construct.php                         17-Jul-2024 20:07                7684
globiterator.count.php                             17-Jul-2024 20:07                4418
gmagick.addimage.php                               17-Jul-2024 20:07                2865
gmagick.addnoiseimage.php                          17-Jul-2024 20:07                2920
gmagick.annotateimage.php                          17-Jul-2024 20:07                4455
gmagick.blurimage.php                              17-Jul-2024 20:07                3316
gmagick.borderimage.php                            17-Jul-2024 20:07                3765
gmagick.charcoalimage.php                          17-Jul-2024 20:07                3266
gmagick.chopimage.php                              17-Jul-2024 20:07                3918
gmagick.clear.php                                  17-Jul-2024 20:07                2599
gmagick.commentimage.php                           17-Jul-2024 20:07                2867
gmagick.compositeimage.php                         17-Jul-2024 20:07                4081
gmagick.constants.php                              17-Jul-2024 20:07              103090
gmagick.construct.php                              17-Jul-2024 20:07                2629
gmagick.cropimage.php                              17-Jul-2024 20:07                4053
gmagick.cropthumbnailimage.php                     17-Jul-2024 20:07                3303
gmagick.current.php                                17-Jul-2024 20:07                2500
gmagick.cyclecolormapimage.php                     17-Jul-2024 20:07                2993
gmagick.deconstructimages.php                      17-Jul-2024 20:07                2748
gmagick.despeckleimage.php                         17-Jul-2024 20:07                3431
gmagick.destroy.php                                17-Jul-2024 20:07                2731
gmagick.drawimage.php                              17-Jul-2024 20:07                2989
gmagick.edgeimage.php                              17-Jul-2024 20:07                2936
gmagick.embossimage.php                            17-Jul-2024 20:07                3444
gmagick.enhanceimage.php                           17-Jul-2024 20:07                2610
gmagick.equalizeimage.php                          17-Jul-2024 20:07                2569
gmagick.examples.php                               17-Jul-2024 20:07                3441
gmagick.flipimage.php                              17-Jul-2024 20:07                2901
gmagick.flopimage.php                              17-Jul-2024 20:07                2898
gmagick.frameimage.php                             17-Jul-2024 20:07                4590
gmagick.gammaimage.php                             17-Jul-2024 20:07                3147
gmagick.getcopyright.php                           17-Jul-2024 20:07                2591
gmagick.getfilename.php                            17-Jul-2024 20:07                2541
gmagick.getimagebackgroundcolor.php                17-Jul-2024 20:07                2678
gmagick.getimageblueprimary.php                    17-Jul-2024 20:07                2995
gmagick.getimagebordercolor.php                    17-Jul-2024 20:07                2722
gmagick.getimagechanneldepth.php                   17-Jul-2024 20:07                2783
gmagick.getimagecolors.php                         17-Jul-2024 20:07                2577
gmagick.getimagecolorspace.php                     17-Jul-2024 20:07                2535
gmagick.getimagecompose.php                        17-Jul-2024 20:07                2615
gmagick.getimagedelay.php                          17-Jul-2024 20:07                2512
gmagick.getimagedepth.php                          17-Jul-2024 20:07                2482
gmagick.getimagedispose.php                        17-Jul-2024 20:07                2536
gmagick.getimageextrema.php                        17-Jul-2024 20:07                2741
gmagick.getimagefilename.php                       17-Jul-2024 20:07                2620
gmagick.getimageformat.php                         17-Jul-2024 20:07                2603
gmagick.getimagegamma.php                          17-Jul-2024 20:07                2503
gmagick.getimagegreenprimary.php                   17-Jul-2024 20:07                2722
gmagick.getimageheight.php                         17-Jul-2024 20:07                2534
gmagick.getimagehistogram.php                      17-Jul-2024 20:07                2895
gmagick.getimageindex.php                          17-Jul-2024 20:07                2665
gmagick.getimageinterlacescheme.php                17-Jul-2024 20:07                2653
gmagick.getimageiterations.php                     17-Jul-2024 20:07                2580
gmagick.getimagematte.php                          17-Jul-2024 20:07                2920
gmagick.getimagemattecolor.php                     17-Jul-2024 20:07                2628
gmagick.getimageprofile.php                        17-Jul-2024 20:07                2735
gmagick.getimageredprimary.php                     17-Jul-2024 20:07                2743
gmagick.getimagerenderingintent.php                17-Jul-2024 20:07                2664
gmagick.getimageresolution.php                     17-Jul-2024 20:07                2596
gmagick.getimagescene.php                          17-Jul-2024 20:07                2499
gmagick.getimagesignature.php                      17-Jul-2024 20:07                2614
gmagick.getimagetype.php                           17-Jul-2024 20:07                2506
gmagick.getimageunits.php                          17-Jul-2024 20:07                2276
gmagick.getimagewhitepoint.php                     17-Jul-2024 20:07                2719
gmagick.getimagewidth.php                          17-Jul-2024 20:07                2513
gmagick.getpackagename.php                         17-Jul-2024 20:07                2567
gmagick.getquantumdepth.php                        17-Jul-2024 20:07                2744
gmagick.getreleasedate.php                         17-Jul-2024 20:07                2601
gmagick.getsamplingfactors.php                     17-Jul-2024 20:07                2654
gmagick.getsize.php                                17-Jul-2024 20:07                2803
gmagick.getversion.php                             17-Jul-2024 20:07                2544
gmagick.hasnextimage.php                           17-Jul-2024 20:07                2901
gmagick.haspreviousimage.php                       17-Jul-2024 20:07                2945
gmagick.implodeimage.php                           17-Jul-2024 20:07                2976
gmagick.installation.php                           17-Jul-2024 20:07                1884
gmagick.labelimage.php                             17-Jul-2024 20:07                2745
gmagick.levelimage.php                             17-Jul-2024 20:07                4696
gmagick.magnifyimage.php                           17-Jul-2024 20:07                2595
gmagick.mapimage.php                               17-Jul-2024 20:07                3281
gmagick.medianfilterimage.php                      17-Jul-2024 20:07                3065
gmagick.minifyimage.php                            17-Jul-2024 20:07                2629
gmagick.modulateimage.php                          17-Jul-2024 20:07                3894
gmagick.motionblurimage.php                        17-Jul-2024 20:07                3919
gmagick.newimage.php                               17-Jul-2024 20:07                3941
gmagick.nextimage.php                              17-Jul-2024 20:07                2752
gmagick.normalizeimage.php                         17-Jul-2024 20:07                3021
gmagick.oilpaintimage.php                          17-Jul-2024 20:07                3037
gmagick.previousimage.php                          17-Jul-2024 20:07                2747
gmagick.profileimage.php                           17-Jul-2024 20:07                3595
gmagick.quantizeimage.php                          17-Jul-2024 20:07                5364
gmagick.quantizeimages.php                         17-Jul-2024 20:07                5367
gmagick.queryfontmetrics.php                       17-Jul-2024 20:07                2922
gmagick.queryfonts.php                             17-Jul-2024 20:07                2698
gmagick.queryformats.php                           17-Jul-2024 20:07                3115
gmagick.radialblurimage.php                        17-Jul-2024 20:07                3241
gmagick.raiseimage.php                             17-Jul-2024 20:07                4432
gmagick.read.php                                   17-Jul-2024 20:07                2760
gmagick.readimage.php                              17-Jul-2024 20:07                2810
gmagick.readimageblob.php                          17-Jul-2024 20:07                3233
gmagick.readimagefile.php                          17-Jul-2024 20:07                3110
gmagick.reducenoiseimage.php                       17-Jul-2024 20:07                3215
gmagick.removeimage.php                            17-Jul-2024 20:07                2577
gmagick.removeimageprofile.php                     17-Jul-2024 20:07                2922
gmagick.requirements.php                           17-Jul-2024 20:07                1658
gmagick.resampleimage.php                          17-Jul-2024 20:07                3944
gmagick.resizeimage.php                            17-Jul-2024 20:07                4281
gmagick.rollimage.php                              17-Jul-2024 20:07                3020
gmagick.rotateimage.php                            17-Jul-2024 20:07                3195
gmagick.scaleimage.php                             17-Jul-2024 20:07                3563
gmagick.separateimagechannel.php                   17-Jul-2024 20:07                3207
gmagick.setcompressionquality.php                  17-Jul-2024 20:07                4223
gmagick.setfilename.php                            17-Jul-2024 20:07                2940
gmagick.setimagebackgroundcolor.php                17-Jul-2024 20:07                3009
gmagick.setimageblueprimary.php                    17-Jul-2024 20:07                3303
gmagick.setimagebordercolor.php                    17-Jul-2024 20:07                2971
gmagick.setimagechanneldepth.php                   17-Jul-2024 20:07                3450
gmagick.setimagecolorspace.php                     17-Jul-2024 20:07                3092
gmagick.setimagecompose.php                        17-Jul-2024 20:07                2858
gmagick.setimagedelay.php                          17-Jul-2024 20:07                2872
gmagick.setimagedepth.php                          17-Jul-2024 20:07                2870
gmagick.setimagedispose.php                        17-Jul-2024 20:07                2914
gmagick.setimagefilename.php                       17-Jul-2024 20:07                2964
gmagick.setimageformat.php                         17-Jul-2024 20:07                2927
gmagick.setimagegamma.php                          17-Jul-2024 20:07                2864
gmagick.setimagegreenprimary.php                   17-Jul-2024 20:07                3311
gmagick.setimageindex.php                          17-Jul-2024 20:07                3011
gmagick.setimageinterlacescheme.php                17-Jul-2024 20:07                3158
gmagick.setimageiterations.php                     17-Jul-2024 20:07                2967
gmagick.setimageprofile.php                        17-Jul-2024 20:07                3400
gmagick.setimageredprimary.php                     17-Jul-2024 20:07                3214
gmagick.setimagerenderingintent.php                17-Jul-2024 20:07                3189
gmagick.setimageresolution.php                     17-Jul-2024 20:07                3208
gmagick.setimagescene.php                          17-Jul-2024 20:07                2860
gmagick.setimagetype.php                           17-Jul-2024 20:07                2985
gmagick.setimageunits.php                          17-Jul-2024 20:07                3044
gmagick.setimagewhitepoint.php                     17-Jul-2024 20:07                3240
gmagick.setsamplingfactors.php                     17-Jul-2024 20:07                3086
gmagick.setsize.php                                17-Jul-2024 20:07                3556
gmagick.setup.php                                  17-Jul-2024 20:07                1434
gmagick.shearimage.php                             17-Jul-2024 20:07                3938
gmagick.solarizeimage.php                          17-Jul-2024 20:07                3118
gmagick.spreadimage.php                            17-Jul-2024 20:07                2962
gmagick.stripimage.php                             17-Jul-2024 20:07                2557
gmagick.swirlimage.php                             17-Jul-2024 20:07                3043
gmagick.thumbnailimage.php                         17-Jul-2024 20:07                3874
gmagick.trimimage.php                              17-Jul-2024 20:07                3107
gmagick.write.php                                  17-Jul-2024 20:07                1748
gmagick.writeimage.php                             17-Jul-2024 20:07                3519
gmagickdraw.annotate.php                           17-Jul-2024 20:07                3204
gmagickdraw.arc.php                                17-Jul-2024 20:07                4364
gmagickdraw.bezier.php                             17-Jul-2024 20:07                2643
gmagickdraw.ellipse.php                            17-Jul-2024 20:07                4285
gmagickdraw.getfillcolor.php                       17-Jul-2024 20:07                2446
gmagickdraw.getfillopacity.php                     17-Jul-2024 20:07                2397
gmagickdraw.getfont.php                            17-Jul-2024 20:07                2388
gmagickdraw.getfontsize.php                        17-Jul-2024 20:07                2439
gmagickdraw.getfontstyle.php                       17-Jul-2024 20:07                2515
gmagickdraw.getfontweight.php                      17-Jul-2024 20:07                2360
gmagickdraw.getstrokecolor.php                     17-Jul-2024 20:07                2501
gmagickdraw.getstrokeopacity.php                   17-Jul-2024 20:07                2474
gmagickdraw.getstrokewidth.php                     17-Jul-2024 20:07                2493
gmagickdraw.gettextdecoration.php                  17-Jul-2024 20:07                2427
gmagickdraw.gettextencoding.php                    17-Jul-2024 20:07                2516
gmagickdraw.line.php                               17-Jul-2024 20:07                3648
gmagickdraw.point.php                              17-Jul-2024 20:07                2935
gmagickdraw.polygon.php                            17-Jul-2024 20:07                2710
gmagickdraw.polyline.php                           17-Jul-2024 20:07                2745
gmagickdraw.rectangle.php                          17-Jul-2024 20:07                3752
gmagickdraw.rotate.php                             17-Jul-2024 20:07                2701
gmagickdraw.roundrectangle.php                     17-Jul-2024 20:07                4529
gmagickdraw.scale.php                              17-Jul-2024 20:07                2999
gmagickdraw.setfillcolor.php                       17-Jul-2024 20:07                2961
gmagickdraw.setfillopacity.php                     17-Jul-2024 20:07                2799
gmagickdraw.setfont.php                            17-Jul-2024 20:07                2699
gmagickdraw.setfontsize.php                        17-Jul-2024 20:07                2729
gmagickdraw.setfontstyle.php                       17-Jul-2024 20:07                2860
gmagickdraw.setfontweight.php                      17-Jul-2024 20:07                2731
gmagickdraw.setstrokecolor.php                     17-Jul-2024 20:07                2985
gmagickdraw.setstrokeopacity.php                   17-Jul-2024 20:07                2817
gmagickdraw.setstrokewidth.php                     17-Jul-2024 20:07                2777
gmagickdraw.settextdecoration.php                  17-Jul-2024 20:07                2863
gmagickdraw.settextencoding.php                    17-Jul-2024 20:07                3071
gmagickpixel.construct.php                         17-Jul-2024 20:07                2579
gmagickpixel.getcolor.php                          17-Jul-2024 20:07                4363
gmagickpixel.getcolorcount.php                     17-Jul-2024 20:07                2488
gmagickpixel.getcolorvalue.php                     17-Jul-2024 20:07                2907
gmagickpixel.setcolor.php                          17-Jul-2024 20:07                3038
gmagickpixel.setcolorvalue.php                     17-Jul-2024 20:07                3317
gmp.constants.php                                  17-Jul-2024 20:07                4404
gmp.construct.php                                  17-Jul-2024 20:07                3756
gmp.examples.php                                   17-Jul-2024 20:07                3079
gmp.installation.php                               17-Jul-2024 20:07                1319
gmp.requirements.php                               17-Jul-2024 20:07                1703
gmp.serialize.php                                  17-Jul-2024 20:07                2220
gmp.setup.php                                      17-Jul-2024 20:07                1400
gmp.unserialize.php                                17-Jul-2024 20:07                2543
gnupg.constants.php                                17-Jul-2024 20:07                9412
gnupg.examples-clearsign.php                       17-Jul-2024 20:07                6391
gnupg.examples.php                                 17-Jul-2024 20:07                1391
gnupg.installation.php                             17-Jul-2024 20:07                1506
gnupg.requirements.php                             17-Jul-2024 20:07                1262
gnupg.resources.php                                17-Jul-2024 20:07                1169
gnupg.setup.php                                    17-Jul-2024 20:07                1485
hash.constants.php                                 17-Jul-2024 20:07                1736
hash.installation.php                              17-Jul-2024 20:07                1606
hash.resources.php                                 17-Jul-2024 20:07                1318
hash.setup.php                                     17-Jul-2024 20:07                1409
hashcontext.construct.php                          17-Jul-2024 20:07                1911
hashcontext.serialize.php                          17-Jul-2024 20:07                2344
hashcontext.unserialize.php                        17-Jul-2024 20:07                2650
history.php                                        17-Jul-2024 20:07                2084
history.php.books.php                              17-Jul-2024 20:07                2480
history.php.php                                    17-Jul-2024 20:07                9170
history.php.publications.php                       17-Jul-2024 20:07                1756
history.php.related.php                            17-Jul-2024 20:07                5358
hrtime-performancecounter.getfrequency.php         17-Jul-2024 20:07                2744
hrtime-performancecounter.getticks.php             17-Jul-2024 20:07                2617
hrtime-performancecounter.gettickssince.php        17-Jul-2024 20:07                2936
hrtime-stopwatch.getelapsedticks.php               17-Jul-2024 20:07                2519
hrtime-stopwatch.getelapsedtime.php                17-Jul-2024 20:07                2931
hrtime-stopwatch.getlastelapsedticks.php           17-Jul-2024 20:07                2587
hrtime-stopwatch.getlastelapsedtime.php            17-Jul-2024 20:07                2955
hrtime-stopwatch.isrunning.php                     17-Jul-2024 20:07                2445
hrtime-stopwatch.start.php                         17-Jul-2024 20:07                2381
hrtime-stopwatch.stop.php                          17-Jul-2024 20:07                2260
hrtime.example.basic.php                           17-Jul-2024 20:07                5486
hrtime.examples.php                                17-Jul-2024 20:07                1379
hrtime.installation.php                            17-Jul-2024 20:07                1908
hrtime.setup.php                                   17-Jul-2024 20:07                1370
ibase.configuration.php                            17-Jul-2024 20:07                7884
ibase.constants.php                                17-Jul-2024 20:07               21288
ibase.installation.php                             17-Jul-2024 20:07                3089
ibase.resources.php                                17-Jul-2024 20:07                1179
ibase.setup.php                                    17-Jul-2024 20:07                1513
ibm-db2.configuration.php                          17-Jul-2024 20:07               20760
ibm-db2.constants.php                              17-Jul-2024 20:07                9031
ibm-db2.installation.php                           17-Jul-2024 20:07                3479
ibm-db2.requirements.php                           17-Jul-2024 20:07                3201
ibm-db2.resources.php                              17-Jul-2024 20:07                1265
ibm-db2.setup.php                                  17-Jul-2024 20:07                1584
iconv.configuration.php                            17-Jul-2024 20:07                4507
iconv.constants.php                                17-Jul-2024 20:07                3619
iconv.installation.php                             17-Jul-2024 20:07                1470
iconv.requirements.php                             17-Jul-2024 20:07                1420
iconv.resources.php                                17-Jul-2024 20:07                1179
iconv.setup.php                                    17-Jul-2024 20:07                1564
igbinary.configuration.php                         17-Jul-2024 20:07                3358
igbinary.installation.php                          17-Jul-2024 20:07                1916
igbinary.setup.php                                 17-Jul-2024 20:07                1454
image.configuration.php                            17-Jul-2024 20:07                3200
image.constants.php                                17-Jul-2024 20:07               56544
image.examples-png.php                             17-Jul-2024 20:07                4695
image.examples-watermark.php                       17-Jul-2024 20:07                5719
image.examples.merged-watermark.php                17-Jul-2024 20:07                8431
image.examples.php                                 17-Jul-2024 20:07                1605
image.installation.php                             17-Jul-2024 20:07                5818
image.requirements.php                             17-Jul-2024 20:07                4184
image.resources.php                                17-Jul-2024 20:07                2022
image.setup.php                                    17-Jul-2024 20:07                1560
imagick.adaptiveblurimage.php                      17-Jul-2024 20:07                6883
imagick.adaptiveresizeimage.php                    17-Jul-2024 20:07                8993
imagick.adaptivesharpenimage.php                   17-Jul-2024 20:07                6423
imagick.adaptivethresholdimage.php                 17-Jul-2024 20:07                6251
imagick.addimage.php                               17-Jul-2024 20:07                2918
imagick.addnoiseimage.php                          17-Jul-2024 20:07                5580
imagick.affinetransformimage.php                   17-Jul-2024 20:07                6647
imagick.animateimages.php                          17-Jul-2024 20:07                3148
imagick.annotateimage.php                          17-Jul-2024 20:07                8682
imagick.appendimages.php                           17-Jul-2024 20:07                6690
imagick.autolevelimage.php                         17-Jul-2024 20:07                4478
imagick.averageimages.php                          17-Jul-2024 20:07                2687
imagick.blackthresholdimage.php                    17-Jul-2024 20:07                5305
imagick.blueshiftimage.php                         17-Jul-2024 20:07                4523
imagick.blurimage.php                              17-Jul-2024 20:07                5761
imagick.borderimage.php                            17-Jul-2024 20:07                6055
imagick.brightnesscontrastimage.php                17-Jul-2024 20:07                5683
imagick.charcoalimage.php                          17-Jul-2024 20:07                5016
imagick.chopimage.php                              17-Jul-2024 20:07                7013
imagick.clampimage.php                             17-Jul-2024 20:07                2739
imagick.clear.php                                  17-Jul-2024 20:07                2268
imagick.clipimage.php                              17-Jul-2024 20:07                2503
imagick.clipimagepath.php                          17-Jul-2024 20:07                3124
imagick.clippathimage.php                          17-Jul-2024 20:07                3520
imagick.clone.php                                  17-Jul-2024 20:07                4136
imagick.clutimage.php                              17-Jul-2024 20:07                6017
imagick.coalesceimages.php                         17-Jul-2024 20:07                2804
imagick.colorfloodfillimage.php                    17-Jul-2024 20:07                5407
imagick.colorizeimage.php                          17-Jul-2024 20:07                6873
imagick.colormatriximage.php                       17-Jul-2024 20:07                7646
imagick.combineimages.php                          17-Jul-2024 20:07                3362
imagick.commentimage.php                           17-Jul-2024 20:07                4983
imagick.compareimagechannels.php                   17-Jul-2024 20:07                3958
imagick.compareimagelayers.php                     17-Jul-2024 20:07                5440
imagick.compareimages.php                          17-Jul-2024 20:07                5662
imagick.compositeimage.php                         17-Jul-2024 20:07                8165
imagick.configuration.php                          17-Jul-2024 20:07                4350
imagick.constants.php                              17-Jul-2024 20:07              157646
imagick.construct.php                              17-Jul-2024 20:07                2600
imagick.contrastimage.php                          17-Jul-2024 20:07                5044
imagick.contraststretchimage.php                   17-Jul-2024 20:07                3942
imagick.convolveimage.php                          17-Jul-2024 20:07                5960
imagick.count.php                                  17-Jul-2024 20:07                2728
imagick.cropimage.php                              17-Jul-2024 20:07                6167
imagick.cropthumbnailimage.php                     17-Jul-2024 20:07                3473
imagick.current.php                                17-Jul-2024 20:07                2465
imagick.cyclecolormapimage.php                     17-Jul-2024 20:07                3001
imagick.decipherimage.php                          17-Jul-2024 20:07                3240
imagick.deconstructimages.php                      17-Jul-2024 20:07                2620
imagick.deleteimageartifact.php                    17-Jul-2024 20:07                3636
imagick.deleteimageproperty.php                    17-Jul-2024 20:07                2661
imagick.deskewimage.php                            17-Jul-2024 20:07               11020
imagick.despeckleimage.php                         17-Jul-2024 20:07                4255
imagick.destroy.php                                17-Jul-2024 20:07                2406
imagick.displayimage.php                           17-Jul-2024 20:07                2802
imagick.displayimages.php                          17-Jul-2024 20:07                2846
imagick.distortimage.php                           17-Jul-2024 20:07               11812
imagick.drawimage.php                              17-Jul-2024 20:07                2702
imagick.edgeimage.php                              17-Jul-2024 20:07                4682
imagick.embossimage.php                            17-Jul-2024 20:07                5379
imagick.encipherimage.php                          17-Jul-2024 20:07                3236
imagick.enhanceimage.php                           17-Jul-2024 20:07                4222
imagick.equalizeimage.php                          17-Jul-2024 20:07                4189
imagick.evaluateimage.php                          17-Jul-2024 20:07                5936
imagick.examples-1.php                             17-Jul-2024 20:07               29929
imagick.examples.php                               17-Jul-2024 20:07                1393
imagick.exportimagepixels.php                      17-Jul-2024 20:07                7917
imagick.extentimage.php                            17-Jul-2024 20:07                5232
imagick.filter.php                                 17-Jul-2024 20:07                7571
imagick.flattenimages.php                          17-Jul-2024 20:07                2791
imagick.flipimage.php                              17-Jul-2024 20:07                4516
imagick.floodfillpaintimage.php                    17-Jul-2024 20:07               11539
imagick.flopimage.php                              17-Jul-2024 20:07                4548
imagick.forwardfouriertransformimage.php           17-Jul-2024 20:07               12110
imagick.frameimage.php                             17-Jul-2024 20:07                8325
imagick.functionimage.php                          17-Jul-2024 20:07               13681
imagick.fximage.php                                17-Jul-2024 20:07                6060
imagick.gammaimage.php                             17-Jul-2024 20:07                5721
imagick.gaussianblurimage.php                      17-Jul-2024 20:07                6257
imagick.getcolorspace.php                          17-Jul-2024 20:07                2428
imagick.getcompression.php                         17-Jul-2024 20:07                2282
imagick.getcompressionquality.php                  17-Jul-2024 20:07                2356
imagick.getcopyright.php                           17-Jul-2024 20:07                2385
imagick.getfilename.php                            17-Jul-2024 20:07                2442
imagick.getfont.php                                17-Jul-2024 20:07                3054
imagick.getformat.php                              17-Jul-2024 20:07                2404
imagick.getgravity.php                             17-Jul-2024 20:07                2407
imagick.gethomeurl.php                             17-Jul-2024 20:07                2262
imagick.getimage.php                               17-Jul-2024 20:07                2446
imagick.getimagealphachannel.php                   17-Jul-2024 20:07                3492
imagick.getimageartifact.php                       17-Jul-2024 20:07                3536
imagick.getimageattribute.php                      17-Jul-2024 20:07                2801
imagick.getimagebackgroundcolor.php                17-Jul-2024 20:07                2612
imagick.getimageblob.php                           17-Jul-2024 20:07                2698
imagick.getimageblueprimary.php                    17-Jul-2024 20:07                2904
imagick.getimagebordercolor.php                    17-Jul-2024 20:07                2619
imagick.getimagechanneldepth.php                   17-Jul-2024 20:07                3208
imagick.getimagechanneldistortion.php              17-Jul-2024 20:07                4092
imagick.getimagechanneldistortions.php             17-Jul-2024 20:07                4447
imagick.getimagechannelextrema.php                 17-Jul-2024 20:07                3615
imagick.getimagechannelkurtosis.php                17-Jul-2024 20:07                3582
imagick.getimagechannelmean.php                    17-Jul-2024 20:07                3270
imagick.getimagechannelrange.php                   17-Jul-2024 20:07                3435
imagick.getimagechannelstatistics.php              17-Jul-2024 20:07                2611
imagick.getimageclipmask.php                       17-Jul-2024 20:07                2911
imagick.getimagecolormapcolor.php                  17-Jul-2024 20:07                2969
imagick.getimagecolors.php                         17-Jul-2024 20:07                2426
imagick.getimagecolorspace.php                     17-Jul-2024 20:07                2409
imagick.getimagecompose.php                        17-Jul-2024 20:07                2417
imagick.getimagecompression.php                    17-Jul-2024 20:07                2370
imagick.getimagecompressionquality.php             17-Jul-2024 20:07                2464
imagick.getimagedelay.php                          17-Jul-2024 20:07                2435
imagick.getimagedepth.php                          17-Jul-2024 20:07                2215
imagick.getimagedispose.php                        17-Jul-2024 20:07                2475
imagick.getimagedistortion.php                     17-Jul-2024 20:07                3275
imagick.getimageextrema.php                        17-Jul-2024 20:07                2850
imagick.getimagefilename.php                       17-Jul-2024 20:07                2549
imagick.getimageformat.php                         17-Jul-2024 20:07                2531
imagick.getimagegamma.php                          17-Jul-2024 20:07                2430
imagick.getimagegeometry.php                       17-Jul-2024 20:07                4149
imagick.getimagegravity.php                        17-Jul-2024 20:07                2700
imagick.getimagegreenprimary.php                   17-Jul-2024 20:07                2700
imagick.getimageheight.php                         17-Jul-2024 20:07                2461
imagick.getimagehistogram.php                      17-Jul-2024 20:07               17201
imagick.getimageindex.php                          17-Jul-2024 20:07                2957
imagick.getimageinterlacescheme.php                17-Jul-2024 20:07                2507
imagick.getimageinterpolatemethod.php              17-Jul-2024 20:07                2734
imagick.getimageiterations.php                     17-Jul-2024 20:07                2523
imagick.getimagelength.php                         17-Jul-2024 20:07                3395
imagick.getimagematte.php                          17-Jul-2024 20:07                2774
imagick.getimagemattecolor.php                     17-Jul-2024 20:07                2765
imagick.getimagemimetype.php                       17-Jul-2024 20:07                2280
imagick.getimageorientation.php                    17-Jul-2024 20:07                2627
imagick.getimagepage.php                           17-Jul-2024 20:07                2692
imagick.getimagepixelcolor.php                     17-Jul-2024 20:07                3170
imagick.getimageprofile.php                        17-Jul-2024 20:07                2814
imagick.getimageprofiles.php                       17-Jul-2024 20:07                3543
imagick.getimageproperties.php                     17-Jul-2024 20:07                5796
imagick.getimageproperty.php                       17-Jul-2024 20:07                4938
imagick.getimageredprimary.php                     17-Jul-2024 20:07                2768
imagick.getimageregion.php                         17-Jul-2024 20:07                3970
imagick.getimagerenderingintent.php                17-Jul-2024 20:07                2651
imagick.getimageresolution.php                     17-Jul-2024 20:07                2512
imagick.getimagesblob.php                          17-Jul-2024 20:07                2540
imagick.getimagescene.php                          17-Jul-2024 20:07                2417
imagick.getimagesignature.php                      17-Jul-2024 20:07                2546
imagick.getimagesize.php                           17-Jul-2024 20:07                2635
imagick.getimagetickspersecond.php                 17-Jul-2024 20:07                2563
imagick.getimagetotalinkdensity.php                17-Jul-2024 20:07                2493
imagick.getimagetype.php                           17-Jul-2024 20:07                4870
imagick.getimageunits.php                          17-Jul-2024 20:07                2459
imagick.getimagevirtualpixelmethod.php             17-Jul-2024 20:07                2630
imagick.getimagewhitepoint.php                     17-Jul-2024 20:07                2680
imagick.getimagewidth.php                          17-Jul-2024 20:07                2435
imagick.getinterlacescheme.php                     17-Jul-2024 20:07                2581
imagick.getiteratorindex.php                       17-Jul-2024 20:07                6060
imagick.getnumberimages.php                        17-Jul-2024 20:07                2530
imagick.getoption.php                              17-Jul-2024 20:07                2788
imagick.getpackagename.php                         17-Jul-2024 20:07                2503
imagick.getpage.php                                17-Jul-2024 20:07                2516
imagick.getpixeliterator.php                       17-Jul-2024 20:07                5987
imagick.getpixelregioniterator.php                 17-Jul-2024 20:07                6749
imagick.getpointsize.php                           17-Jul-2024 20:07                2770
imagick.getquantum.php                             17-Jul-2024 20:07                2308
imagick.getquantumdepth.php                        17-Jul-2024 20:07                2614
imagick.getquantumrange.php                        17-Jul-2024 20:07                2876
imagick.getregistry.php                            17-Jul-2024 20:07                2537
imagick.getreleasedate.php                         17-Jul-2024 20:07                2527
imagick.getresource.php                            17-Jul-2024 20:07                2945
imagick.getresourcelimit.php                       17-Jul-2024 20:07                3356
imagick.getsamplingfactors.php                     17-Jul-2024 20:07                2591
imagick.getsize.php                                17-Jul-2024 20:07                5845
imagick.getsizeoffset.php                          17-Jul-2024 20:07                2548
imagick.getversion.php                             17-Jul-2024 20:07                2513
imagick.haldclutimage.php                          17-Jul-2024 20:07                6095
imagick.hasnextimage.php                           17-Jul-2024 20:07                2658
imagick.haspreviousimage.php                       17-Jul-2024 20:07                2696
imagick.identifyformat.php                         17-Jul-2024 20:07                4498
imagick.identifyimage.php                          17-Jul-2024 20:07                4119
imagick.implodeimage.php                           17-Jul-2024 20:07                4672
imagick.importimagepixels.php                      17-Jul-2024 20:07               11365
imagick.installation.php                           17-Jul-2024 20:07                2908
imagick.inversefouriertransformimage.php           17-Jul-2024 20:07                3473
imagick.labelimage.php                             17-Jul-2024 20:07                2605
imagick.levelimage.php                             17-Jul-2024 20:07                7787
imagick.linearstretchimage.php                     17-Jul-2024 20:07                5699
imagick.liquidrescaleimage.php                     17-Jul-2024 20:07                4499
imagick.listregistry.php                           17-Jul-2024 20:07                2367
imagick.magnifyimage.php                           17-Jul-2024 20:07                4221
imagick.mapimage.php                               17-Jul-2024 20:07                3222
imagick.mattefloodfillimage.php                    17-Jul-2024 20:07                5744
imagick.medianfilterimage.php                      17-Jul-2024 20:07                5121
imagick.mergeimagelayers.php                       17-Jul-2024 20:07                6435
imagick.minifyimage.php                            17-Jul-2024 20:07                2386
imagick.modulateimage.php                          17-Jul-2024 20:07                5647
imagick.montageimage.php                           17-Jul-2024 20:07                4583
imagick.morphimages.php                            17-Jul-2024 20:07                2815
imagick.morphology.php                             17-Jul-2024 20:07               66853
imagick.mosaicimages.php                           17-Jul-2024 20:07                2696
imagick.motionblurimage.php                        17-Jul-2024 20:07                6818
imagick.negateimage.php                            17-Jul-2024 20:07                5571
imagick.newimage.php                               17-Jul-2024 20:07                7537
imagick.newpseudoimage.php                         17-Jul-2024 20:07                5829
imagick.nextimage.php                              17-Jul-2024 20:07                2318
imagick.normalizeimage.php                         17-Jul-2024 20:07                6420
imagick.oilpaintimage.php                          17-Jul-2024 20:07                4625
imagick.opaquepaintimage.php                       17-Jul-2024 20:07                4984
imagick.optimizeimagelayers.php                    17-Jul-2024 20:07                5272
imagick.orderedposterizeimage.php                  17-Jul-2024 20:07                6766
imagick.paintfloodfillimage.php                    17-Jul-2024 20:07                5730
imagick.paintopaqueimage.php                       17-Jul-2024 20:07                5355
imagick.painttransparentimage.php                  17-Jul-2024 20:07                4620
imagick.pingimage.php                              17-Jul-2024 20:07                2727
imagick.pingimageblob.php                          17-Jul-2024 20:07                5953
imagick.pingimagefile.php                          17-Jul-2024 20:07                5785
imagick.polaroidimage.php                          17-Jul-2024 20:07                4744
imagick.posterizeimage.php                         17-Jul-2024 20:07                5658
imagick.previewimages.php                          17-Jul-2024 20:07                3124
imagick.previousimage.php                          17-Jul-2024 20:07                2373
imagick.profileimage.php                           17-Jul-2024 20:07                3212
imagick.quantizeimage.php                          17-Jul-2024 20:07                6711
imagick.quantizeimages.php                         17-Jul-2024 20:07                4041
imagick.queryfontmetrics.php                       17-Jul-2024 20:07                5600
imagick.queryfonts.php                             17-Jul-2024 20:07                4746
imagick.queryformats.php                           17-Jul-2024 20:07                7121
imagick.radialblurimage.php                        17-Jul-2024 20:07                5528
imagick.raiseimage.php                             17-Jul-2024 20:07                6542
imagick.randomthresholdimage.php                   17-Jul-2024 20:07                6426
imagick.readimage.php                              17-Jul-2024 20:07                2569
imagick.readimageblob.php                          17-Jul-2024 20:07                5821
imagick.readimagefile.php                          17-Jul-2024 20:07                3210
imagick.readimages.php                             17-Jul-2024 20:07                2616
imagick.recolorimage.php                           17-Jul-2024 20:07                6296
imagick.reducenoiseimage.php                       17-Jul-2024 20:07                5171
imagick.remapimage.php                             17-Jul-2024 20:07                3428
imagick.removeimage.php                            17-Jul-2024 20:07                2509
imagick.removeimageprofile.php                     17-Jul-2024 20:07                2809
imagick.render.php                                 17-Jul-2024 20:07                2281
imagick.requirements.php                           17-Jul-2024 20:07                1541
imagick.resampleimage.php                          17-Jul-2024 20:07                5651
imagick.resetimagepage.php                         17-Jul-2024 20:07                2796
imagick.resizeimage.php                            17-Jul-2024 20:07               11254
imagick.resources.php                              17-Jul-2024 20:07                1193
imagick.rollimage.php                              17-Jul-2024 20:07                4823
imagick.rotateimage.php                            17-Jul-2024 20:07                5695
imagick.rotationalblurimage.php                    17-Jul-2024 20:07                5750
imagick.roundcorners.php                           17-Jul-2024 20:07                6658
imagick.sampleimage.php                            17-Jul-2024 20:07                2992
imagick.scaleimage.php                             17-Jul-2024 20:07                6922
imagick.segmentimage.php                           17-Jul-2024 20:07                6766
imagick.selectiveblurimage.php                     17-Jul-2024 20:07                6613
imagick.separateimagechannel.php                   17-Jul-2024 20:07                5407
imagick.sepiatoneimage.php                         17-Jul-2024 20:07                4903
imagick.setbackgroundcolor.php                     17-Jul-2024 20:07                3268
imagick.setcolorspace.php                          17-Jul-2024 20:07                2985
imagick.setcompression.php                         17-Jul-2024 20:07                2786
imagick.setcompressionquality.php                  17-Jul-2024 20:07                6943
imagick.setfilename.php                            17-Jul-2024 20:07                2656
imagick.setfirstiterator.php                       17-Jul-2024 20:07                2367
imagick.setfont.php                                17-Jul-2024 20:07                5510
imagick.setformat.php                              17-Jul-2024 20:07                2558
imagick.setgravity.php                             17-Jul-2024 20:07                2717
imagick.setimage.php                               17-Jul-2024 20:07                4714
imagick.setimagealphachannel.php                   17-Jul-2024 20:07                3643
imagick.setimageartifact.php                       17-Jul-2024 20:07                7303
imagick.setimageattribute.php                      17-Jul-2024 20:07                3146
imagick.setimagebackgroundcolor.php                17-Jul-2024 20:07                3497
imagick.setimagebias.php                           17-Jul-2024 20:07                6734
imagick.setimagebiasquantum.php                    17-Jul-2024 20:07                2876
imagick.setimageblueprimary.php                    17-Jul-2024 20:07                3171
imagick.setimagebordercolor.php                    17-Jul-2024 20:07                3475
imagick.setimagechanneldepth.php                   17-Jul-2024 20:07                3188
imagick.setimageclipmask.php                       17-Jul-2024 20:07                8665
imagick.setimagecolormapcolor.php                  17-Jul-2024 20:07                3211
imagick.setimagecolorspace.php                     17-Jul-2024 20:07                3232
imagick.setimagecompose.php                        17-Jul-2024 20:07                2951
imagick.setimagecompression.php                    17-Jul-2024 20:07                2922
imagick.setimagecompressionquality.php             17-Jul-2024 20:07                4865
imagick.setimagedelay.php                          17-Jul-2024 20:07                6176
imagick.setimagedepth.php                          17-Jul-2024 20:07                2769
imagick.setimagedispose.php                        17-Jul-2024 20:07                2813
imagick.setimageextent.php                         17-Jul-2024 20:07                3088
imagick.setimagefilename.php                       17-Jul-2024 20:07                2865
imagick.setimageformat.php                         17-Jul-2024 20:07                2713
imagick.setimagegamma.php                          17-Jul-2024 20:07                2773
imagick.setimagegravity.php                        17-Jul-2024 20:07                2882
imagick.setimagegreenprimary.php                   17-Jul-2024 20:07                3164
imagick.setimageindex.php                          17-Jul-2024 20:07                3342
imagick.setimageinterlacescheme.php                17-Jul-2024 20:07                2933
imagick.setimageinterpolatemethod.php              17-Jul-2024 20:07                2860
imagick.setimageiterations.php                     17-Jul-2024 20:07                5022
imagick.setimagematte.php                          17-Jul-2024 20:07                2754
imagick.setimagemattecolor.php                     17-Jul-2024 20:07                3659
imagick.setimageopacity.php                        17-Jul-2024 20:07                4993
imagick.setimageorientation.php                    17-Jul-2024 20:07                4734
imagick.setimagepage.php                           17-Jul-2024 20:07                3727
imagick.setimageprofile.php                        17-Jul-2024 20:07                3307
imagick.setimageproperty.php                       17-Jul-2024 20:07                5155
imagick.setimageredprimary.php                     17-Jul-2024 20:07                3160
imagick.setimagerenderingintent.php                17-Jul-2024 20:07                2939
imagick.setimageresolution.php                     17-Jul-2024 20:07                5016
imagick.setimagescene.php                          17-Jul-2024 20:07                2793
imagick.setimagetickspersecond.php                 17-Jul-2024 20:07                7759
imagick.setimagetype.php                           17-Jul-2024 20:07                2591
imagick.setimageunits.php                          17-Jul-2024 20:07                2627
imagick.setimagevirtualpixelmethod.php             17-Jul-2024 20:07                2747
imagick.setimagewhitepoint.php                     17-Jul-2024 20:07                3158
imagick.setinterlacescheme.php                     17-Jul-2024 20:07                2675
imagick.setiteratorindex.php                       17-Jul-2024 20:07                6232
imagick.setlastiterator.php                        17-Jul-2024 20:07                2381
imagick.setoption.php                              17-Jul-2024 20:07               11570
imagick.setpage.php                                17-Jul-2024 20:07                3480
imagick.setpointsize.php                           17-Jul-2024 20:07                5213
imagick.setprogressmonitor.php                     17-Jul-2024 20:07               10255
imagick.setregistry.php                            17-Jul-2024 20:07                3073
imagick.setresolution.php                          17-Jul-2024 20:07                3764
imagick.setresourcelimit.php                       17-Jul-2024 20:07                3686
imagick.setsamplingfactors.php                     17-Jul-2024 20:07                6788
imagick.setsize.php                                17-Jul-2024 20:07                2906
imagick.setsizeoffset.php                          17-Jul-2024 20:07                3390
imagick.settype.php                                17-Jul-2024 20:07                2537
imagick.setup.php                                  17-Jul-2024 20:07                1579
imagick.shadeimage.php                             17-Jul-2024 20:07                5637
imagick.shadowimage.php                            17-Jul-2024 20:07                5462
imagick.sharpenimage.php                           17-Jul-2024 20:07                5632
imagick.shaveimage.php                             17-Jul-2024 20:07                4765
imagick.shearimage.php                             17-Jul-2024 20:07                6475
imagick.sigmoidalcontrastimage.php                 17-Jul-2024 20:07                7993
imagick.sketchimage.php                            17-Jul-2024 20:07                5841
imagick.smushimages.php                            17-Jul-2024 20:07                5816
imagick.solarizeimage.php                          17-Jul-2024 20:07                4868
imagick.sparsecolorimage.php                       17-Jul-2024 20:07               26688
imagick.spliceimage.php                            17-Jul-2024 20:07                5830
imagick.spreadimage.php                            17-Jul-2024 20:07                4678
imagick.statisticimage.php                         17-Jul-2024 20:07                6752
imagick.steganoimage.php                           17-Jul-2024 20:07                3058
imagick.stereoimage.php                            17-Jul-2024 20:07                2844
imagick.stripimage.php                             17-Jul-2024 20:07                2492
imagick.subimagematch.php                          17-Jul-2024 20:07                7530
imagick.swirlimage.php                             17-Jul-2024 20:07                4730
imagick.textureimage.php                           17-Jul-2024 20:07                6145
imagick.thresholdimage.php                         17-Jul-2024 20:07                5284
imagick.thumbnailimage.php                         17-Jul-2024 20:07                7493
imagick.tintimage.php                              17-Jul-2024 20:07                7812
imagick.tostring.php                               17-Jul-2024 20:07                2934
imagick.transformimage.php                         17-Jul-2024 20:07                5979
imagick.transformimagecolorspace.php               17-Jul-2024 20:07                5758
imagick.transparentpaintimage.php                  17-Jul-2024 20:07                7213
imagick.transposeimage.php                         17-Jul-2024 20:07                4566
imagick.transverseimage.php                        17-Jul-2024 20:07                4554
imagick.trimimage.php                              17-Jul-2024 20:07                5699
imagick.uniqueimagecolors.php                      17-Jul-2024 20:07                5504
imagick.unsharpmaskimage.php                       17-Jul-2024 20:07                6720
imagick.valid.php                                  17-Jul-2024 20:07                2261
imagick.vignetteimage.php                          17-Jul-2024 20:07                6586
imagick.waveimage.php                              17-Jul-2024 20:07                6307
imagick.whitethresholdimage.php                    17-Jul-2024 20:07                5217
imagick.writeimage.php                             17-Jul-2024 20:07                3009
imagick.writeimagefile.php                         17-Jul-2024 20:07                3749
imagick.writeimages.php                            17-Jul-2024 20:07                2890
imagick.writeimagesfile.php                        17-Jul-2024 20:07                3799
imagickdraw.affine.php                             17-Jul-2024 20:07               16908
imagickdraw.annotation.php                         17-Jul-2024 20:07                3297
imagickdraw.arc.php                                17-Jul-2024 20:07                9625
imagickdraw.bezier.php                             17-Jul-2024 20:07               16798
imagickdraw.circle.php                             17-Jul-2024 20:07                9020
imagickdraw.clear.php                              17-Jul-2024 20:07                2334
imagickdraw.clone.php                              17-Jul-2024 20:07                2427
imagickdraw.color.php                              17-Jul-2024 20:07                3457
imagickdraw.comment.php                            17-Jul-2024 20:07                2683
imagickdraw.composite.php                          17-Jul-2024 20:07               11900
imagickdraw.construct.php                          17-Jul-2024 20:07                2202
imagickdraw.destroy.php                            17-Jul-2024 20:07                2303
imagickdraw.ellipse.php                            17-Jul-2024 20:07               12206
imagickdraw.getclippath.php                        17-Jul-2024 20:07                2302
imagickdraw.getcliprule.php                        17-Jul-2024 20:07                2423
imagickdraw.getclipunits.php                       17-Jul-2024 20:07                2367
imagickdraw.getfillcolor.php                       17-Jul-2024 20:07                2376
imagickdraw.getfillopacity.php                     17-Jul-2024 20:07                2336
imagickdraw.getfillrule.php                        17-Jul-2024 20:07                2385
imagickdraw.getfont.php                            17-Jul-2024 20:07                2269
imagickdraw.getfontfamily.php                      17-Jul-2024 20:07                2329
imagickdraw.getfontsize.php                        17-Jul-2024 20:07                2405
imagickdraw.getfontstretch.php                     17-Jul-2024 20:07                2375
imagickdraw.getfontstyle.php                       17-Jul-2024 20:07                2548
imagickdraw.getfontweight.php                      17-Jul-2024 20:07                2387
imagickdraw.getgravity.php                         17-Jul-2024 20:07                2453
imagickdraw.getstrokeantialias.php                 17-Jul-2024 20:07                2725
imagickdraw.getstrokecolor.php                     17-Jul-2024 20:07                2765
imagickdraw.getstrokedasharray.php                 17-Jul-2024 20:07                2463
imagickdraw.getstrokedashoffset.php                17-Jul-2024 20:07                2437
imagickdraw.getstrokelinecap.php                   17-Jul-2024 20:07                2578
imagickdraw.getstrokelinejoin.php                  17-Jul-2024 20:07                2607
imagickdraw.getstrokemiterlimit.php                17-Jul-2024 20:07                2699
imagickdraw.getstrokeopacity.php                   17-Jul-2024 20:07                2440
imagickdraw.getstrokewidth.php                     17-Jul-2024 20:07                2449
imagickdraw.gettextalignment.php                   17-Jul-2024 20:07                2469
imagickdraw.gettextantialias.php                   17-Jul-2024 20:07                2606
imagickdraw.gettextdecoration.php                  17-Jul-2024 20:07                2506
imagickdraw.gettextencoding.php                    17-Jul-2024 20:07                2431
imagickdraw.gettextinterlinespacing.php            17-Jul-2024 20:07                2412
imagickdraw.gettextinterwordspacing.php            17-Jul-2024 20:07                2436
imagickdraw.gettextkerning.php                     17-Jul-2024 20:07                2331
imagickdraw.gettextundercolor.php                  17-Jul-2024 20:07                2479
imagickdraw.getvectorgraphics.php                  17-Jul-2024 20:07                2529
imagickdraw.line.php                               17-Jul-2024 20:07                8319
imagickdraw.matte.php                              17-Jul-2024 20:07                8347
imagickdraw.pathclose.php                          17-Jul-2024 20:07                2426
imagickdraw.pathcurvetoabsolute.php                17-Jul-2024 20:07                4881
imagickdraw.pathcurvetoquadraticbezierabsolute.php 17-Jul-2024 20:07               11139
imagickdraw.pathcurvetoquadraticbezierrelative.php 17-Jul-2024 20:07                4262
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 17-Jul-2024 20:07               10328
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 17-Jul-2024 20:07               10430
imagickdraw.pathcurvetorelative.php                17-Jul-2024 20:07                4897
imagickdraw.pathcurvetosmoothabsolute.php          17-Jul-2024 20:07                4634
imagickdraw.pathcurvetosmoothrelative.php          17-Jul-2024 20:07                4641
imagickdraw.pathellipticarcabsolute.php            17-Jul-2024 20:07                5654
imagickdraw.pathellipticarcrelative.php            17-Jul-2024 20:07                5624
imagickdraw.pathfinish.php                         17-Jul-2024 20:07                2259
imagickdraw.pathlinetoabsolute.php                 17-Jul-2024 20:07                3187
imagickdraw.pathlinetohorizontalabsolute.php       17-Jul-2024 20:07                3037
imagickdraw.pathlinetohorizontalrelative.php       17-Jul-2024 20:07                3032
imagickdraw.pathlinetorelative.php                 17-Jul-2024 20:07                3237
imagickdraw.pathlinetoverticalabsolute.php         17-Jul-2024 20:07                3001
imagickdraw.pathlinetoverticalrelative.php         17-Jul-2024 20:07                3006
imagickdraw.pathmovetoabsolute.php                 17-Jul-2024 20:07                3234
imagickdraw.pathmovetorelative.php                 17-Jul-2024 20:07                3170
imagickdraw.pathstart.php                          17-Jul-2024 20:07               11768
imagickdraw.point.php                              17-Jul-2024 20:07                6853
imagickdraw.polygon.php                            17-Jul-2024 20:07                8936
imagickdraw.polyline.php                           17-Jul-2024 20:07                8940
imagickdraw.pop.php                                17-Jul-2024 20:07                2676
imagickdraw.popclippath.php                        17-Jul-2024 20:07                2218
imagickdraw.popdefs.php                            17-Jul-2024 20:07                7708
imagickdraw.poppattern.php                         17-Jul-2024 20:07                2409
imagickdraw.push.php                               17-Jul-2024 20:07                8434
imagickdraw.pushclippath.php                       17-Jul-2024 20:07                2910
imagickdraw.pushdefs.php                           17-Jul-2024 20:07                2517
imagickdraw.pushpattern.php                        17-Jul-2024 20:07               14600
imagickdraw.rectangle.php                          17-Jul-2024 20:07                8525
imagickdraw.render.php                             17-Jul-2024 20:07                2451
imagickdraw.resetvectorgraphics.php                17-Jul-2024 20:07                2419
imagickdraw.rotate.php                             17-Jul-2024 20:07                7720
imagickdraw.roundrectangle.php                     17-Jul-2024 20:07                9375
imagickdraw.scale.php                              17-Jul-2024 20:07                8066
imagickdraw.setclippath.php                        17-Jul-2024 20:07                8397
imagickdraw.setcliprule.php                        17-Jul-2024 20:07                9408
imagickdraw.setclipunits.php                       17-Jul-2024 20:07                8785
imagickdraw.setfillalpha.php                       17-Jul-2024 20:07                7741
imagickdraw.setfillcolor.php                       17-Jul-2024 20:07                7743
imagickdraw.setfillopacity.php                     17-Jul-2024 20:07                7799
imagickdraw.setfillpatternurl.php                  17-Jul-2024 20:07                3238
imagickdraw.setfillrule.php                        17-Jul-2024 20:07               12945
imagickdraw.setfont.php                            17-Jul-2024 20:07                9251
imagickdraw.setfontfamily.php                      17-Jul-2024 20:07                9863
imagickdraw.setfontsize.php                        17-Jul-2024 20:07                8247
imagickdraw.setfontstretch.php                     17-Jul-2024 20:07                9674
imagickdraw.setfontstyle.php                       17-Jul-2024 20:07                8964
imagickdraw.setfontweight.php                      17-Jul-2024 20:07                9115
imagickdraw.setgravity.php                         17-Jul-2024 20:07               10531
imagickdraw.setresolution.php                      17-Jul-2024 20:07                2915
imagickdraw.setstrokealpha.php                     17-Jul-2024 20:07                8401
imagickdraw.setstrokeantialias.php                 17-Jul-2024 20:07                8940
imagickdraw.setstrokecolor.php                     17-Jul-2024 20:07                8460
imagickdraw.setstrokedasharray.php                 17-Jul-2024 20:07               13381
imagickdraw.setstrokedashoffset.php                17-Jul-2024 20:07                9832
imagickdraw.setstrokelinecap.php                   17-Jul-2024 20:07                8548
imagickdraw.setstrokelinejoin.php                  17-Jul-2024 20:07               11434
imagickdraw.setstrokemiterlimit.php                17-Jul-2024 20:07               11251
imagickdraw.setstrokeopacity.php                   17-Jul-2024 20:07               10197
imagickdraw.setstrokepatternurl.php                17-Jul-2024 20:07                2934
imagickdraw.setstrokewidth.php                     17-Jul-2024 20:07                8432
imagickdraw.settextalignment.php                   17-Jul-2024 20:07                9413
imagickdraw.settextantialias.php                   17-Jul-2024 20:07                8827
imagickdraw.settextdecoration.php                  17-Jul-2024 20:07                7449
imagickdraw.settextencoding.php                    17-Jul-2024 20:07                3117
imagickdraw.settextinterlinespacing.php            17-Jul-2024 20:07                2909
imagickdraw.settextinterwordspacing.php            17-Jul-2024 20:07                2779
imagickdraw.settextkerning.php                     17-Jul-2024 20:07                2818
imagickdraw.settextundercolor.php                  17-Jul-2024 20:07                7765
imagickdraw.setvectorgraphics.php                  17-Jul-2024 20:07                8934
imagickdraw.setviewbox.php                         17-Jul-2024 20:07               10310
imagickdraw.skewx.php                              17-Jul-2024 20:07                8131
imagickdraw.skewy.php                              17-Jul-2024 20:07                8120
imagickdraw.translate.php                          17-Jul-2024 20:07                8458
imagickkernel.addkernel.php                        17-Jul-2024 20:07                7046
imagickkernel.addunitykernel.php                   17-Jul-2024 20:07               13694
imagickkernel.frombuiltin.php                      17-Jul-2024 20:07               26251
imagickkernel.frommatrix.php                       17-Jul-2024 20:07               23183
imagickkernel.getmatrix.php                        17-Jul-2024 20:07                7091
imagickkernel.scale.php                            17-Jul-2024 20:07               13213
imagickkernel.separate.php                         17-Jul-2024 20:07                9706
imagickpixel.clear.php                             17-Jul-2024 20:07                2364
imagickpixel.construct.php                         17-Jul-2024 20:07               11799
imagickpixel.destroy.php                           17-Jul-2024 20:07                2453
imagickpixel.getcolor.php                          17-Jul-2024 20:07                7883
imagickpixel.getcolorasstring.php                  17-Jul-2024 20:07                4852
imagickpixel.getcolorcount.php                     17-Jul-2024 20:07                4920
imagickpixel.getcolorquantum.php                   17-Jul-2024 20:07                2855
imagickpixel.getcolorvalue.php                     17-Jul-2024 20:07                8654
imagickpixel.getcolorvaluequantum.php              17-Jul-2024 20:07                6107
imagickpixel.gethsl.php                            17-Jul-2024 20:07                4355
imagickpixel.getindex.php                          17-Jul-2024 20:07                2278
imagickpixel.ispixelsimilar.php                    17-Jul-2024 20:07                3636
imagickpixel.ispixelsimilarquantum.php             17-Jul-2024 20:07                3242
imagickpixel.issimilar.php                         17-Jul-2024 20:07               16508
imagickpixel.setcolor.php                          17-Jul-2024 20:07                7477
imagickpixel.setcolorcount.php                     17-Jul-2024 20:07                2688
imagickpixel.setcolorvalue.php                     17-Jul-2024 20:07                5172
imagickpixel.setcolorvaluequantum.php              17-Jul-2024 20:07                8436
imagickpixel.sethsl.php                            17-Jul-2024 20:07                7528
imagickpixel.setindex.php                          17-Jul-2024 20:07                2617
imagickpixeliterator.clear.php                     17-Jul-2024 20:07                6287
imagickpixeliterator.construct.php                 17-Jul-2024 20:07                5960
imagickpixeliterator.destroy.php                   17-Jul-2024 20:07                2494
imagickpixeliterator.getcurrentiteratorrow.php     17-Jul-2024 20:07                2602
imagickpixeliterator.getiteratorrow.php            17-Jul-2024 20:07                2527
imagickpixeliterator.getnextiteratorrow.php        17-Jul-2024 20:07                6719
imagickpixeliterator.getpreviousiteratorrow.php    17-Jul-2024 20:07                2671
imagickpixeliterator.newpixeliterator.php          17-Jul-2024 20:07                2747
imagickpixeliterator.newpixelregioniterator.php    17-Jul-2024 20:07                4260
imagickpixeliterator.resetiterator.php             17-Jul-2024 20:07                8695
imagickpixeliterator.setiteratorfirstrow.php       17-Jul-2024 20:07                2588
imagickpixeliterator.setiteratorlastrow.php        17-Jul-2024 20:07                2581
imagickpixeliterator.setiteratorrow.php            17-Jul-2024 20:07                7098
imagickpixeliterator.synciterator.php              17-Jul-2024 20:07                2436
imap.configuration.php                             17-Jul-2024 20:07                3138
imap.constants.php                                 17-Jul-2024 20:07               24770
imap.installation.php                              17-Jul-2024 20:07                2587
imap.requirements.php                              17-Jul-2024 20:07                3018
imap.resources.php                                 17-Jul-2024 20:07                1388
imap.setup.php                                     17-Jul-2024 20:07                1549
index.php                                          17-Jul-2024 20:07               12872
indexes.examples.php                               17-Jul-2024 20:07              706330
indexes.functions.php                              17-Jul-2024 20:07             1139947
indexes.php                                        17-Jul-2024 20:07                1430
infiniteiterator.construct.php                     17-Jul-2024 20:07                5054
infiniteiterator.next.php                          17-Jul-2024 20:07                3282
info.configuration.php                             17-Jul-2024 20:07               12494
info.constants.php                                 17-Jul-2024 20:07               22744
info.resources.php                                 17-Jul-2024 20:07                1172
info.setup.php                                     17-Jul-2024 20:07                1441
ini.core.php                                       17-Jul-2024 20:07               68567
ini.list.php                                       17-Jul-2024 20:07              104760
ini.php                                            17-Jul-2024 20:07                1551
ini.sections.php                                   17-Jul-2024 20:07                3883
inotify.constants.php                              17-Jul-2024 20:07               10303
inotify.install.php                                17-Jul-2024 20:07                1666
inotify.requirements.php                           17-Jul-2024 20:07                1220
inotify.resources.php                              17-Jul-2024 20:07                1298
inotify.setup.php                                  17-Jul-2024 20:07                1505
install.cloud.azure.php                            17-Jul-2024 20:07                3786
install.cloud.digitalocean.php                     17-Jul-2024 20:07                2997
install.cloud.ec2.php                              17-Jul-2024 20:07                1419
install.cloud.php                                  17-Jul-2024 20:07                1684
install.fpm.configuration.php                      17-Jul-2024 20:07               33992
install.fpm.install.php                            17-Jul-2024 20:07                3307
install.fpm.php                                    17-Jul-2024 20:07                3634
install.general.php                                17-Jul-2024 20:07                3948
install.macosx.bundled.php                         17-Jul-2024 20:07                9956
install.macosx.compile.php                         17-Jul-2024 20:07                1342
install.macosx.packages.php                        17-Jul-2024 20:07                2838
install.macosx.php                                 17-Jul-2024 20:07                1883
install.pecl.downloads.php                         17-Jul-2024 20:07                3270
install.pecl.intro.php                             17-Jul-2024 20:07                2733
install.pecl.pear.php                              17-Jul-2024 20:07                2798
install.pecl.php                                   17-Jul-2024 20:07                1879
install.pecl.php-config.php                        17-Jul-2024 20:07                3845
install.pecl.phpize.php                            17-Jul-2024 20:07                2738
install.pecl.static.php                            17-Jul-2024 20:07                3207
install.pecl.windows.php                           17-Jul-2024 20:07                8403
install.php                                        17-Jul-2024 20:07                5334
install.problems.bugs.php                          17-Jul-2024 20:07                1850
install.problems.faq.php                           17-Jul-2024 20:07                1323
install.problems.php                               17-Jul-2024 20:07                1563
install.problems.support.php                       17-Jul-2024 20:07                2185
install.unix.apache2.php                           17-Jul-2024 20:07               11793
install.unix.commandline.php                       17-Jul-2024 20:07                3626
install.unix.debian.php                            17-Jul-2024 20:07                6279
install.unix.lighttpd-14.php                       17-Jul-2024 20:07                5757
install.unix.litespeed.php                         17-Jul-2024 20:07                8446
install.unix.nginx.php                             17-Jul-2024 20:07                8000
install.unix.openbsd.php                           17-Jul-2024 20:07                5598
install.unix.php                                   17-Jul-2024 20:07                7070
install.unix.solaris.php                           17-Jul-2024 20:07                3692
install.windows.apache2.php                        17-Jul-2024 20:07                6456
install.windows.building.php                       17-Jul-2024 20:07                1659
install.windows.commandline.php                    17-Jul-2024 20:07                7668
install.windows.manual.php                         17-Jul-2024 20:07                5444
install.windows.pecl.php                           17-Jul-2024 20:07                1602
install.windows.php                                17-Jul-2024 20:07                3073
install.windows.recommended.php                    17-Jul-2024 20:07                4584
install.windows.requirements.php                   17-Jul-2024 20:07                2210
install.windows.tools.php                          17-Jul-2024 20:07                1770
install.windows.troubleshooting.php                17-Jul-2024 20:07                1664
internaliterator.construct.php                     17-Jul-2024 20:07                1967
internaliterator.current.php                       17-Jul-2024 20:07                2259
internaliterator.key.php                           17-Jul-2024 20:07                2233
internaliterator.next.php                          17-Jul-2024 20:07                2245
internaliterator.rewind.php                        17-Jul-2024 20:07                2265
internaliterator.valid.php                         17-Jul-2024 20:07                2250
intl.configuration.php                             17-Jul-2024 20:07                5255
intl.constants.php                                 17-Jul-2024 20:07               70651
intl.examples.basic.php                            17-Jul-2024 20:07                4370
intl.examples.php                                  17-Jul-2024 20:07                1405
intl.installation.php                              17-Jul-2024 20:07                1736
intl.requirements.php                              17-Jul-2024 20:07                1345
intl.resources.php                                 17-Jul-2024 20:07                1172
intl.setup.php                                     17-Jul-2024 20:07                1547
intlbreakiterator.construct.php                    17-Jul-2024 20:07                4050
intlbreakiterator.createcharacterinstance.php      17-Jul-2024 20:07                3313
intlbreakiterator.createcodepointinstance.php      17-Jul-2024 20:07                2743
intlbreakiterator.createlineinstance.php           17-Jul-2024 20:07                3274
intlbreakiterator.createsentenceinstance.php       17-Jul-2024 20:07                3276
intlbreakiterator.createtitleinstance.php          17-Jul-2024 20:07                3256
intlbreakiterator.createwordinstance.php           17-Jul-2024 20:07                3210
intlbreakiterator.current.php                      17-Jul-2024 20:07                2432
intlbreakiterator.first.php                        17-Jul-2024 20:07                2416
intlbreakiterator.following.php                    17-Jul-2024 20:07                2731
intlbreakiterator.geterrorcode.php                 17-Jul-2024 20:07                2955
intlbreakiterator.geterrormessage.php              17-Jul-2024 20:07                3004
intlbreakiterator.getlocale.php                    17-Jul-2024 20:07                2841
intlbreakiterator.getpartsiterator.php             17-Jul-2024 20:07                3668
intlbreakiterator.gettext.php                      17-Jul-2024 20:07                2549
intlbreakiterator.isboundary.php                   17-Jul-2024 20:07                2701
intlbreakiterator.last.php                         17-Jul-2024 20:07                2415
intlbreakiterator.next.php                         17-Jul-2024 20:07                2865
intlbreakiterator.preceding.php                    17-Jul-2024 20:07                2709
intlbreakiterator.previous.php                     17-Jul-2024 20:07                2471
intlbreakiterator.settext.php                      17-Jul-2024 20:07                3560
intlcalendar.add.php                               17-Jul-2024 20:07                8828
intlcalendar.after.php                             17-Jul-2024 20:07                6834
intlcalendar.before.php                            17-Jul-2024 20:07                4210
intlcalendar.clear.php                             17-Jul-2024 20:07               19075
intlcalendar.construct.php                         17-Jul-2024 20:07                2338
intlcalendar.createinstance.php                    17-Jul-2024 20:07               13570
intlcalendar.equals.php                            17-Jul-2024 20:07               10929
intlcalendar.fielddifference.php                   17-Jul-2024 20:07               11354
intlcalendar.fromdatetime.php                      17-Jul-2024 20:07                8046
intlcalendar.get.php                               17-Jul-2024 20:07                8852
intlcalendar.getactualmaximum.php                  17-Jul-2024 20:07                8753
intlcalendar.getactualminimum.php                  17-Jul-2024 20:07                5937
intlcalendar.getavailablelocales.php               17-Jul-2024 20:07                4439
intlcalendar.getdayofweektype.php                  17-Jul-2024 20:07               10677
intlcalendar.geterrorcode.php                      17-Jul-2024 20:07                9143
intlcalendar.geterrormessage.php                   17-Jul-2024 20:07                6192
intlcalendar.getfirstdayofweek.php                 17-Jul-2024 20:07                8766
intlcalendar.getgreatestminimum.php                17-Jul-2024 20:07                4826
intlcalendar.getkeywordvaluesforlocale.php         17-Jul-2024 20:07                7528
intlcalendar.getleastmaximum.php                   17-Jul-2024 20:07                8400
intlcalendar.getlocale.php                         17-Jul-2024 20:07                6357
intlcalendar.getmaximum.php                        17-Jul-2024 20:07                5470
intlcalendar.getminimaldaysinfirstweek.php         17-Jul-2024 20:07                9065
intlcalendar.getminimum.php                        17-Jul-2024 20:07                4770
intlcalendar.getnow.php                            17-Jul-2024 20:07                5356
intlcalendar.getrepeatedwalltimeoption.php         17-Jul-2024 20:07               10339
intlcalendar.getskippedwalltimeoption.php          17-Jul-2024 20:07               12678
intlcalendar.gettime.php                           17-Jul-2024 20:07                6619
intlcalendar.gettimezone.php                       17-Jul-2024 20:07                7576
intlcalendar.gettype.php                           17-Jul-2024 20:07                5761
intlcalendar.getweekendtransition.php              17-Jul-2024 20:07                5432
intlcalendar.indaylighttime.php                    17-Jul-2024 20:07                8758
intlcalendar.isequivalentto.php                    17-Jul-2024 20:07                8500
intlcalendar.islenient.php                         17-Jul-2024 20:07                8407
intlcalendar.isset.php                             17-Jul-2024 20:07                4862
intlcalendar.isweekend.php                         17-Jul-2024 20:07                9000
intlcalendar.roll.php                              17-Jul-2024 20:07                9536
intlcalendar.set.php                               17-Jul-2024 20:07               16044
intlcalendar.setdate.php                           17-Jul-2024 20:07                4876
intlcalendar.setdatetime.php                       17-Jul-2024 20:07                6799
intlcalendar.setfirstdayofweek.php                 17-Jul-2024 20:07                8901
intlcalendar.setlenient.php                        17-Jul-2024 20:07                5089
intlcalendar.setminimaldaysinfirstweek.php         17-Jul-2024 20:07                5433
intlcalendar.setrepeatedwalltimeoption.php         17-Jul-2024 20:07                6551
intlcalendar.setskippedwalltimeoption.php          17-Jul-2024 20:07                7418
intlcalendar.settime.php                           17-Jul-2024 20:07                8739
intlcalendar.settimezone.php                       17-Jul-2024 20:07               11310
intlcalendar.todatetime.php                        17-Jul-2024 20:07                7185
intlchar.charage.php                               17-Jul-2024 20:07                5898
intlchar.chardigitvalue.php                        17-Jul-2024 20:07                5559
intlchar.chardirection.php                         17-Jul-2024 20:07               10720
intlchar.charfromname.php                          17-Jul-2024 20:07                7284
intlchar.charmirror.php                            17-Jul-2024 20:07                6577
intlchar.charname.php                              17-Jul-2024 20:07                7670
intlchar.chartype.php                              17-Jul-2024 20:07               11611
intlchar.chr.php                                   17-Jul-2024 20:07                5628
intlchar.digit.php                                 17-Jul-2024 20:07                8381
intlchar.enumcharnames.php                         17-Jul-2024 20:07                9091
intlchar.enumchartypes.php                         17-Jul-2024 20:07                5844
intlchar.foldcase.php                              17-Jul-2024 20:07                4101
intlchar.fordigit.php                              17-Jul-2024 20:07                7111
intlchar.getbidipairedbracket.php                  17-Jul-2024 20:07                6337
intlchar.getblockcode.php                          17-Jul-2024 20:07                5624
intlchar.getcombiningclass.php                     17-Jul-2024 20:07                4968
intlchar.getfc-nfkc-closure.php                    17-Jul-2024 20:07                4989
intlchar.getintpropertymaxvalue.php                17-Jul-2024 20:07                6388
intlchar.getintpropertyminvalue.php                17-Jul-2024 20:07                6381
intlchar.getintpropertyvalue.php                   17-Jul-2024 20:07                8092
intlchar.getnumericvalue.php                       17-Jul-2024 20:07                5674
intlchar.getpropertyenum.php                       17-Jul-2024 20:07                6735
intlchar.getpropertyname.php                       17-Jul-2024 20:07                9086
intlchar.getpropertyvalueenum.php                  17-Jul-2024 20:07                7992
intlchar.getpropertyvaluename.php                  17-Jul-2024 20:07               10907
intlchar.getunicodeversion.php                     17-Jul-2024 20:07                3963
intlchar.hasbinaryproperty.php                     17-Jul-2024 20:07                9053
intlchar.isalnum.php                               17-Jul-2024 20:07                5983
intlchar.isalpha.php                               17-Jul-2024 20:07                5862
intlchar.isbase.php                                17-Jul-2024 20:07                6188
intlchar.isblank.php                               17-Jul-2024 20:07                6854
intlchar.iscntrl.php                               17-Jul-2024 20:07                6934
intlchar.isdefined.php                             17-Jul-2024 20:07                6865
intlchar.isdigit.php                               17-Jul-2024 20:07                6185
intlchar.isgraph.php                               17-Jul-2024 20:07                6122
intlchar.isidignorable.php                         17-Jul-2024 20:07                6397
intlchar.isidpart.php                              17-Jul-2024 20:07                7038
intlchar.isidstart.php                             17-Jul-2024 20:07                6467
intlchar.isisocontrol.php                          17-Jul-2024 20:07                5674
intlchar.isjavaidpart.php                          17-Jul-2024 20:07                6959
intlchar.isjavaidstart.php                         17-Jul-2024 20:07                6689
intlchar.isjavaspacechar.php                       17-Jul-2024 20:07                6922
intlchar.islower.php                               17-Jul-2024 20:07                7338
intlchar.ismirrored.php                            17-Jul-2024 20:07                5798
intlchar.isprint.php                               17-Jul-2024 20:07                6259
intlchar.ispunct.php                               17-Jul-2024 20:07                5896
intlchar.isspace.php                               17-Jul-2024 20:07                6667
intlchar.istitle.php                               17-Jul-2024 20:07                7564
intlchar.isualphabetic.php                         17-Jul-2024 20:07                6011
intlchar.isulowercase.php                          17-Jul-2024 20:07                7043
intlchar.isupper.php                               17-Jul-2024 20:07                7336
intlchar.isuuppercase.php                          17-Jul-2024 20:07                7081
intlchar.isuwhitespace.php                         17-Jul-2024 20:07                7503
intlchar.iswhitespace.php                          17-Jul-2024 20:07                7396
intlchar.isxdigit.php                              17-Jul-2024 20:07                7255
intlchar.ord.php                                   17-Jul-2024 20:07                5480
intlchar.tolower.php                               17-Jul-2024 20:07                7743
intlchar.totitle.php                               17-Jul-2024 20:07                7894
intlchar.toupper.php                               17-Jul-2024 20:07                7635
intlcodepointbreakiterator.getlastcodepoint.php    17-Jul-2024 20:07                2674
intldateformatter.create.php                       17-Jul-2024 20:07               29291
intldateformatter.format.php                       17-Jul-2024 20:07               26604
intldateformatter.formatobject.php                 17-Jul-2024 20:07               14677
intldateformatter.getcalendar.php                  17-Jul-2024 20:07               11169
intldateformatter.getcalendarobject.php            17-Jul-2024 20:07                7651
intldateformatter.getdatetype.php                  17-Jul-2024 20:07               11615
intldateformatter.geterrorcode.php                 17-Jul-2024 20:07                8579
intldateformatter.geterrormessage.php              17-Jul-2024 20:07                8557
intldateformatter.getlocale.php                    17-Jul-2024 20:07               12287
intldateformatter.getpattern.php                   17-Jul-2024 20:07               10340
intldateformatter.gettimetype.php                  17-Jul-2024 20:07               11609
intldateformatter.gettimezone.php                  17-Jul-2024 20:07                8653
intldateformatter.gettimezoneid.php                17-Jul-2024 20:07                8897
intldateformatter.islenient.php                    17-Jul-2024 20:07               14702
intldateformatter.localtime.php                    17-Jul-2024 20:07               11561
intldateformatter.parse.php                        17-Jul-2024 20:07               12426
intldateformatter.setcalendar.php                  17-Jul-2024 20:07               14450
intldateformatter.setlenient.php                   17-Jul-2024 20:07               15543
intldateformatter.setpattern.php                   17-Jul-2024 20:07               11566
intldateformatter.settimezone.php                  17-Jul-2024 20:07               12523
intldatepatterngenerator.create.php                17-Jul-2024 20:07                4407
intldatepatterngenerator.getbestpattern.php        17-Jul-2024 20:07                6916
intlgregoriancalendar.construct.php                17-Jul-2024 20:07                5634
intlgregoriancalendar.createfromdate.php           17-Jul-2024 20:07                7403
intlgregoriancalendar.createfromdatetime.php       17-Jul-2024 20:07                9112
intlgregoriancalendar.getgregorianchange.php       17-Jul-2024 20:07                2654
intlgregoriancalendar.isleapyear.php               17-Jul-2024 20:07                3033
intlgregoriancalendar.setgregorianchange.php       17-Jul-2024 20:07                3055
intliterator.current.php                           17-Jul-2024 20:07                2306
intliterator.key.php                               17-Jul-2024 20:07                2275
intliterator.next.php                              17-Jul-2024 20:07                2291
intliterator.rewind.php                            17-Jul-2024 20:07                2319
intliterator.valid.php                             17-Jul-2024 20:07                2292
intlpartsiterator.getbreakiterator.php             17-Jul-2024 20:07                2517
intlrulebasedbreakiterator.construct.php           17-Jul-2024 20:07                3167
intlrulebasedbreakiterator.getbinaryrules.php      17-Jul-2024 20:07                2774
intlrulebasedbreakiterator.getrules.php            17-Jul-2024 20:07                2738
intlrulebasedbreakiterator.getrulestatus.php       17-Jul-2024 20:07                2710
intlrulebasedbreakiterator.getrulestatusvec.php    17-Jul-2024 20:07                2832
intltimezone.construct.php                         17-Jul-2024 20:07                1979
intltimezone.countequivalentids.php                17-Jul-2024 20:07                3649
intltimezone.createdefault.php                     17-Jul-2024 20:07                2962
intltimezone.createenumeration.php                 17-Jul-2024 20:07                4735
intltimezone.createtimezone.php                    17-Jul-2024 20:07                3625
intltimezone.createtimezoneidenumeration.php       17-Jul-2024 20:07                5810
intltimezone.fromdatetimezone.php                  17-Jul-2024 20:07                3746
intltimezone.getcanonicalid.php                    17-Jul-2024 20:07                4372
intltimezone.getdisplayname.php                    17-Jul-2024 20:07                5553
intltimezone.getdstsavings.php                     17-Jul-2024 20:07                3094
intltimezone.getequivalentid.php                   17-Jul-2024 20:07                4055
intltimezone.geterrorcode.php                      17-Jul-2024 20:07                3266
intltimezone.geterrormessage.php                   17-Jul-2024 20:07                3294
intltimezone.getgmt.php                            17-Jul-2024 20:07                2811
intltimezone.getid.php                             17-Jul-2024 20:07                3146
intltimezone.getidforwindowsid.php                 17-Jul-2024 20:07                5803
intltimezone.getoffset.php                         17-Jul-2024 20:07                5073
intltimezone.getrawoffset.php                      17-Jul-2024 20:07                3045
intltimezone.getregion.php                         17-Jul-2024 20:07                3651
intltimezone.gettzdataversion.php                  17-Jul-2024 20:07                3185
intltimezone.getunknown.php                        17-Jul-2024 20:07                3077
intltimezone.getwindowsid.php                      17-Jul-2024 20:07                4388
intltimezone.hassamerules.php                      17-Jul-2024 20:07                3487
intltimezone.todatetimezone.php                    17-Jul-2024 20:07                3395
intltimezone.usedaylighttime.php                   17-Jul-2024 20:07                3071
intro-whatcando.php                                17-Jul-2024 20:07                7525
intro-whatis.php                                   17-Jul-2024 20:07                4019
intro.apache.php                                   17-Jul-2024 20:07                1160
intro.apcu.php                                     17-Jul-2024 20:07                1807
intro.array.php                                    17-Jul-2024 20:07                1795
intro.bc.php                                       17-Jul-2024 20:07                4457
intro.bzip2.php                                    17-Jul-2024 20:07                1157
intro.calendar.php                                 17-Jul-2024 20:07                1923
intro.classobj.php                                 17-Jul-2024 20:07                1614
intro.cmark.php                                    17-Jul-2024 20:07                7336
intro.com.php                                      17-Jul-2024 20:07                2838
intro.componere.php                                17-Jul-2024 20:07                6662
intro.ctype.php                                    17-Jul-2024 20:07                3620
intro.cubrid.php                                   17-Jul-2024 20:07                1463
intro.curl.php                                     17-Jul-2024 20:07                1474
intro.datetime.php                                 17-Jul-2024 20:07                2441
intro.dba.php                                      17-Jul-2024 20:07                1489
intro.dbase.php                                    17-Jul-2024 20:07                6746
intro.dio.php                                      17-Jul-2024 20:07                1596
intro.dom.php                                      17-Jul-2024 20:07                1666
intro.ds.php                                       17-Jul-2024 20:07                1412
intro.eio.php                                      17-Jul-2024 20:07               14400
intro.enchant.php                                  17-Jul-2024 20:07                2602
intro.errorfunc.php                                17-Jul-2024 20:07                1739
intro.ev.php                                       17-Jul-2024 20:07                2253
intro.event.php                                    17-Jul-2024 20:07                1876
intro.exec.php                                     17-Jul-2024 20:07                1716
intro.exif.php                                     17-Jul-2024 20:07                1421
intro.expect.php                                   17-Jul-2024 20:07                1423
intro.fann.php                                     17-Jul-2024 20:07                1343
intro.fdf.php                                      17-Jul-2024 20:07                3818
intro.ffi.php                                      17-Jul-2024 20:07                2534
intro.fileinfo.php                                 17-Jul-2024 20:07                1358
intro.filesystem.php                               17-Jul-2024 20:07                1381
intro.filter.php                                   17-Jul-2024 20:07                2665
intro.fpm.php                                      17-Jul-2024 20:07                1287
intro.ftp.php                                      17-Jul-2024 20:07                1668
intro.funchand.php                                 17-Jul-2024 20:07                1170
intro.gearman.php                                  17-Jul-2024 20:07                1653
intro.gender.php                                   17-Jul-2024 20:07                1321
intro.geoip.php                                    17-Jul-2024 20:07                1494
intro.gettext.php                                  17-Jul-2024 20:07                1485
intro.gmagick.php                                  17-Jul-2024 20:07                1683
intro.gmp.php                                      17-Jul-2024 20:07                2994
intro.gnupg.php                                    17-Jul-2024 20:07                1210
intro.hash.php                                     17-Jul-2024 20:07                1193
intro.hrtime.php                                   17-Jul-2024 20:07                1655
intro.ibase.php                                    17-Jul-2024 20:07                3145
intro.ibm-db2.php                                  17-Jul-2024 20:07                1270
intro.iconv.php                                    17-Jul-2024 20:07                1811
intro.igbinary.php                                 17-Jul-2024 20:07                1665
intro.image.php                                    17-Jul-2024 20:07                6858
intro.imagick.php                                  17-Jul-2024 20:07                1733
intro.imap.php                                     17-Jul-2024 20:07                1610
intro.info.php                                     17-Jul-2024 20:07                1447
intro.inotify.php                                  17-Jul-2024 20:07                2373
intro.intl.php                                     17-Jul-2024 20:07                5004
intro.json.php                                     17-Jul-2024 20:07                1573
intro.ldap.php                                     17-Jul-2024 20:07                4070
intro.libxml.php                                   17-Jul-2024 20:07                1762
intro.lua.php                                      17-Jul-2024 20:07                1253
intro.luasandbox.php                               17-Jul-2024 20:07                2355
intro.lzf.php                                      17-Jul-2024 20:07                1411
intro.mail.php                                     17-Jul-2024 20:07                1197
intro.mailparse.php                                17-Jul-2024 20:07                1929
intro.math.php                                     17-Jul-2024 20:07                1901
intro.mbstring.php                                 17-Jul-2024 20:07                2654
intro.mcrypt.php                                   17-Jul-2024 20:07                2210
intro.memcache.php                                 17-Jul-2024 20:07                1653
intro.memcached.php                                17-Jul-2024 20:07                1893
intro.mhash.php                                    17-Jul-2024 20:07                2832
intro.misc.php                                     17-Jul-2024 20:07                1151
intro.mqseries.php                                 17-Jul-2024 20:07                1734
intro.mysql-xdevapi.php                            17-Jul-2024 20:07                1870
intro.mysql.php                                    17-Jul-2024 20:07                1885
intro.mysqli.php                                   17-Jul-2024 20:07                2049
intro.mysqlnd.php                                  17-Jul-2024 20:07                1945
intro.network.php                                  17-Jul-2024 20:07                1139
intro.oauth.php                                    17-Jul-2024 20:07                1291
intro.oci8.php                                     17-Jul-2024 20:07                1387
intro.opcache.php                                  17-Jul-2024 20:07                1578
intro.openal.php                                   17-Jul-2024 20:07                1243
intro.openssl.php                                  17-Jul-2024 20:07                1477
intro.outcontrol.php                               17-Jul-2024 20:07                1720
intro.parallel.php                                 17-Jul-2024 20:07                6481
intro.parle.php                                    17-Jul-2024 20:07                3429
intro.password.php                                 17-Jul-2024 20:07                1364
intro.pcntl.php                                    17-Jul-2024 20:07                2355
intro.pcre.php                                     17-Jul-2024 20:07                2465
intro.pdo.php                                      17-Jul-2024 20:07                1891
intro.pgsql.php                                    17-Jul-2024 20:07                1495
intro.phar.php                                     17-Jul-2024 20:07                9157
intro.phpdbg.php                                   17-Jul-2024 20:07                6031
intro.posix.php                                    17-Jul-2024 20:07                1701
intro.ps.php                                       17-Jul-2024 20:07                1752
intro.pspell.php                                   17-Jul-2024 20:07                1185
intro.pthreads.php                                 17-Jul-2024 20:07                9479
intro.quickhash.php                                17-Jul-2024 20:07                1257
intro.radius.php                                   17-Jul-2024 20:07                2157
intro.random.php                                   17-Jul-2024 20:07                1099
intro.rar.php                                      17-Jul-2024 20:07                1531
intro.readline.php                                 17-Jul-2024 20:07                1852
intro.recode.php                                   17-Jul-2024 20:07                2245
intro.reflection.php                               17-Jul-2024 20:07                1655
intro.rnp.php                                      17-Jul-2024 20:07                1270
intro.rpminfo.php                                  17-Jul-2024 20:07                1387
intro.rrd.php                                      17-Jul-2024 20:07                1365
intro.runkit7.php                                  17-Jul-2024 20:07                1469
intro.scoutapm.php                                 17-Jul-2024 20:07                1446
intro.seaslog.php                                  17-Jul-2024 20:07                3418
intro.sem.php                                      17-Jul-2024 20:07                3215
intro.session.php                                  17-Jul-2024 20:07                4645
intro.shmop.php                                    17-Jul-2024 20:07                1231
intro.simdjson.php                                 17-Jul-2024 20:07                1219
intro.simplexml.php                                17-Jul-2024 20:07                1273
intro.snmp.php                                     17-Jul-2024 20:07                1565
intro.soap.php                                     17-Jul-2024 20:07                1433
intro.sockets.php                                  17-Jul-2024 20:07                2364
intro.sodium.php                                   17-Jul-2024 20:07                1320
intro.solr.php                                     17-Jul-2024 20:07                1645
intro.spl.php                                      17-Jul-2024 20:07                1490
intro.sqlite3.php                                  17-Jul-2024 20:07                1140
intro.sqlsrv.php                                   17-Jul-2024 20:07                2156
intro.ssdeep.php                                   17-Jul-2024 20:07                1746
intro.ssh2.php                                     17-Jul-2024 20:07                1331
intro.stats.php                                    17-Jul-2024 20:07                1501
intro.stomp.php                                    17-Jul-2024 20:07                1334
intro.stream.php                                   17-Jul-2024 20:07                3650
intro.strings.php                                  17-Jul-2024 20:07                1580
intro.svm.php                                      17-Jul-2024 20:07                1215
intro.svn.php                                      17-Jul-2024 20:07                1689
intro.swoole.php                                   17-Jul-2024 20:07                1619
intro.sync.php                                     17-Jul-2024 20:07                2344
intro.taint.php                                    17-Jul-2024 20:07                4278
intro.tcpwrap.php                                  17-Jul-2024 20:07                1261
intro.tidy.php                                     17-Jul-2024 20:07                1399
intro.tokenizer.php                                17-Jul-2024 20:07                1422
intro.trader.php                                   17-Jul-2024 20:07                2378
intro.ui.php                                       17-Jul-2024 20:07                1191
intro.uodbc.php                                    17-Jul-2024 20:07                2748
intro.uopz.php                                     17-Jul-2024 20:07                2273
intro.url.php                                      17-Jul-2024 20:07                1124
intro.v8js.php                                     17-Jul-2024 20:07                1218
intro.var.php                                      17-Jul-2024 20:07                1260
intro.var_representation.php                       17-Jul-2024 20:07                1419
intro.varnish.php                                  17-Jul-2024 20:07                1308
intro.wddx.php                                     17-Jul-2024 20:07                2135
intro.win32service.php                             17-Jul-2024 20:07                1391
intro.wincache.php                                 17-Jul-2024 20:07                4855
intro.wkhtmltox.php                                17-Jul-2024 20:07                1267
intro.xattr.php                                    17-Jul-2024 20:07                1180
intro.xdiff.php                                    17-Jul-2024 20:07                2602
intro.xhprof.php                                   17-Jul-2024 20:07                2531
intro.xlswriter.php                                17-Jul-2024 20:07                1179
intro.xml.php                                      17-Jul-2024 20:07                2185
intro.xmldiff.php                                  17-Jul-2024 20:07                1401
intro.xmlreader.php                                17-Jul-2024 20:07                1575
intro.xmlrpc.php                                   17-Jul-2024 20:07                1801
intro.xmlwriter.php                                17-Jul-2024 20:07                1537
intro.xsl.php                                      17-Jul-2024 20:07                1328
intro.yac.php                                      17-Jul-2024 20:07                1192
intro.yaconf.php                                   17-Jul-2024 20:07                2557
intro.yaf.php                                      17-Jul-2024 20:07                1505
intro.yaml.php                                     17-Jul-2024 20:07                1371
intro.yar.php                                      17-Jul-2024 20:07                1328
intro.yaz.php                                      17-Jul-2024 20:07                2492
intro.zip.php                                      17-Jul-2024 20:07                1152
intro.zlib.php                                     17-Jul-2024 20:07                1642
intro.zmq.php                                      17-Jul-2024 20:07                1346
intro.zookeeper.php                                17-Jul-2024 20:07                1438
introduction.php                                   17-Jul-2024 20:07                1440
iterator.current.php                               17-Jul-2024 20:07                2128
iterator.key.php                                   17-Jul-2024 20:07                2505
iterator.next.php                                  17-Jul-2024 20:07                2373
iterator.rewind.php                                17-Jul-2024 20:07                2551
iterator.valid.php                                 17-Jul-2024 20:07                2720
iteratoraggregate.getiterator.php                  17-Jul-2024 20:07                2825
iteratoriterator.construct.php                     17-Jul-2024 20:07                3453
iteratoriterator.current.php                       17-Jul-2024 20:07                2707
iteratoriterator.getinneriterator.php              17-Jul-2024 20:07                3154
iteratoriterator.key.php                           17-Jul-2024 20:07                2655
iteratoriterator.next.php                          17-Jul-2024 20:07                2809
iteratoriterator.rewind.php                        17-Jul-2024 20:07                2828
iteratoriterator.valid.php                         17-Jul-2024 20:07                3026
json.constants.php                                 17-Jul-2024 20:07               16817
json.installation.php                              17-Jul-2024 20:07                1679
json.requirements.php                              17-Jul-2024 20:07                1184
json.resources.php                                 17-Jul-2024 20:07                1162
json.setup.php                                     17-Jul-2024 20:07                1455
jsonserializable.jsonserialize.php                 17-Jul-2024 20:07               12489
langref.php                                        17-Jul-2024 20:07               19788
language.attributes.classes.php                    17-Jul-2024 20:07                6287
language.attributes.overview.php                   17-Jul-2024 20:07                9868
language.attributes.php                            17-Jul-2024 20:07                1682
language.attributes.reflection.php                 17-Jul-2024 20:07                7904
language.attributes.syntax.php                     17-Jul-2024 20:07                5901
language.basic-syntax.comments.php                 17-Jul-2024 20:07                3711
language.basic-syntax.instruction-separation.php   17-Jul-2024 20:07                3908
language.basic-syntax.php                          17-Jul-2024 20:07                1649
language.basic-syntax.phpmode.php                  17-Jul-2024 20:07                4255
language.basic-syntax.phptags.php                  17-Jul-2024 20:07                4565
language.constants.magic.php                       17-Jul-2024 20:07                5132
language.constants.php                             17-Jul-2024 20:07                5929
language.constants.predefined.php                  17-Jul-2024 20:07                1488
language.constants.syntax.php                      17-Jul-2024 20:07                9913
language.control-structures.php                    17-Jul-2024 20:07                2739
language.enumerations.backed.php                   17-Jul-2024 20:07                9494
language.enumerations.basics.php                   17-Jul-2024 20:07                7913
language.enumerations.constants.php                17-Jul-2024 20:07                2340
language.enumerations.examples.php                 17-Jul-2024 20:07                7193
language.enumerations.expressions.php              17-Jul-2024 20:07                6435
language.enumerations.listing.php                  17-Jul-2024 20:07                2226
language.enumerations.methods.php                  17-Jul-2024 20:07               13374
language.enumerations.object-differences.inheri..> 17-Jul-2024 20:07                5882
language.enumerations.object-differences.php       17-Jul-2024 20:07                4545
language.enumerations.overview.php                 17-Jul-2024 20:07                2210
language.enumerations.php                          17-Jul-2024 20:07                2370
language.enumerations.serialization.php            17-Jul-2024 20:07                4743
language.enumerations.static-methods.php           17-Jul-2024 20:07                3170
language.enumerations.traits.php                   17-Jul-2024 20:07                4254
language.errors.basics.php                         17-Jul-2024 20:07                4560
language.errors.php                                17-Jul-2024 20:07                1823
language.errors.php7.php                           17-Jul-2024 20:07                5823
language.exceptions.extending.php                  17-Jul-2024 20:07               19437
language.exceptions.php                            17-Jul-2024 20:07               26488
language.expressions.php                           17-Jul-2024 20:07               13724
language.fibers.php                                17-Jul-2024 20:07                6160
language.functions.php                             17-Jul-2024 20:07                1905
language.generators.comparison.php                 17-Jul-2024 20:07                8762
language.generators.overview.php                   17-Jul-2024 20:07                8834
language.generators.php                            17-Jul-2024 20:07                1580
language.generators.syntax.php                     17-Jul-2024 20:07               23273
language.namespaces.basics.php                     17-Jul-2024 20:07               10721
language.namespaces.definition.php                 17-Jul-2024 20:07                4132
language.namespaces.definitionmultiple.php         17-Jul-2024 20:07                8965
language.namespaces.dynamic.php                    17-Jul-2024 20:07                7999
language.namespaces.fallback.php                   17-Jul-2024 20:07                5870
language.namespaces.faq.php                        17-Jul-2024 20:07               30259
language.namespaces.global.php                     17-Jul-2024 20:07                2683
language.namespaces.importing.php                  17-Jul-2024 20:07               14451
language.namespaces.nested.php                     17-Jul-2024 20:07                2756
language.namespaces.nsconstants.php                17-Jul-2024 20:07                8495
language.namespaces.php                            17-Jul-2024 20:07                2298
language.namespaces.rationale.php                  17-Jul-2024 20:07                6002
language.namespaces.rules.php                      17-Jul-2024 20:07               11677
language.oop5.abstract.php                         17-Jul-2024 20:07               10684
language.oop5.anonymous.php                        17-Jul-2024 20:07               10219
language.oop5.autoload.php                         17-Jul-2024 20:07                6259
language.oop5.basic.php                            17-Jul-2024 20:07               46776
language.oop5.changelog.php                        17-Jul-2024 20:07               12277
language.oop5.cloning.php                          17-Jul-2024 20:07                8659
language.oop5.constants.php                        17-Jul-2024 20:07                8749
language.oop5.decon.php                            17-Jul-2024 20:07               26614
language.oop5.final.php                            17-Jul-2024 20:07                5921
language.oop5.inheritance.php                      17-Jul-2024 20:07               12250
language.oop5.interfaces.php                       17-Jul-2024 20:07               22151
language.oop5.iterations.php                       17-Jul-2024 20:07                5696
language.oop5.late-static-bindings.php             17-Jul-2024 20:07               13825
language.oop5.magic.php                            17-Jul-2024 20:07               43650
language.oop5.object-comparison.php                17-Jul-2024 20:07                8632
language.oop5.overloading.php                      17-Jul-2024 20:07               23155
language.oop5.paamayim-nekudotayim.php             17-Jul-2024 20:07                8138
language.oop5.php                                  17-Jul-2024 20:07                3226
language.oop5.properties.php                       17-Jul-2024 20:07               26219
language.oop5.references.php                       17-Jul-2024 20:07                5605
language.oop5.serialization.php                    17-Jul-2024 20:07                6605
language.oop5.static.php                           17-Jul-2024 20:07                8907
language.oop5.traits.php                           17-Jul-2024 20:07               34294
language.oop5.variance.php                         17-Jul-2024 20:07               15365
language.oop5.visibility.php                       17-Jul-2024 20:07               24535
language.operators.arithmetic.php                  17-Jul-2024 20:07                5567
language.operators.array.php                       17-Jul-2024 20:07                8731
language.operators.assignment.php                  17-Jul-2024 20:07               10398
language.operators.bitwise.php                     17-Jul-2024 20:07               42543
language.operators.comparison.php                  17-Jul-2024 20:07               40480
language.operators.errorcontrol.php                17-Jul-2024 20:07                5510
language.operators.execution.php                   17-Jul-2024 20:07                3135
language.operators.increment.php                   17-Jul-2024 20:07               13315
language.operators.logical.php                     17-Jul-2024 20:07                7537
language.operators.php                             17-Jul-2024 20:07                3554
language.operators.precedence.php                  17-Jul-2024 20:07               18518
language.operators.string.php                      17-Jul-2024 20:07                3032
language.operators.type.php                        17-Jul-2024 20:07               17720
language.references.arent.php                      17-Jul-2024 20:07                3056
language.references.pass.php                       17-Jul-2024 20:07                6327
language.references.php                            17-Jul-2024 20:07                1859
language.references.return.php                     17-Jul-2024 20:07                6642
language.references.spot.php                       17-Jul-2024 20:07                2584
language.references.unset.php                      17-Jul-2024 20:07                2190
language.references.whatare.php                    17-Jul-2024 20:07                1849
language.references.whatdo.php                     17-Jul-2024 20:07               17545
language.types.array.php                           17-Jul-2024 20:07               98282
language.types.boolean.php                         17-Jul-2024 20:07                9541
language.types.callable.php                        17-Jul-2024 20:07               11744
language.types.declarations.php                    17-Jul-2024 20:07               40945
language.types.enumerations.php                    17-Jul-2024 20:07                3566
language.types.float.php                           17-Jul-2024 20:07                8557
language.types.integer.php                         17-Jul-2024 20:07               20254
language.types.intro.php                           17-Jul-2024 20:07                5797
language.types.iterable.php                        17-Jul-2024 20:07                2924
language.types.mixed.php                           17-Jul-2024 20:07                1705
language.types.never.php                           17-Jul-2024 20:07                1904
language.types.null.php                            17-Jul-2024 20:07                3522
language.types.numeric-strings.php                 17-Jul-2024 20:07               10762
language.types.object.php                          17-Jul-2024 20:07                5350
language.types.php                                 17-Jul-2024 20:07                2824
language.types.relative-class-types.php            17-Jul-2024 20:07                2319
language.types.resource.php                        17-Jul-2024 20:07                2703
language.types.string.php                          17-Jul-2024 20:07               76349
language.types.type-juggling.php                   17-Jul-2024 20:07               25448
language.types.type-system.php                     17-Jul-2024 20:07                8059
language.types.value.php                           17-Jul-2024 20:07                2141
language.types.void.php                            17-Jul-2024 20:07                1913
language.variables.basics.php                      17-Jul-2024 20:07               12935
language.variables.external.php                    17-Jul-2024 20:07               17533
language.variables.php                             17-Jul-2024 20:07                1700
language.variables.predefined.php                  17-Jul-2024 20:07                2648
language.variables.scope.php                       17-Jul-2024 20:07               26442
language.variables.superglobals.php                17-Jul-2024 20:07                4125
language.variables.variable.php                    17-Jul-2024 20:07                9655
ldap.configuration.php                             17-Jul-2024 20:07                2317
ldap.constants.php                                 17-Jul-2024 20:07               32746
ldap.controls.php                                  17-Jul-2024 20:07                9935
ldap.examples-basic.php                            17-Jul-2024 20:07                8128
ldap.examples-controls.php                         17-Jul-2024 20:07               16045
ldap.examples.php                                  17-Jul-2024 20:07                1429
ldap.installation.php                              17-Jul-2024 20:07                2649
ldap.requirements.php                              17-Jul-2024 20:07                1500
ldap.resources.php                                 17-Jul-2024 20:07                1401
ldap.setup.php                                     17-Jul-2024 20:07                1546
ldap.using.php                                     17-Jul-2024 20:07                2244
libxml.constants.php                               17-Jul-2024 20:07               13534
libxml.installation.php                            17-Jul-2024 20:07                1918
libxml.installation_old.php                        17-Jul-2024 20:07                2594
libxml.requirements.php                            17-Jul-2024 20:07                1337
libxml.resources.php                               17-Jul-2024 20:07                1212
libxml.setup.php                                   17-Jul-2024 20:07                1620
limititerator.construct.php                        17-Jul-2024 20:07                7302
limititerator.current.php                          17-Jul-2024 20:07                3540
limititerator.getposition.php                      17-Jul-2024 20:07                5721
limititerator.key.php                              17-Jul-2024 20:07                3590
limititerator.next.php                             17-Jul-2024 20:07                3267
limititerator.rewind.php                           17-Jul-2024 20:07                3435
limititerator.seek.php                             17-Jul-2024 20:07                4114
limititerator.valid.php                            17-Jul-2024 20:07                3497
locale.acceptfromhttp.php                          17-Jul-2024 20:07                6218
locale.canonicalize.php                            17-Jul-2024 20:07                3139
locale.composelocale.php                           17-Jul-2024 20:07               13463
locale.filtermatches.php                           17-Jul-2024 20:07                9273
locale.getallvariants.php                          17-Jul-2024 20:07                6671
locale.getdefault.php                              17-Jul-2024 20:07                5851
locale.getdisplaylanguage.php                      17-Jul-2024 20:07                9874
locale.getdisplayname.php                          17-Jul-2024 20:07                9856
locale.getdisplayregion.php                        17-Jul-2024 20:07                9822
locale.getdisplayscript.php                        17-Jul-2024 20:07                9829
locale.getdisplayvariant.php                       17-Jul-2024 20:07                9868
locale.getkeywords.php                             17-Jul-2024 20:07                7283
locale.getprimarylanguage.php                      17-Jul-2024 20:07                6072
locale.getregion.php                               17-Jul-2024 20:07                6013
locale.getscript.php                               17-Jul-2024 20:07                5694
locale.lookup.php                                  17-Jul-2024 20:07               10156
locale.parselocale.php                             17-Jul-2024 20:07                7397
locale.setdefault.php                              17-Jul-2024 20:07                5361
lua.assign.php                                     17-Jul-2024 20:07                4590
lua.call.php                                       17-Jul-2024 20:07                7445
lua.construct.php                                  17-Jul-2024 20:07                2375
lua.eval.php                                       17-Jul-2024 20:07                3725
lua.getversion.php                                 17-Jul-2024 20:07                2231
lua.include.php                                    17-Jul-2024 20:07                2674
lua.installation.php                               17-Jul-2024 20:07                1894
lua.registercallback.php                           17-Jul-2024 20:07                4559
lua.requirements.php                               17-Jul-2024 20:07                1233
lua.resources.php                                  17-Jul-2024 20:07                1165
lua.setup.php                                      17-Jul-2024 20:07                1443
luaclosure.invoke.php                              17-Jul-2024 20:07                4090
luasandbox.callfunction.php                        17-Jul-2024 20:07                5076
luasandbox.disableprofiler.php                     17-Jul-2024 20:07                2853
luasandbox.enableprofiler.php                      17-Jul-2024 20:07                3509
luasandbox.examples-basic.php                      17-Jul-2024 20:07                6657
luasandbox.examples.php                            17-Jul-2024 20:07                1489
luasandbox.getcpuusage.php                         17-Jul-2024 20:07                3611
luasandbox.getmemoryusage.php                      17-Jul-2024 20:07                3189
luasandbox.getpeakmemoryusage.php                  17-Jul-2024 20:07                3239
luasandbox.getprofilerfunctionreport.php           17-Jul-2024 20:07                6021
luasandbox.getversioninfo.php                      17-Jul-2024 20:07                3106
luasandbox.installation.php                        17-Jul-2024 20:07                2034
luasandbox.loadbinary.php                          17-Jul-2024 20:07                3638
luasandbox.loadstring.php                          17-Jul-2024 20:07                5628
luasandbox.pauseusagetimer.php                     17-Jul-2024 20:07                9411
luasandbox.registerlibrary.php                     17-Jul-2024 20:07                6640
luasandbox.requirements.php                        17-Jul-2024 20:07                1749
luasandbox.resources.php                           17-Jul-2024 20:07                1230
luasandbox.setcpulimit.php                         17-Jul-2024 20:07                6132
luasandbox.setmemorylimit.php                      17-Jul-2024 20:07                5535
luasandbox.setup.php                               17-Jul-2024 20:07                1527
luasandbox.unpauseusagetimer.php                   17-Jul-2024 20:07                3149
luasandbox.wrapphpfunction.php                     17-Jul-2024 20:07                4376
luasandboxfunction.call.php                        17-Jul-2024 20:07                8044
luasandboxfunction.construct.php                   17-Jul-2024 20:07                2691
luasandboxfunction.dump.php                        17-Jul-2024 20:07                2447
lzf.installation.php                               17-Jul-2024 20:07                2342
lzf.resources.php                                  17-Jul-2024 20:07                1144
lzf.setup.php                                      17-Jul-2024 20:07                1403
mail.configuration.php                             17-Jul-2024 20:07                7542
mail.requirements.php                              17-Jul-2024 20:07                1838
mail.resources.php                                 17-Jul-2024 20:07                1162
mail.setup.php                                     17-Jul-2024 20:07                1484
mailparse.configuration.php                        17-Jul-2024 20:07                2431
mailparse.constants.php                            17-Jul-2024 20:07                2314
mailparse.installation.php                         17-Jul-2024 20:07                2416
mailparse.resources.php                            17-Jul-2024 20:07                1544
mailparse.setup.php                                17-Jul-2024 20:07                1542
manual.php                                         17-Jul-2024 20:07                1048
math.constants.php                                 17-Jul-2024 20:07                7195
math.resources.php                                 17-Jul-2024 20:07                1162
math.setup.php                                     17-Jul-2024 20:07                1354
mbstring.configuration.php                         17-Jul-2024 20:07               15693
mbstring.constants.php                             17-Jul-2024 20:07                6773
mbstring.encodings.php                             17-Jul-2024 20:07               14798
mbstring.http.php                                  17-Jul-2024 20:07                4961
mbstring.installation.php                          17-Jul-2024 20:07                3173
mbstring.ja-basic.php                              17-Jul-2024 20:07                3481
mbstring.overload.php                              17-Jul-2024 20:07                6898
mbstring.php4.req.php                              17-Jul-2024 20:07                3749
mbstring.resources.php                             17-Jul-2024 20:07                1200
mbstring.setup.php                                 17-Jul-2024 20:07                1549
mbstring.supported-encodings.php                   17-Jul-2024 20:07                8177
mcrypt.ciphers.php                                 17-Jul-2024 20:07                6446
mcrypt.configuration.php                           17-Jul-2024 20:07                3504
mcrypt.constants.php                               17-Jul-2024 20:07                6288
mcrypt.installation.php                            17-Jul-2024 20:07                1695
mcrypt.requirements.php                            17-Jul-2024 20:07                2105
mcrypt.resources.php                               17-Jul-2024 20:07                1295
mcrypt.setup.php                                   17-Jul-2024 20:07                1577
memcache.add.php                                   17-Jul-2024 20:07                7341
memcache.addserver.php                             17-Jul-2024 20:07               13383
memcache.close.php                                 17-Jul-2024 20:07                5176
memcache.connect.php                               17-Jul-2024 20:07                7200
memcache.constants.php                             17-Jul-2024 20:07                5142
memcache.decrement.php                             17-Jul-2024 20:07                7244
memcache.delete.php                                17-Jul-2024 20:07                6460
memcache.examples-overview.php                     17-Jul-2024 20:07                6419
memcache.examples.php                              17-Jul-2024 20:07                1415
memcache.flush.php                                 17-Jul-2024 20:07                4633
memcache.get.php                                   17-Jul-2024 20:07                9140
memcache.getextendedstats.php                      17-Jul-2024 20:07                8417
memcache.getserverstatus.php                       17-Jul-2024 20:07                6148
memcache.getstats.php                              17-Jul-2024 20:07                4688
memcache.getversion.php                            17-Jul-2024 20:07                5039
memcache.increment.php                             17-Jul-2024 20:07                7065
memcache.ini.php                                   17-Jul-2024 20:07               10475
memcache.installation.php                          17-Jul-2024 20:07                2009
memcache.pconnect.php                              17-Jul-2024 20:07                6171
memcache.replace.php                               17-Jul-2024 20:07                7358
memcache.requirements.php                          17-Jul-2024 20:07                1310
memcache.resources.php                             17-Jul-2024 20:07                1257
memcache.set.php                                   17-Jul-2024 20:07                9571
memcache.setcompressthreshold.php                  17-Jul-2024 20:07                5888
memcache.setserverparams.php                       17-Jul-2024 20:07               10983
memcache.setup.php                                 17-Jul-2024 20:07                1590
memcached.add.php                                  17-Jul-2024 20:07                4609
memcached.addbykey.php                             17-Jul-2024 20:07                5744
memcached.addserver.php                            17-Jul-2024 20:07                7459
memcached.addservers.php                           17-Jul-2024 20:07                5379
memcached.append.php                               17-Jul-2024 20:07                7369
memcached.appendbykey.php                          17-Jul-2024 20:07                5101
memcached.callbacks.php                            17-Jul-2024 20:07                1508
memcached.callbacks.read-through.php               17-Jul-2024 20:07                4390
memcached.callbacks.result.php                     17-Jul-2024 20:07                4834
memcached.cas.php                                  17-Jul-2024 20:07                9613
memcached.casbykey.php                             17-Jul-2024 20:07                5854
memcached.configuration.php                        17-Jul-2024 20:07               27991
memcached.constants.php                            17-Jul-2024 20:07               28562
memcached.construct.php                            17-Jul-2024 20:07                5602
memcached.decrement.php                            17-Jul-2024 20:07                9041
memcached.decrementbykey.php                       17-Jul-2024 20:07                5937
memcached.delete.php                               17-Jul-2024 20:07                5636
memcached.deletebykey.php                          17-Jul-2024 20:07                5505
memcached.deletemulti.php                          17-Jul-2024 20:07                4820
memcached.deletemultibykey.php                     17-Jul-2024 20:07                5739
memcached.expiration.php                           17-Jul-2024 20:07                1930
memcached.fetch.php                                17-Jul-2024 20:07                6725
memcached.fetchall.php                             17-Jul-2024 20:07                6518
memcached.flush.php                                17-Jul-2024 20:07                4636
memcached.get.php                                  17-Jul-2024 20:07               10291
memcached.getallkeys.php                           17-Jul-2024 20:07                3058
memcached.getbykey.php                             17-Jul-2024 20:07                6470
memcached.getdelayed.php                           17-Jul-2024 20:07                8839
memcached.getdelayedbykey.php                      17-Jul-2024 20:07                5837
memcached.getmulti.php                             17-Jul-2024 20:07               20647
memcached.getmultibykey.php                        17-Jul-2024 20:07                5644
memcached.getoption.php                            17-Jul-2024 20:07                5183
memcached.getresultcode.php                        17-Jul-2024 20:07                4256
memcached.getresultmessage.php                     17-Jul-2024 20:07                4653
memcached.getserverbykey.php                       17-Jul-2024 20:07                7650
memcached.getserverlist.php                        17-Jul-2024 20:07                4580
memcached.getstats.php                             17-Jul-2024 20:07                5828
memcached.getversion.php                           17-Jul-2024 20:07                4096
memcached.increment.php                            17-Jul-2024 20:07                8360
memcached.incrementbykey.php                       17-Jul-2024 20:07                5870
memcached.installation.php                         17-Jul-2024 20:07                2564
memcached.ispersistent.php                         17-Jul-2024 20:07                3004
memcached.ispristine.php                           17-Jul-2024 20:07                2931
memcached.prepend.php                              17-Jul-2024 20:07                7345
memcached.prependbykey.php                         17-Jul-2024 20:07                5243
memcached.quit.php                                 17-Jul-2024 20:07                2444
memcached.replace.php                              17-Jul-2024 20:07                4670
memcached.replacebykey.php                         17-Jul-2024 20:07                5612
memcached.requirements.php                         17-Jul-2024 20:07                1512
memcached.resetserverlist.php                      17-Jul-2024 20:07                3161
memcached.resources.php                            17-Jul-2024 20:07                1207
memcached.sessions.php                             17-Jul-2024 20:07                2703
memcached.set.php                                  17-Jul-2024 20:07                9067
memcached.setbykey.php                             17-Jul-2024 20:07                7005
memcached.setmulti.php                             17-Jul-2024 20:07                6274
memcached.setmultibykey.php                        17-Jul-2024 20:07                4893
memcached.setoption.php                            17-Jul-2024 20:07                7308
memcached.setoptions.php                           17-Jul-2024 20:07                6955
memcached.setsaslauthdata.php                      17-Jul-2024 20:07                3531
memcached.setup.php                                17-Jul-2024 20:07                1605
memcached.touch.php                                17-Jul-2024 20:07                3747
memcached.touchbykey.php                           17-Jul-2024 20:07                4610
messageformatter.create.php                        17-Jul-2024 20:07               11023
messageformatter.format.php                        17-Jul-2024 20:07                9705
messageformatter.formatmessage.php                 17-Jul-2024 20:07               14451
messageformatter.geterrorcode.php                  17-Jul-2024 20:07                3978
messageformatter.geterrormessage.php               17-Jul-2024 20:07                7624
messageformatter.getlocale.php                     17-Jul-2024 20:07                5481
messageformatter.getpattern.php                    17-Jul-2024 20:07               10079
messageformatter.parse.php                         17-Jul-2024 20:07                9818
messageformatter.parsemessage.php                  17-Jul-2024 20:07               10015
messageformatter.setpattern.php                    17-Jul-2024 20:07               10613
mhash.constants.php                                17-Jul-2024 20:07                7138
mhash.examples.php                                 17-Jul-2024 20:07                3307
mhash.installation.php                             17-Jul-2024 20:07                1587
mhash.requirements.php                             17-Jul-2024 20:07                1320
mhash.resources.php                                17-Jul-2024 20:07                1169
mhash.setup.php                                    17-Jul-2024 20:07                1484
migration56.changed-functions.php                  17-Jul-2024 20:07                6799
migration56.constants.php                          17-Jul-2024 20:07                6791
migration56.deprecated.php                         17-Jul-2024 20:07                6229
migration56.extensions.php                         17-Jul-2024 20:07                4333
migration56.incompatible.php                       17-Jul-2024 20:07                8444
migration56.new-features.php                       17-Jul-2024 20:07               28535
migration56.new-functions.php                      17-Jul-2024 20:07                7552
migration56.openssl.php                            17-Jul-2024 20:07               26756
migration56.php                                    17-Jul-2024 20:07                2328
migration70.changed-functions.php                  17-Jul-2024 20:07                4981
migration70.classes.php                            17-Jul-2024 20:07                3918
migration70.constants.php                          17-Jul-2024 20:07                9505
migration70.deprecated.php                         17-Jul-2024 20:07                5512
migration70.incompatible.php                       17-Jul-2024 20:07               61161
migration70.new-features.php                       17-Jul-2024 20:07               40129
migration70.new-functions.php                      17-Jul-2024 20:07                7358
migration70.other-changes.php                      17-Jul-2024 20:07                3280
migration70.php                                    17-Jul-2024 20:07                2685
migration70.removed-exts-sapis.php                 17-Jul-2024 20:07                3169
migration70.sapi-changes.php                       17-Jul-2024 20:07                1988
migration71.changed-functions.php                  17-Jul-2024 20:07                7648
migration71.constants.php                          17-Jul-2024 20:07                8797
migration71.deprecated.php                         17-Jul-2024 20:07                2235
migration71.incompatible.php                       17-Jul-2024 20:07               28960
migration71.new-features.php                       17-Jul-2024 20:07               26596
migration71.new-functions.php                      17-Jul-2024 20:07                5086
migration71.other-changes.php                      17-Jul-2024 20:07                8214
migration71.php                                    17-Jul-2024 20:07                2386
migration71.windows-support.php                    17-Jul-2024 20:07                6723
migration72.constants.php                          17-Jul-2024 20:07               31969
migration72.deprecated.php                         17-Jul-2024 20:07                9888
migration72.incompatible.php                       17-Jul-2024 20:07               19173
migration72.new-features.php                       17-Jul-2024 20:07               18381
migration72.new-functions.php                      17-Jul-2024 20:07               24418
migration72.other-changes.php                      17-Jul-2024 20:07                5735
migration72.php                                    17-Jul-2024 20:07                2282
migration73.constants.php                          17-Jul-2024 20:07               26170
migration73.deprecated.php                         17-Jul-2024 20:07                8675
migration73.incompatible.php                       17-Jul-2024 20:07               17263
migration73.new-features.php                       17-Jul-2024 20:07               16133
migration73.new-functions.php                      17-Jul-2024 20:07                7420
migration73.other-changes.php                      17-Jul-2024 20:07               15880
migration73.php                                    17-Jul-2024 20:07                2408
migration73.windows-support.php                    17-Jul-2024 20:07                1805
migration74.constants.php                          17-Jul-2024 20:07                7803
migration74.deprecated.php                         17-Jul-2024 20:07               15059
migration74.incompatible.php                       17-Jul-2024 20:07               17728
migration74.new-classes.php                        17-Jul-2024 20:07                1514
migration74.new-features.php                       17-Jul-2024 20:07               21377
migration74.new-functions.php                      17-Jul-2024 20:07                3754
migration74.other-changes.php                      17-Jul-2024 20:07               20527
migration74.php                                    17-Jul-2024 20:07                2616
migration74.removed-extensions.php                 17-Jul-2024 20:07                1906
migration74.windows-support.php                    17-Jul-2024 20:07                3643
migration80.deprecated.php                         17-Jul-2024 20:07               18400
migration80.incompatible.php                       17-Jul-2024 20:07               94315
migration80.new-features.php                       17-Jul-2024 20:07               31220
migration80.other-changes.php                      17-Jul-2024 20:07               14899
migration80.php                                    17-Jul-2024 20:07                2255
migration81.constants.php                          17-Jul-2024 20:07                8231
migration81.deprecated.php                         17-Jul-2024 20:07               18795
migration81.incompatible.php                       17-Jul-2024 20:07               22410
migration81.new-classes.php                        17-Jul-2024 20:07                2150
migration81.new-features.php                       17-Jul-2024 20:07               23177
migration81.new-functions.php                      17-Jul-2024 20:07                8489
migration81.other-changes.php                      17-Jul-2024 20:07                9716
migration81.php                                    17-Jul-2024 20:07                2481
migration82.constants.php                          17-Jul-2024 20:07               22160
migration82.deprecated.php                         17-Jul-2024 20:07                5642
migration82.incompatible.php                       17-Jul-2024 20:07                9182
migration82.new-features.php                       17-Jul-2024 20:07                6798
migration82.new-functions.php                      17-Jul-2024 20:07                4311
migration82.other-changes.php                      17-Jul-2024 20:07               25237
migration82.php                                    17-Jul-2024 20:07                2508
migration82.windows-support.php                    17-Jul-2024 20:07                2217
migration83.constants.php                          17-Jul-2024 20:07               14841
migration83.deprecated.php                         17-Jul-2024 20:07                7405
migration83.incompatible.php                       17-Jul-2024 20:07               13858
migration83.new-classes.php                        17-Jul-2024 20:07                3402
migration83.new-features.php                       17-Jul-2024 20:07                6960
migration83.new-functions.php                      17-Jul-2024 20:07                7323
migration83.other-changes.php                      17-Jul-2024 20:07               30303
migration83.php                                    17-Jul-2024 20:07                2641
migration83.windows-support.php                    17-Jul-2024 20:07                1410
misc.configuration.php                             17-Jul-2024 20:07                5900
misc.constants.php                                 17-Jul-2024 20:07                2532
misc.resources.php                                 17-Jul-2024 20:07                1172
misc.setup.php                                     17-Jul-2024 20:07                1430
mongodb-bson-binary.construct.php                  17-Jul-2024 20:07                7942
mongodb-bson-binary.getdata.php                    17-Jul-2024 20:07                4404
mongodb-bson-binary.gettype.php                    17-Jul-2024 20:07                4386
mongodb-bson-binary.jsonserialize.php              17-Jul-2024 20:07                5370
mongodb-bson-binary.serialize.php                  17-Jul-2024 20:07                3464
mongodb-bson-binary.tostring.php                   17-Jul-2024 20:07                4194
mongodb-bson-binary.unserialize.php                17-Jul-2024 20:07                4309
mongodb-bson-binaryinterface.getdata.php           17-Jul-2024 20:07                2842
mongodb-bson-binaryinterface.gettype.php           17-Jul-2024 20:07                2852
mongodb-bson-binaryinterface.tostring.php          17-Jul-2024 20:07                3310
mongodb-bson-dbpointer.construct.php               17-Jul-2024 20:07                2673
mongodb-bson-dbpointer.jsonserialize.php           17-Jul-2024 20:07                5439
mongodb-bson-dbpointer.serialize.php               17-Jul-2024 20:07                3539
mongodb-bson-dbpointer.tostring.php                17-Jul-2024 20:07                2684
mongodb-bson-dbpointer.unserialize.php             17-Jul-2024 20:07                3808
mongodb-bson-decimal128.construct.php              17-Jul-2024 20:07                5782
mongodb-bson-decimal128.jsonserialize.php          17-Jul-2024 20:07                5460
mongodb-bson-decimal128.serialize.php              17-Jul-2024 20:07                3564
mongodb-bson-decimal128.tostring.php               17-Jul-2024 20:07                4532
mongodb-bson-decimal128.unserialize.php            17-Jul-2024 20:07                4401
mongodb-bson-decimal128interface.tostring.php      17-Jul-2024 20:07                3005
mongodb-bson-document.construct.php                17-Jul-2024 20:07                3287
mongodb-bson-document.frombson.php                 17-Jul-2024 20:07                4068
mongodb-bson-document.fromjson.php                 17-Jul-2024 20:07                4581
mongodb-bson-document.fromphp.php                  17-Jul-2024 20:07                4303
mongodb-bson-document.get.php                      17-Jul-2024 20:07                4269
mongodb-bson-document.getiterator.php              17-Jul-2024 20:07                3521
mongodb-bson-document.has.php                      17-Jul-2024 20:07                3799
mongodb-bson-document.offsetexists.php             17-Jul-2024 20:07                3528
mongodb-bson-document.offsetget.php                17-Jul-2024 20:07                4358
mongodb-bson-document.offsetset.php                17-Jul-2024 20:07                3595
mongodb-bson-document.offsetunset.php              17-Jul-2024 20:07                3204
mongodb-bson-document.serialize.php                17-Jul-2024 20:07                3544
mongodb-bson-document.tocanonicalextendedjson.php  17-Jul-2024 20:07               12721
mongodb-bson-document.tophp.php                    17-Jul-2024 20:07                5482
mongodb-bson-document.torelaxedextendedjson.php    17-Jul-2024 20:07               12438
mongodb-bson-document.tostring.php                 17-Jul-2024 20:07                2758
mongodb-bson-document.unserialize.php              17-Jul-2024 20:07                4357
mongodb-bson-int64.construct.php                   17-Jul-2024 20:07                4775
mongodb-bson-int64.jsonserialize.php               17-Jul-2024 20:07                5114
mongodb-bson-int64.serialize.php                   17-Jul-2024 20:07                3441
mongodb-bson-int64.tostring.php                    17-Jul-2024 20:07                3850
mongodb-bson-int64.unserialize.php                 17-Jul-2024 20:07                4280
mongodb-bson-iterator.construct.php                17-Jul-2024 20:07                3375
mongodb-bson-iterator.current.php                  17-Jul-2024 20:07                3608
mongodb-bson-iterator.key.php                      17-Jul-2024 20:07                3598
mongodb-bson-iterator.next.php                     17-Jul-2024 20:07                2408
mongodb-bson-iterator.rewind.php                   17-Jul-2024 20:07                2442
mongodb-bson-iterator.valid.php                    17-Jul-2024 20:07                2816
mongodb-bson-javascript.construct.php              17-Jul-2024 20:07                7253
mongodb-bson-javascript.getcode.php                17-Jul-2024 20:07                4376
mongodb-bson-javascript.getscope.php               17-Jul-2024 20:07                5352
mongodb-bson-javascript.jsonserialize.php          17-Jul-2024 20:07                5456
mongodb-bson-javascript.serialize.php              17-Jul-2024 20:07                3564
mongodb-bson-javascript.tostring.php               17-Jul-2024 20:07                4188
mongodb-bson-javascript.unserialize.php            17-Jul-2024 20:07                4393
mongodb-bson-javascriptinterface.getcode.php       17-Jul-2024 20:07                2936
mongodb-bson-javascriptinterface.getscope.php      17-Jul-2024 20:07                3101
mongodb-bson-javascriptinterface.tostring.php      17-Jul-2024 20:07                3408
mongodb-bson-maxkey.construct.php                  17-Jul-2024 20:07                3637
mongodb-bson-maxkey.jsonserialize.php              17-Jul-2024 20:07                5376
mongodb-bson-maxkey.serialize.php                  17-Jul-2024 20:07                3468
mongodb-bson-maxkey.unserialize.php                17-Jul-2024 20:07                3741
mongodb-bson-minkey.construct.php                  17-Jul-2024 20:07                3637
mongodb-bson-minkey.jsonserialize.php              17-Jul-2024 20:07                5376
mongodb-bson-minkey.serialize.php                  17-Jul-2024 20:07                3468
mongodb-bson-minkey.unserialize.php                17-Jul-2024 20:07                3745
mongodb-bson-objectid.construct.php                17-Jul-2024 20:07                5273
mongodb-bson-objectid.gettimestamp.php             17-Jul-2024 20:07                5473
mongodb-bson-objectid.jsonserialize.php            17-Jul-2024 20:07                5422
mongodb-bson-objectid.serialize.php                17-Jul-2024 20:07                3516
mongodb-bson-objectid.tostring.php                 17-Jul-2024 20:07                4178
mongodb-bson-objectid.unserialize.php              17-Jul-2024 20:07                4347
mongodb-bson-objectidinterface.gettimestamp.php    17-Jul-2024 20:07                3005
mongodb-bson-objectidinterface.tostring.php        17-Jul-2024 20:07                2989
mongodb-bson-packedarray.construct.php             17-Jul-2024 20:07                2907
mongodb-bson-packedarray.fromphp.php               17-Jul-2024 20:07                3984
mongodb-bson-packedarray.get.php                   17-Jul-2024 20:07                4317
mongodb-bson-packedarray.getiterator.php           17-Jul-2024 20:07                3575
mongodb-bson-packedarray.has.php                   17-Jul-2024 20:07                3853
mongodb-bson-packedarray.offsetexists.php          17-Jul-2024 20:07                3584
mongodb-bson-packedarray.offsetget.php             17-Jul-2024 20:07                4524
mongodb-bson-packedarray.offsetset.php             17-Jul-2024 20:07                3649
mongodb-bson-packedarray.offsetunset.php           17-Jul-2024 20:07                3258
mongodb-bson-packedarray.serialize.php             17-Jul-2024 20:07                3576
mongodb-bson-packedarray.tophp.php                 17-Jul-2024 20:07                4666
mongodb-bson-packedarray.tostring.php              17-Jul-2024 20:07                2774
mongodb-bson-packedarray.unserialize.php           17-Jul-2024 20:07                4413
mongodb-bson-persistable.bsonserialize.php         17-Jul-2024 20:07                6175
mongodb-bson-regex.construct.php                   17-Jul-2024 20:07                7016
mongodb-bson-regex.getflags.php                    17-Jul-2024 20:07                4486
mongodb-bson-regex.getpattern.php                  17-Jul-2024 20:07                4348
mongodb-bson-regex.jsonserialize.php               17-Jul-2024 20:07                5355
mongodb-bson-regex.serialize.php                   17-Jul-2024 20:07                3439
mongodb-bson-regex.tostring.php                    17-Jul-2024 20:07                3886
mongodb-bson-regex.unserialize.php                 17-Jul-2024 20:07                4284
mongodb-bson-regexinterface.getflags.php           17-Jul-2024 20:07                2841
mongodb-bson-regexinterface.getpattern.php         17-Jul-2024 20:07                2884
mongodb-bson-regexinterface.tostring.php           17-Jul-2024 20:07                2915
mongodb-bson-serializable.bsonserialize.php        17-Jul-2024 20:07               16576
mongodb-bson-symbol.construct.php                  17-Jul-2024 20:07                2613
mongodb-bson-symbol.jsonserialize.php              17-Jul-2024 20:07                5376
mongodb-bson-symbol.serialize.php                  17-Jul-2024 20:07                3464
mongodb-bson-symbol.tostring.php                   17-Jul-2024 20:07                2662
mongodb-bson-symbol.unserialize.php                17-Jul-2024 20:07                3747
mongodb-bson-timestamp.construct.php               17-Jul-2024 20:07                4829
mongodb-bson-timestamp.getincrement.php            17-Jul-2024 20:07                4305
mongodb-bson-timestamp.gettimestamp.php            17-Jul-2024 20:07                4290
mongodb-bson-timestamp.jsonserialize.php           17-Jul-2024 20:07                5443
mongodb-bson-timestamp.serialize.php               17-Jul-2024 20:07                3539
mongodb-bson-timestamp.tostring.php                17-Jul-2024 20:07                4020
mongodb-bson-timestamp.unserialize.php             17-Jul-2024 20:07                4380
mongodb-bson-timestampinterface.getincrement.php   17-Jul-2024 20:07                3368
mongodb-bson-timestampinterface.gettimestamp.php   17-Jul-2024 20:07                3383
mongodb-bson-timestampinterface.tostring.php       17-Jul-2024 20:07                3007
mongodb-bson-undefined.construct.php               17-Jul-2024 20:07                2673
mongodb-bson-undefined.jsonserialize.php           17-Jul-2024 20:07                5439
mongodb-bson-undefined.serialize.php               17-Jul-2024 20:07                3539
mongodb-bson-undefined.tostring.php                17-Jul-2024 20:07                2684
mongodb-bson-undefined.unserialize.php             17-Jul-2024 20:07                3809
mongodb-bson-unserializable.bsonunserialize.php    17-Jul-2024 20:07                7075
mongodb-bson-utcdatetime.construct.php             17-Jul-2024 20:07                8156
mongodb-bson-utcdatetime.jsonserialize.php         17-Jul-2024 20:07                5481
mongodb-bson-utcdatetime.serialize.php             17-Jul-2024 20:07                3591
mongodb-bson-utcdatetime.todatetime.php            17-Jul-2024 20:07                5817
mongodb-bson-utcdatetime.tostring.php              17-Jul-2024 20:07                3984
mongodb-bson-utcdatetime.unserialize.php           17-Jul-2024 20:07                4412
mongodb-bson-utcdatetimeinterface.todatetime.php   17-Jul-2024 20:07                3284
mongodb-bson-utcdatetimeinterface.tostring.php     17-Jul-2024 20:07                3023
mongodb-driver-bulkwrite.construct.php             17-Jul-2024 20:07               18656
mongodb-driver-bulkwrite.count.php                 17-Jul-2024 20:07                6923
mongodb-driver-bulkwrite.delete.php                17-Jul-2024 20:07               12035
mongodb-driver-bulkwrite.insert.php                17-Jul-2024 20:07                9597
mongodb-driver-bulkwrite.update.php                17-Jul-2024 20:07               15645
mongodb-driver-clientencryption.addkeyaltname.php  17-Jul-2024 20:07                5571
mongodb-driver-clientencryption.construct.php      17-Jul-2024 20:07               11314
mongodb-driver-clientencryption.createdatakey.php  17-Jul-2024 20:07               11002
mongodb-driver-clientencryption.decrypt.php        17-Jul-2024 20:07                4212
mongodb-driver-clientencryption.deletekey.php      17-Jul-2024 20:07                4319
mongodb-driver-clientencryption.encrypt.php        17-Jul-2024 20:07               13365
mongodb-driver-clientencryption.encryptexpressi..> 17-Jul-2024 20:07               15080
mongodb-driver-clientencryption.getkey.php         17-Jul-2024 20:07                4452
mongodb-driver-clientencryption.getkeybyaltname..> 17-Jul-2024 20:07                5041
mongodb-driver-clientencryption.getkeys.php        17-Jul-2024 20:07                3860
mongodb-driver-clientencryption.removekeyaltnam..> 17-Jul-2024 20:07                5636
mongodb-driver-clientencryption.rewrapmanydatak..> 17-Jul-2024 20:07               12187
mongodb-driver-command.construct.php               17-Jul-2024 20:07               14212
mongodb-driver-commandexception.getresultdocume..> 17-Jul-2024 20:07                3257
mongodb-driver-cursor.construct.php                17-Jul-2024 20:07                3347
mongodb-driver-cursor.current.php                  17-Jul-2024 20:07                3095
mongodb-driver-cursor.getid.php                    17-Jul-2024 20:07                7588
mongodb-driver-cursor.getserver.php                17-Jul-2024 20:07                7481
mongodb-driver-cursor.isdead.php                   17-Jul-2024 20:07               10613
mongodb-driver-cursor.key.php                      17-Jul-2024 20:07                2645
mongodb-driver-cursor.next.php                     17-Jul-2024 20:07                3507
mongodb-driver-cursor.rewind.php                   17-Jul-2024 20:07                3957
mongodb-driver-cursor.settypemap.php               17-Jul-2024 20:07                7957
mongodb-driver-cursor.toarray.php                  17-Jul-2024 20:07                7674
mongodb-driver-cursor.valid.php                    17-Jul-2024 20:07                2841
mongodb-driver-cursorid.construct.php              17-Jul-2024 20:07                2835
mongodb-driver-cursorid.serialize.php              17-Jul-2024 20:07                3562
mongodb-driver-cursorid.tostring.php               17-Jul-2024 20:07                6974
mongodb-driver-cursorid.unserialize.php            17-Jul-2024 20:07                4419
mongodb-driver-cursorinterface.getid.php           17-Jul-2024 20:07                4015
mongodb-driver-cursorinterface.getserver.php       17-Jul-2024 20:07                4116
mongodb-driver-cursorinterface.isdead.php          17-Jul-2024 20:07                4079
mongodb-driver-cursorinterface.settypemap.php      17-Jul-2024 20:07                4118
mongodb-driver-cursorinterface.toarray.php         17-Jul-2024 20:07                3978
mongodb-driver-manager.addsubscriber.php           17-Jul-2024 20:07                5547
mongodb-driver-manager.construct.php               17-Jul-2024 20:07               80138
mongodb-driver-manager.createclientencryption.php  17-Jul-2024 20:07               12640
mongodb-driver-manager.executebulkwrite.php        17-Jul-2024 20:07               23198
mongodb-driver-manager.executecommand.php          17-Jul-2024 20:07               24973
mongodb-driver-manager.executequery.php            17-Jul-2024 20:07               16518
mongodb-driver-manager.executereadcommand.php      17-Jul-2024 20:07               10187
mongodb-driver-manager.executereadwritecommand.php 17-Jul-2024 20:07               11264
mongodb-driver-manager.executewritecommand.php     17-Jul-2024 20:07               11353
mongodb-driver-manager.getencryptedfieldsmap.php   17-Jul-2024 20:07                3913
mongodb-driver-manager.getreadconcern.php          17-Jul-2024 20:07                5885
mongodb-driver-manager.getreadpreference.php       17-Jul-2024 20:07                6480
mongodb-driver-manager.getservers.php              17-Jul-2024 20:07                7923
mongodb-driver-manager.getwriteconcern.php         17-Jul-2024 20:07                5938
mongodb-driver-manager.removesubscriber.php        17-Jul-2024 20:07                4939
mongodb-driver-manager.selectserver.php            17-Jul-2024 20:07                7211
mongodb-driver-manager.startsession.php            17-Jul-2024 20:07               12608
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                3713
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                3640
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                3812
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                3641
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                4844
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                4032
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                4271
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                4194
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                4041
mongodb-driver-monitoring-commandfailedevent.ge..> 17-Jul-2024 20:07                3825
mongodb-driver-monitoring-commandstartedevent.g..> 17-Jul-2024 20:07                4039
mongodb-driver-monitoring-commandstartedevent.g..> 17-Jul-2024 20:07                3749
mongodb-driver-monitoring-commandstartedevent.g..> 17-Jul-2024 20:07                3651
mongodb-driver-monitoring-commandstartedevent.g..> 17-Jul-2024 20:07                5153
mongodb-driver-monitoring-commandstartedevent.g..> 17-Jul-2024 20:07                4732
mongodb-driver-monitoring-commandstartedevent.g..> 17-Jul-2024 20:07                4485
mongodb-driver-monitoring-commandstartedevent.g..> 17-Jul-2024 20:07                4061
mongodb-driver-monitoring-commandstartedevent.g..> 17-Jul-2024 20:07                3845
mongodb-driver-monitoring-commandsubscriber.com..> 17-Jul-2024 20:07                4894
mongodb-driver-monitoring-commandsubscriber.com..> 17-Jul-2024 20:07                4962
mongodb-driver-monitoring-commandsubscriber.com..> 17-Jul-2024 20:07                4960
mongodb-driver-monitoring-commandsucceededevent..> 17-Jul-2024 20:07                3770
mongodb-driver-monitoring-commandsucceededevent..> 17-Jul-2024 20:07                3697
mongodb-driver-monitoring-commandsucceededevent..> 17-Jul-2024 20:07                3881
mongodb-driver-monitoring-commandsucceededevent..> 17-Jul-2024 20:07                4931
mongodb-driver-monitoring-commandsucceededevent..> 17-Jul-2024 20:07                4089
mongodb-driver-monitoring-commandsucceededevent..> 17-Jul-2024 20:07                4334
mongodb-driver-monitoring-commandsucceededevent..> 17-Jul-2024 20:07                4699
mongodb-driver-monitoring-commandsucceededevent..> 17-Jul-2024 20:07                4101
mongodb-driver-monitoring-commandsucceededevent..> 17-Jul-2024 20:07                3871
mongodb-driver-monitoring-logsubscriber.log.php    17-Jul-2024 20:07                4632
mongodb-driver-monitoring-sdamsubscriber.server..> 17-Jul-2024 20:07                4781
mongodb-driver-monitoring-sdamsubscriber.server..> 17-Jul-2024 20:07                4755
mongodb-driver-monitoring-sdamsubscriber.server..> 17-Jul-2024 20:07                5317
mongodb-driver-monitoring-sdamsubscriber.server..> 17-Jul-2024 20:07                5380
mongodb-driver-monitoring-sdamsubscriber.server..> 17-Jul-2024 20:07                5390
mongodb-driver-monitoring-sdamsubscriber.server..> 17-Jul-2024 20:07                4785
mongodb-driver-monitoring-sdamsubscriber.topolo..> 17-Jul-2024 20:07                4856
mongodb-driver-monitoring-sdamsubscriber.topolo..> 17-Jul-2024 20:07                4797
mongodb-driver-monitoring-sdamsubscriber.topolo..> 17-Jul-2024 20:07                4780
mongodb-driver-monitoring-serverchangedevent.ge..> 17-Jul-2024 20:07                3190
mongodb-driver-monitoring-serverchangedevent.ge..> 17-Jul-2024 20:07                3506
mongodb-driver-monitoring-serverchangedevent.ge..> 17-Jul-2024 20:07                3258
mongodb-driver-monitoring-serverchangedevent.ge..> 17-Jul-2024 20:07                3583
mongodb-driver-monitoring-serverchangedevent.ge..> 17-Jul-2024 20:07                3306
mongodb-driver-monitoring-serverclosedevent.get..> 17-Jul-2024 20:07                3152
mongodb-driver-monitoring-serverclosedevent.get..> 17-Jul-2024 20:07                3202
mongodb-driver-monitoring-serverclosedevent.get..> 17-Jul-2024 20:07                3262
mongodb-driver-monitoring-serverheartbeatfailed..> 17-Jul-2024 20:07                3638
mongodb-driver-monitoring-serverheartbeatfailed..> 17-Jul-2024 20:07                3490
mongodb-driver-monitoring-serverheartbeatfailed..> 17-Jul-2024 20:07                3327
mongodb-driver-monitoring-serverheartbeatfailed..> 17-Jul-2024 20:07                3356
mongodb-driver-monitoring-serverheartbeatfailed..> 17-Jul-2024 20:07                3711
mongodb-driver-monitoring-serverheartbeatstarte..> 17-Jul-2024 20:07                3332
mongodb-driver-monitoring-serverheartbeatstarte..> 17-Jul-2024 20:07                3374
mongodb-driver-monitoring-serverheartbeatstarte..> 17-Jul-2024 20:07                3731
mongodb-driver-monitoring-serverheartbeatsuccee..> 17-Jul-2024 20:07                3690
mongodb-driver-monitoring-serverheartbeatsuccee..> 17-Jul-2024 20:07                3399
mongodb-driver-monitoring-serverheartbeatsuccee..> 17-Jul-2024 20:07                3408
mongodb-driver-monitoring-serverheartbeatsuccee..> 17-Jul-2024 20:07                4226
mongodb-driver-monitoring-serverheartbeatsuccee..> 17-Jul-2024 20:07                3747
mongodb-driver-monitoring-serveropeningevent.ge..> 17-Jul-2024 20:07                3170
mongodb-driver-monitoring-serveropeningevent.ge..> 17-Jul-2024 20:07                3220
mongodb-driver-monitoring-serveropeningevent.ge..> 17-Jul-2024 20:07                3294
mongodb-driver-monitoring-topologychangedevent...> 17-Jul-2024 20:07                3575
mongodb-driver-monitoring-topologychangedevent...> 17-Jul-2024 20:07                3653
mongodb-driver-monitoring-topologychangedevent...> 17-Jul-2024 20:07                3314
mongodb-driver-monitoring-topologyclosedevent.g..> 17-Jul-2024 20:07                3259
mongodb-driver-monitoring-topologyopeningevent...> 17-Jul-2024 20:07                3269
mongodb-driver-query.construct.php                 17-Jul-2024 20:07               32852
mongodb-driver-readconcern.bsonserialize.php       17-Jul-2024 20:07                6744
mongodb-driver-readconcern.construct.php           17-Jul-2024 20:07                5737
mongodb-driver-readconcern.getlevel.php            17-Jul-2024 20:07                5781
mongodb-driver-readconcern.isdefault.php           17-Jul-2024 20:07                8055
mongodb-driver-readconcern.serialize.php           17-Jul-2024 20:07                3639
mongodb-driver-readconcern.unserialize.php         17-Jul-2024 20:07                4470
mongodb-driver-readpreference.bsonserialize.php    17-Jul-2024 20:07               10364
mongodb-driver-readpreference.construct.php        17-Jul-2024 20:07               18439
mongodb-driver-readpreference.gethedge.php         17-Jul-2024 20:07                3425
mongodb-driver-readpreference.getmaxstalenessse..> 17-Jul-2024 20:07                8153
mongodb-driver-readpreference.getmode.php          17-Jul-2024 20:07                7477
mongodb-driver-readpreference.getmodestring.php    17-Jul-2024 20:07                7683
mongodb-driver-readpreference.gettagsets.php       17-Jul-2024 20:07                8038
mongodb-driver-readpreference.serialize.php        17-Jul-2024 20:07                3716
mongodb-driver-readpreference.unserialize.php      17-Jul-2024 20:07                4549
mongodb-driver-runtimeexception.haserrorlabel.php  17-Jul-2024 20:07                4232
mongodb-driver-server.construct.php                17-Jul-2024 20:07                3379
mongodb-driver-server.executebulkwrite.php         17-Jul-2024 20:07               11507
mongodb-driver-server.executecommand.php           17-Jul-2024 20:07               13341
mongodb-driver-server.executequery.php             17-Jul-2024 20:07                8943
mongodb-driver-server.executereadcommand.php       17-Jul-2024 20:07               10783
mongodb-driver-server.executereadwritecommand.php  17-Jul-2024 20:07               11778
mongodb-driver-server.executewritecommand.php      17-Jul-2024 20:07               11833
mongodb-driver-server.gethost.php                  17-Jul-2024 20:07                5444
mongodb-driver-server.getinfo.php                  17-Jul-2024 20:07               10584
mongodb-driver-server.getlatency.php               17-Jul-2024 20:07                7097
mongodb-driver-server.getport.php                  17-Jul-2024 20:07                5486
mongodb-driver-server.getserverdescription.php     17-Jul-2024 20:07                3430
mongodb-driver-server.gettags.php                  17-Jul-2024 20:07                3786
mongodb-driver-server.gettype.php                  17-Jul-2024 20:07                3822
mongodb-driver-server.isarbiter.php                17-Jul-2024 20:07                3639
mongodb-driver-server.ishidden.php                 17-Jul-2024 20:07                3633
mongodb-driver-server.ispassive.php                17-Jul-2024 20:07                3701
mongodb-driver-server.isprimary.php                17-Jul-2024 20:07                3646
mongodb-driver-server.issecondary.php              17-Jul-2024 20:07                3681
mongodb-driver-serverapi.bsonserialize.php         17-Jul-2024 20:07                3308
mongodb-driver-serverapi.construct.php             17-Jul-2024 20:07                5239
mongodb-driver-serverapi.serialize.php             17-Jul-2024 20:07                3592
mongodb-driver-serverapi.unserialize.php           17-Jul-2024 20:07                4437
mongodb-driver-serverdescription.gethellorespon..> 17-Jul-2024 20:07                5199
mongodb-driver-serverdescription.gethost.php       17-Jul-2024 20:07                3448
mongodb-driver-serverdescription.getlastupdatet..> 17-Jul-2024 20:07                3607
mongodb-driver-serverdescription.getport.php       17-Jul-2024 20:07                3503
mongodb-driver-serverdescription.getroundtripti..> 17-Jul-2024 20:07                3902
mongodb-driver-serverdescription.gettype.php       17-Jul-2024 20:07                3838
mongodb-driver-session.aborttransaction.php        17-Jul-2024 20:07                4197
mongodb-driver-session.advanceclustertime.php      17-Jul-2024 20:07                4886
mongodb-driver-session.advanceoperationtime.php    17-Jul-2024 20:07                4826
mongodb-driver-session.committransaction.php       17-Jul-2024 20:07                5556
mongodb-driver-session.construct.php               17-Jul-2024 20:07                2902
mongodb-driver-session.endsession.php              17-Jul-2024 20:07                4331
mongodb-driver-session.getclustertime.php          17-Jul-2024 20:07                3976
mongodb-driver-session.getlogicalsessionid.php     17-Jul-2024 20:07                3140
mongodb-driver-session.getoperationtime.php        17-Jul-2024 20:07                4056
mongodb-driver-session.getserver.php               17-Jul-2024 20:07                3955
mongodb-driver-session.gettransactionoptions.php   17-Jul-2024 20:07                3831
mongodb-driver-session.gettransactionstate.php     17-Jul-2024 20:07                3735
mongodb-driver-session.isdirty.php                 17-Jul-2024 20:07                3025
mongodb-driver-session.isintransaction.php         17-Jul-2024 20:07                3797
mongodb-driver-session.starttransaction.php        17-Jul-2024 20:07                9082
mongodb-driver-topologydescription.getservers.php  17-Jul-2024 20:07                3467
mongodb-driver-topologydescription.gettype.php     17-Jul-2024 20:07                3515
mongodb-driver-topologydescription.hasreadables..> 17-Jul-2024 20:07                3954
mongodb-driver-topologydescription.haswritables..> 17-Jul-2024 20:07                3235
mongodb-driver-writeconcern.bsonserialize.php      17-Jul-2024 20:07                7189
mongodb-driver-writeconcern.construct.php          17-Jul-2024 20:07               10530
mongodb-driver-writeconcern.getjournal.php         17-Jul-2024 20:07                5967
mongodb-driver-writeconcern.getw.php               17-Jul-2024 20:07                5257
mongodb-driver-writeconcern.getwtimeout.php        17-Jul-2024 20:07                5875
mongodb-driver-writeconcern.isdefault.php          17-Jul-2024 20:07                7842
mongodb-driver-writeconcern.serialize.php          17-Jul-2024 20:07                3664
mongodb-driver-writeconcern.unserialize.php        17-Jul-2024 20:07                4509
mongodb-driver-writeconcernerror.getcode.php       17-Jul-2024 20:07                6295
mongodb-driver-writeconcernerror.getinfo.php       17-Jul-2024 20:07                6621
mongodb-driver-writeconcernerror.getmessage.php    17-Jul-2024 20:07                6386
mongodb-driver-writeerror.getcode.php              17-Jul-2024 20:07                5644
mongodb-driver-writeerror.getindex.php             17-Jul-2024 20:07                6166
mongodb-driver-writeerror.getinfo.php              17-Jul-2024 20:07                3137
mongodb-driver-writeerror.getmessage.php           17-Jul-2024 20:07                5780
mongodb-driver-writeexception.getwriteresult.php   17-Jul-2024 20:07                7899
mongodb-driver-writeresult.getdeletedcount.php     17-Jul-2024 20:07                8136
mongodb-driver-writeresult.getinsertedcount.php    17-Jul-2024 20:07                8218
mongodb-driver-writeresult.getmatchedcount.php     17-Jul-2024 20:07                8781
mongodb-driver-writeresult.getmodifiedcount.php    17-Jul-2024 20:07                9079
mongodb-driver-writeresult.getserver.php           17-Jul-2024 20:07                6511
mongodb-driver-writeresult.getupsertedcount.php    17-Jul-2024 20:07                8307
mongodb-driver-writeresult.getupsertedids.php      17-Jul-2024 20:07                8783
mongodb-driver-writeresult.getwriteconcernerror..> 17-Jul-2024 20:07                7173
mongodb-driver-writeresult.getwriteerrors.php      17-Jul-2024 20:07               12972
mongodb-driver-writeresult.isacknowledged.php      17-Jul-2024 20:07                8148
mongodb.architecture.php                           17-Jul-2024 20:07                1982
mongodb.configuration.php                          17-Jul-2024 20:07                3933
mongodb.connection-handling.php                    17-Jul-2024 20:07                8761
mongodb.constants.php                              17-Jul-2024 20:07                2063
mongodb.exceptions.php                             17-Jul-2024 20:07                5205
mongodb.exceptions.tree.php                        17-Jul-2024 20:07                5633
mongodb.installation.homebrew.php                  17-Jul-2024 20:07                2041
mongodb.installation.manual.php                    17-Jul-2024 20:07                6166
mongodb.installation.pecl.php                      17-Jul-2024 20:07                4949
mongodb.installation.php                           17-Jul-2024 20:07                1816
mongodb.installation.windows.php                   17-Jul-2024 20:07                4231
mongodb.monitoring.php                             17-Jul-2024 20:07               19440
mongodb.overview.php                               17-Jul-2024 20:07                4679
mongodb.persistence.deserialization.php            17-Jul-2024 20:07               21869
mongodb.persistence.php                            17-Jul-2024 20:07                1828
mongodb.persistence.serialization.php              17-Jul-2024 20:07               23141
mongodb.requirements.php                           17-Jul-2024 20:07                3161
mongodb.security.php                               17-Jul-2024 20:07                1544
mongodb.security.request_injection.php             17-Jul-2024 20:07                3044
mongodb.security.script_injection.php              17-Jul-2024 20:07                9233
mongodb.setup.php                                  17-Jul-2024 20:07                2030
mongodb.tutorial.apm.php                           17-Jul-2024 20:07               18800
mongodb.tutorial.library.php                       17-Jul-2024 20:07               10958
mongodb.tutorial.php                               17-Jul-2024 20:07                1749
mqseries.configure.php                             17-Jul-2024 20:07                2731
mqseries.constants.php                             17-Jul-2024 20:07                2694
mqseries.ini.php                                   17-Jul-2024 20:07                1289
mqseries.requirements.php                          17-Jul-2024 20:07                1606
mqseries.resources.php                             17-Jul-2024 20:07                1664
mqseries.setup.php                                 17-Jul-2024 20:07                1590
multipleiterator.attachiterator.php                17-Jul-2024 20:07                4566
multipleiterator.construct.php                     17-Jul-2024 20:07                8655
multipleiterator.containsiterator.php              17-Jul-2024 20:07                3464
multipleiterator.countiterators.php                17-Jul-2024 20:07                3086
multipleiterator.current.php                       17-Jul-2024 20:07                4453
multipleiterator.detachiterator.php                17-Jul-2024 20:07                3198
multipleiterator.getflags.php                      17-Jul-2024 20:07                3224
multipleiterator.key.php                           17-Jul-2024 20:07                4268
multipleiterator.next.php                          17-Jul-2024 20:07                2811
multipleiterator.rewind.php                        17-Jul-2024 20:07                2829
multipleiterator.setflags.php                      17-Jul-2024 20:07                3499
multipleiterator.valid.php                         17-Jul-2024 20:07                3044
mysql-xdevapi-baseresult.getwarnings.php           17-Jul-2024 20:07                6977
mysql-xdevapi-baseresult.getwarningscount.php      17-Jul-2024 20:07                6694
mysql-xdevapi-client.close.php                     17-Jul-2024 20:07                2460
mysql-xdevapi-client.construct.php                 17-Jul-2024 20:07                3437
mysql-xdevapi-client.getsession.php                17-Jul-2024 20:07                2416
mysql-xdevapi-collection.add.php                   17-Jul-2024 20:07                9451
mysql-xdevapi-collection.addorreplaceone.php       17-Jul-2024 20:07                8425
mysql-xdevapi-collection.construct.php             17-Jul-2024 20:07                6462
mysql-xdevapi-collection.count.php                 17-Jul-2024 20:07                6509
mysql-xdevapi-collection.createindex.php           17-Jul-2024 20:07                9365
mysql-xdevapi-collection.dropindex.php             17-Jul-2024 20:07                6958
mysql-xdevapi-collection.existsindatabase.php      17-Jul-2024 20:07                6111
mysql-xdevapi-collection.find.php                  17-Jul-2024 20:07                9697
mysql-xdevapi-collection.getname.php               17-Jul-2024 20:07                5165
mysql-xdevapi-collection.getone.php                17-Jul-2024 20:07                7215
mysql-xdevapi-collection.getschema.php             17-Jul-2024 20:07                5328
mysql-xdevapi-collection.getsession.php            17-Jul-2024 20:07                5543
mysql-xdevapi-collection.modify.php                17-Jul-2024 20:07                8265
mysql-xdevapi-collection.remove.php                17-Jul-2024 20:07                8609
mysql-xdevapi-collection.removeone.php             17-Jul-2024 20:07                7725
mysql-xdevapi-collection.replaceone.php            17-Jul-2024 20:07                8145
mysql-xdevapi-collectionadd.construct.php          17-Jul-2024 20:07                7838
mysql-xdevapi-collectionadd.execute.php            17-Jul-2024 20:07                7813
mysql-xdevapi-collectionfind.bind.php              17-Jul-2024 20:07                8071
mysql-xdevapi-collectionfind.construct.php         17-Jul-2024 20:07                6952
mysql-xdevapi-collectionfind.execute.php           17-Jul-2024 20:07                7315
mysql-xdevapi-collectionfind.fields.php            17-Jul-2024 20:07                7643
mysql-xdevapi-collectionfind.groupby.php           17-Jul-2024 20:07                4452
mysql-xdevapi-collectionfind.having.php            17-Jul-2024 20:07                4518
mysql-xdevapi-collectionfind.limit.php             17-Jul-2024 20:07                8278
mysql-xdevapi-collectionfind.lockexclusive.php     17-Jul-2024 20:07                6858
mysql-xdevapi-collectionfind.lockshared.php        17-Jul-2024 20:07                6633
mysql-xdevapi-collectionfind.offset.php            17-Jul-2024 20:07                8080
mysql-xdevapi-collectionfind.sort.php              17-Jul-2024 20:07                8202
mysql-xdevapi-collectionmodify.arrayappend.php     17-Jul-2024 20:07                8182
mysql-xdevapi-collectionmodify.arrayinsert.php     17-Jul-2024 20:07                8872
mysql-xdevapi-collectionmodify.bind.php            17-Jul-2024 20:07                8253
mysql-xdevapi-collectionmodify.construct.php       17-Jul-2024 20:07                6912
mysql-xdevapi-collectionmodify.execute.php         17-Jul-2024 20:07                3290
mysql-xdevapi-collectionmodify.limit.php           17-Jul-2024 20:07                8709
mysql-xdevapi-collectionmodify.patch.php           17-Jul-2024 20:07                4058
mysql-xdevapi-collectionmodify.replace.php         17-Jul-2024 20:07                7984
mysql-xdevapi-collectionmodify.set.php             17-Jul-2024 20:07                7926
mysql-xdevapi-collectionmodify.skip.php            17-Jul-2024 20:07                4734
mysql-xdevapi-collectionmodify.sort.php            17-Jul-2024 20:07                4744
mysql-xdevapi-collectionmodify.unset.php           17-Jul-2024 20:07                4353
mysql-xdevapi-collectionremove.bind.php            17-Jul-2024 20:07                5130
mysql-xdevapi-collectionremove.construct.php       17-Jul-2024 20:07                7332
mysql-xdevapi-collectionremove.execute.php         17-Jul-2024 20:07                4016
mysql-xdevapi-collectionremove.limit.php           17-Jul-2024 20:07