Index of /php/manual/tr/


../
feeds/                                             13-Apr-2024 02:08                   -
images/                                            13-Apr-2024 02:08                   -
styles/                                            13-Apr-2024 02:07                   -
toc/                                               13-Apr-2024 02:08                   -
about.formats.php                                  13-Apr-2024 02:08                4112
about.generate.php                                 13-Apr-2024 02:08                2657
about.howtohelp.php                                13-Apr-2024 02:08                3374
about.more.php                                     13-Apr-2024 02:08                1794
about.notes.php                                    13-Apr-2024 02:08                2384
about.php                                          13-Apr-2024 02:08                1820
about.phpversions.php                              13-Apr-2024 02:08                3271
about.prototypes.php                               13-Apr-2024 02:08                7445
about.translations.php                             13-Apr-2024 02:08                3118
aliases.php                                        13-Apr-2024 02:08               28946
allowdynamicproperties.construct.php               13-Apr-2024 02:08                2237
apache.configuration.php                           13-Apr-2024 02:08                5590
apache.constants.php                               13-Apr-2024 02:08                1142
apache.installation.php                            13-Apr-2024 02:08                1251
apache.requirements.php                            13-Apr-2024 02:08                1164
apache.resources.php                               13-Apr-2024 02:08                1208
apache.setup.php                                   13-Apr-2024 02:08                1572
apcu.configuration.php                             13-Apr-2024 02:08               16610
apcu.constants.php                                 13-Apr-2024 02:08                7381
apcu.installation.php                              13-Apr-2024 02:08                3179
apcu.requirements.php                              13-Apr-2024 02:08                1150
apcu.resources.php                                 13-Apr-2024 02:08                1194
apcu.setup.php                                     13-Apr-2024 02:08                1528
apcuiterator.construct.php                         13-Apr-2024 02:08                7091
apcuiterator.current.php                           13-Apr-2024 02:08                2988
apcuiterator.gettotalcount.php                     13-Apr-2024 02:08                3155
apcuiterator.gettotalhits.php                      13-Apr-2024 02:08                3291
apcuiterator.gettotalsize.php                      13-Apr-2024 02:08                3032
apcuiterator.key.php                               13-Apr-2024 02:08                2790
apcuiterator.next.php                              13-Apr-2024 02:08                3049
apcuiterator.rewind.php                            13-Apr-2024 02:08                2695
apcuiterator.valid.php                             13-Apr-2024 02:08                2918
appendices.php                                     13-Apr-2024 02:08               12462
appenditerator.append.php                          13-Apr-2024 02:08                5408
appenditerator.construct.php                       13-Apr-2024 02:08               10087
appenditerator.current.php                         13-Apr-2024 02:08                3449
appenditerator.getarrayiterator.php                13-Apr-2024 02:08                3062
appenditerator.getiteratorindex.php                13-Apr-2024 02:08                6592
appenditerator.key.php                             13-Apr-2024 02:08                7862
appenditerator.next.php                            13-Apr-2024 02:08                3334
appenditerator.rewind.php                          13-Apr-2024 02:08                3326
appenditerator.valid.php                           13-Apr-2024 02:08                3323
array.configuration.php                            13-Apr-2024 02:08                1250
array.constants.php                                13-Apr-2024 02:08               12177
array.installation.php                             13-Apr-2024 02:08                1213
array.requirements.php                             13-Apr-2024 02:08                1157
array.resources.php                                13-Apr-2024 02:08                1201
array.setup.php                                    13-Apr-2024 02:08                1536
array.sorting.php                                  13-Apr-2024 02:08                7118
arrayaccess.offsetexists.php                       13-Apr-2024 02:08                9311
arrayaccess.offsetget.php                          13-Apr-2024 02:08                4880
arrayaccess.offsetset.php                          13-Apr-2024 02:08                5144
arrayaccess.offsetunset.php                        13-Apr-2024 02:08                2805
arrayiterator.append.php                           13-Apr-2024 02:08                3499
arrayiterator.asort.php                            13-Apr-2024 02:08                7390
arrayiterator.construct.php                        13-Apr-2024 02:08                3752
arrayiterator.count.php                            13-Apr-2024 02:08                3220
arrayiterator.current.php                          13-Apr-2024 02:08                5167
arrayiterator.getarraycopy.php                     13-Apr-2024 02:08                3067
arrayiterator.getflags.php                         13-Apr-2024 02:08                3058
arrayiterator.key.php                              13-Apr-2024 02:08                3977
arrayiterator.ksort.php                            13-Apr-2024 02:08                7354
arrayiterator.natcasesort.php                      13-Apr-2024 02:08                4728
arrayiterator.natsort.php                          13-Apr-2024 02:08                4619
arrayiterator.next.php                             13-Apr-2024 02:08                4599
arrayiterator.offsetexists.php                     13-Apr-2024 02:08                3302
arrayiterator.offsetget.php                        13-Apr-2024 02:08                3330
arrayiterator.offsetset.php                        13-Apr-2024 02:08                3595
arrayiterator.offsetunset.php                      13-Apr-2024 02:08                3733
arrayiterator.rewind.php                           13-Apr-2024 02:08                4587
arrayiterator.seek.php                             13-Apr-2024 02:08                2583
arrayiterator.serialize.php                        13-Apr-2024 02:08                2862
arrayiterator.setflags.php                         13-Apr-2024 02:08                4098
arrayiterator.uasort.php                           13-Apr-2024 02:08                6453
arrayiterator.uksort.php                           13-Apr-2024 02:08                6345
arrayiterator.unserialize.php                      13-Apr-2024 02:08                3098
arrayiterator.valid.php                            13-Apr-2024 02:08                4657
arrayobject.append.php                             13-Apr-2024 02:08                5449
arrayobject.asort.php                              13-Apr-2024 02:08               10279
arrayobject.construct.php                          13-Apr-2024 02:08                6229
arrayobject.count.php                              13-Apr-2024 02:08                5368
arrayobject.exchangearray.php                      13-Apr-2024 02:08                6458
arrayobject.getarraycopy.php                       13-Apr-2024 02:08                5257
arrayobject.getflags.php                           13-Apr-2024 02:08                6089
arrayobject.getiterator.php                        13-Apr-2024 02:08                5251
arrayobject.getiteratorclass.php                   13-Apr-2024 02:08                6550
arrayobject.ksort.php                              13-Apr-2024 02:08                9949
arrayobject.natcasesort.php                        13-Apr-2024 02:08                8207
arrayobject.natsort.php                            13-Apr-2024 02:08                7901
arrayobject.offsetexists.php                       13-Apr-2024 02:08                4924
arrayobject.offsetget.php                          13-Apr-2024 02:08                5129
arrayobject.offsetset.php                          13-Apr-2024 02:08                6734
arrayobject.offsetunset.php                        13-Apr-2024 02:08                4227
arrayobject.serialize.php                          13-Apr-2024 02:08                5081
arrayobject.setflags.php                           13-Apr-2024 02:08                6668
arrayobject.setiteratorclass.php                   13-Apr-2024 02:08                5813
arrayobject.uasort.php                             13-Apr-2024 02:08               10955
arrayobject.uksort.php                             13-Apr-2024 02:08               10360
arrayobject.unserialize.php                        13-Apr-2024 02:08                3524
attribute.construct.php                            13-Apr-2024 02:08                2326
backedenum.from.php                                13-Apr-2024 02:08                6223
backedenum.tryfrom.php                             13-Apr-2024 02:08                6668
bc.configuration.php                               13-Apr-2024 02:08                2602
bc.constants.php                                   13-Apr-2024 02:08                1111
bc.installation.php                                13-Apr-2024 02:08                1413
bc.requirements.php                                13-Apr-2024 02:08                1136
bc.resources.php                                   13-Apr-2024 02:08                1180
bc.setup.php                                       13-Apr-2024 02:08                1525
book.apache.php                                    13-Apr-2024 02:08                3335
book.apcu.php                                      13-Apr-2024 02:08                4359
book.array.php                                     13-Apr-2024 02:08               13414
book.bc.php                                        13-Apr-2024 02:08                3108
book.bson.php                                      13-Apr-2024 02:08               24512
book.bzip2.php                                     13-Apr-2024 02:08                3028
book.calendar.php                                  13-Apr-2024 02:08                4431
book.classobj.php                                  13-Apr-2024 02:08                4721
book.cmark.php                                     13-Apr-2024 02:08                8711
book.com.php                                       13-Apr-2024 02:08                8468
book.componere.php                                 13-Apr-2024 02:08                6111
book.ctype.php                                     13-Apr-2024 02:08                3344
book.cubrid.php                                    13-Apr-2024 02:08               13834
book.curl.php                                      13-Apr-2024 02:08                7563
book.datetime.php                                  13-Apr-2024 02:08               18032
book.dba.php                                       13-Apr-2024 02:08                3385
book.dbase.php                                     13-Apr-2024 02:08                3193
book.dio.php                                       13-Apr-2024 02:08                3098
book.dir.php                                       13-Apr-2024 02:08                3196
book.dom.php                                       13-Apr-2024 02:08               23118
book.ds.php                                        13-Apr-2024 02:08               25069
book.eio.php                                       13-Apr-2024 02:08                7919
book.enchant.php                                   13-Apr-2024 02:08                5317
book.errorfunc.php                                 13-Apr-2024 02:08                3514
book.ev.php                                        13-Apr-2024 02:08               13344
book.event.php                                     13-Apr-2024 02:08               23111
book.exec.php                                      13-Apr-2024 02:08                3532
book.exif.php                                      13-Apr-2024 02:08                2680
book.expect.php                                    13-Apr-2024 02:08                2459
book.fann.php                                      13-Apr-2024 02:08               23064
book.fdf.php                                       13-Apr-2024 02:08                5611
book.ffi.php                                       13-Apr-2024 02:08                5616
book.fileinfo.php                                  13-Apr-2024 02:08                3199
book.filesystem.php                                13-Apr-2024 02:08               11070
book.filter.php                                    13-Apr-2024 02:08                3399
book.fpm.php                                       13-Apr-2024 02:08                1913
book.ftp.php                                       13-Apr-2024 02:08                6398
book.funchand.php                                  13-Apr-2024 02:08                3979
book.gearman.php                                   13-Apr-2024 02:08               14769
book.gender.php                                    13-Apr-2024 02:08                2516
book.geoip.php                                     13-Apr-2024 02:08                4320
book.gettext.php                                   13-Apr-2024 02:08                3079
book.gmagick.php                                   13-Apr-2024 02:08               22540
book.gmp.php                                       13-Apr-2024 02:08                6505
book.gnupg.php                                     13-Apr-2024 02:08                4849
book.hash.php                                      13-Apr-2024 02:08                4373
book.hrtime.php                                    13-Apr-2024 02:08                3455
book.ibase.php                                     13-Apr-2024 02:08               12146
book.ibm-db2.php                                   13-Apr-2024 02:08                8609
book.iconv.php                                     13-Apr-2024 02:08                3404
book.igbinary.php                                  13-Apr-2024 02:08                2084
book.image.php                                     13-Apr-2024 02:08               18484
book.imagick.php                                   13-Apr-2024 02:08               75553
book.imap.php                                      13-Apr-2024 02:08               11536
book.info.php                                      13-Apr-2024 02:08                9472
book.inotify.php                                   13-Apr-2024 02:08                2518
book.intl.php                                      13-Apr-2024 02:08               46870
book.json.php                                      13-Apr-2024 02:08                2943
book.ldap.php                                      13-Apr-2024 02:08                9108
book.libxml.php                                    13-Apr-2024 02:08                3334
book.lua.php                                       13-Apr-2024 02:08                2604
book.luasandbox.php                                13-Apr-2024 02:08                5526
book.lzf.php                                       13-Apr-2024 02:08                2236
book.mail.php                                      13-Apr-2024 02:08                2070
book.mailparse.php                                 13-Apr-2024 02:08                3875
book.math.php                                      13-Apr-2024 02:08                5299
book.mbstring.php                                  13-Apr-2024 02:08               12004
book.mcrypt.php                                    13-Apr-2024 02:08                6850
book.memcache.php                                  13-Apr-2024 02:08                4187
book.memcached.php                                 13-Apr-2024 02:08                8034
book.mhash.php                                     13-Apr-2024 02:08                2546
book.misc.php                                      13-Apr-2024 02:08                5791
book.mongodb.php                                   13-Apr-2024 02:08               26800
book.mqseries.php                                  13-Apr-2024 02:08                3140
book.mysql-xdevapi.php                             13-Apr-2024 02:08               28975
book.mysql.php                                     13-Apr-2024 02:08                7943
book.mysqli.php                                    13-Apr-2024 02:08               18037
book.mysqlnd.php                                   13-Apr-2024 02:08                2417
book.network.php                                   13-Apr-2024 02:08                6325
book.oauth.php                                     13-Apr-2024 02:08                7152
book.oci8.php                                      13-Apr-2024 02:08               16893
book.opcache.php                                   13-Apr-2024 02:08                2654
book.openal.php                                    13-Apr-2024 02:08                4401
book.openssl.php                                   13-Apr-2024 02:08               11907
book.outcontrol.php                                13-Apr-2024 02:08                4396
book.parallel.php                                  13-Apr-2024 02:08                5669
book.parle.php                                     13-Apr-2024 02:08                9199
book.password.php                                  13-Apr-2024 02:08                2587
book.pcntl.php                                     13-Apr-2024 02:08                5519
book.pcre.php                                      13-Apr-2024 02:08                4015
book.pdo.php                                       13-Apr-2024 02:08                8680
book.pgsql.php                                     13-Apr-2024 02:08               12414
book.phar.php                                      13-Apr-2024 02:08               15668
book.phpdbg.php                                    13-Apr-2024 02:08                2886
book.posix.php                                     13-Apr-2024 02:08                7513
book.ps.php                                        13-Apr-2024 02:08                9158
book.pspell.php                                    13-Apr-2024 02:08                4396
book.pthreads.php                                  13-Apr-2024 02:08                5408
book.quickhash.php                                 13-Apr-2024 02:08                8874
book.radius.php                                    13-Apr-2024 02:08                5505
book.random.php                                    13-Apr-2024 02:08                9046
book.rar.php                                       13-Apr-2024 02:08                5223
book.readline.php                                  13-Apr-2024 02:08                3635
book.recode.php                                    13-Apr-2024 02:08                2291
book.reflection.php                                13-Apr-2024 02:08               40158
book.rnp.php                                       13-Apr-2024 02:08                6009
book.rpminfo.php                                   13-Apr-2024 02:08                2481
book.rrd.php                                       13-Apr-2024 02:08                5066
book.runkit7.php                                   13-Apr-2024 02:08                4191
book.scoutapm.php                                  13-Apr-2024 02:08                2143
book.seaslog.php                                   13-Apr-2024 02:08                5153
book.sem.php                                       13-Apr-2024 02:08                4118
book.session.php                                   13-Apr-2024 02:08                8434
book.shmop.php                                     13-Apr-2024 02:08                2767
book.simdjson.php                                  13-Apr-2024 02:08                2588
book.simplexml.php                                 13-Apr-2024 02:08                5748
book.snmp.php                                      13-Apr-2024 02:08                5801
book.soap.php                                      13-Apr-2024 02:08                6048
book.sockets.php                                   13-Apr-2024 02:08                7370
book.sodium.php                                    13-Apr-2024 02:08               17266
book.solr.php                                      13-Apr-2024 02:08               53100
book.spl.php                                       13-Apr-2024 02:08                9975
book.sqlite3.php                                   13-Apr-2024 02:08                7647
book.sqlsrv.php                                    13-Apr-2024 02:08                5300
book.ssdeep.php                                    13-Apr-2024 02:08                2276
book.ssh2.php                                      13-Apr-2024 02:08                5806
book.stats.php                                     13-Apr-2024 02:08               11768
book.stomp.php                                     13-Apr-2024 02:08                4099
book.stream.php                                    13-Apr-2024 02:08               12806
book.strings.php                                   13-Apr-2024 02:08               14694
book.svm.php                                       13-Apr-2024 02:08                3632
book.svn.php                                       13-Apr-2024 02:08                7556
book.swoole.php                                    13-Apr-2024 02:08               37277
book.sync.php                                      13-Apr-2024 02:08                4731
book.taint.php                                     13-Apr-2024 02:08                2472
book.tcpwrap.php                                   13-Apr-2024 02:08                2015
book.tidy.php                                      13-Apr-2024 02:08                7422
book.tokenizer.php                                 13-Apr-2024 02:08                3238
book.trader.php                                    13-Apr-2024 02:08               17454
book.ui.php                                        13-Apr-2024 02:08               27846
book.uodbc.php                                     13-Apr-2024 02:08                7906
book.uopz.php                                      13-Apr-2024 02:08                5059
book.url.php                                       13-Apr-2024 02:08                3084
book.v8js.php                                      13-Apr-2024 02:08                3048
book.var.php                                       13-Apr-2024 02:08                6227
book.var_representation.php                        13-Apr-2024 02:08                2067
book.varnish.php                                   13-Apr-2024 02:08                5324
book.wddx.php                                      13-Apr-2024 02:08                2815
book.win32service.php                              13-Apr-2024 02:08                5193
book.wincache.php                                  13-Apr-2024 02:08                5563
book.wkhtmltox.php                                 13-Apr-2024 02:08                3260
book.xattr.php                                     13-Apr-2024 02:08                2469
book.xdiff.php                                     13-Apr-2024 02:08                4329
book.xhprof.php                                    13-Apr-2024 02:08                2413
book.xlswriter.php                                 13-Apr-2024 02:08                4371
book.xml.php                                       13-Apr-2024 02:08                6017
book.xmldiff.php                                   13-Apr-2024 02:08                3040
book.xmlreader.php                                 13-Apr-2024 02:08                5378
book.xmlrpc.php                                    13-Apr-2024 02:08                4093
book.xmlwriter.php                                 13-Apr-2024 02:08                7247
book.xsl.php                                       13-Apr-2024 02:08                3986
book.yac.php                                       13-Apr-2024 02:08                2549
book.yaconf.php                                    13-Apr-2024 02:08                2090
book.yaf.php                                       13-Apr-2024 02:08               34606
book.yaml.php                                      13-Apr-2024 02:08                2722
book.yar.php                                       13-Apr-2024 02:08                3640
book.yaz.php                                       13-Apr-2024 02:08                4645
book.zip.php                                       13-Apr-2024 02:08               10528
book.zlib.php                                      13-Apr-2024 02:08                5583
book.zmq.php                                       13-Apr-2024 02:08                5427
book.zookeeper.php                                 13-Apr-2024 02:08                6605
bzip2.configuration.php                            13-Apr-2024 02:08                1250
bzip2.constants.php                                13-Apr-2024 02:08                1134
bzip2.examples.php                                 13-Apr-2024 02:08                4044
bzip2.installation.php                             13-Apr-2024 02:08                1371
bzip2.requirements.php                             13-Apr-2024 02:08                1347
bzip2.resources.php                                13-Apr-2024 02:08                1270
bzip2.setup.php                                    13-Apr-2024 02:08                1559
cachingiterator.construct.php                      13-Apr-2024 02:08                2790
cachingiterator.count.php                          13-Apr-2024 02:08                2482
cachingiterator.current.php                        13-Apr-2024 02:08                2808
cachingiterator.getcache.php                       13-Apr-2024 02:08                5847
cachingiterator.getflags.php                       13-Apr-2024 02:08                2476
cachingiterator.hasnext.php                        13-Apr-2024 02:08                2604
cachingiterator.key.php                            13-Apr-2024 02:08                2180
cachingiterator.next.php                           13-Apr-2024 02:08                2398
cachingiterator.offsetexists.php                   13-Apr-2024 02:08                2934
cachingiterator.offsetget.php                      13-Apr-2024 02:08                2682
cachingiterator.offsetset.php                      13-Apr-2024 02:08                3050
cachingiterator.offsetunset.php                    13-Apr-2024 02:08                2723
cachingiterator.rewind.php                         13-Apr-2024 02:08                2414
cachingiterator.setflags.php                       13-Apr-2024 02:08                2755
cachingiterator.tostring.php                       13-Apr-2024 02:08                2614
cachingiterator.valid.php                          13-Apr-2024 02:08                2651
calendar.configuration.php                         13-Apr-2024 02:08                1271
calendar.constants.php                             13-Apr-2024 02:08               12915
calendar.installation.php                          13-Apr-2024 02:08                1475
calendar.requirements.php                          13-Apr-2024 02:08                1178
calendar.resources.php                             13-Apr-2024 02:08                1222
calendar.setup.php                                 13-Apr-2024 02:08                1596
callbackfilteriterator.accept.php                  13-Apr-2024 02:08                3568
callbackfilteriterator.construct.php               13-Apr-2024 02:08                3916
cc.license.php                                     13-Apr-2024 02:08               20682
changelog.misc.php                                 13-Apr-2024 02:08                1262
changelog.mysql.php                                13-Apr-2024 02:08                2498
changelog.mysql_xdevapi.php                        13-Apr-2024 02:08                2296
changelog.mysqli.php                               13-Apr-2024 02:08                1305
changelog.strings.php                              13-Apr-2024 02:08                1341
class.addressinfo.php                              13-Apr-2024 02:08                1707
class.allowdynamicproperties.php                   13-Apr-2024 02:08                5026
class.apcuiterator.php                             13-Apr-2024 02:08                7291
class.appenditerator.php                           13-Apr-2024 02:08                7847
class.argumentcounterror.php                       13-Apr-2024 02:08                8677
class.arithmeticerror.php                          13-Apr-2024 02:08                8753
class.arrayaccess.php                              13-Apr-2024 02:08               11801
class.arrayiterator.php                            13-Apr-2024 02:08               16789
class.arrayobject.php                              13-Apr-2024 02:08               16644
class.assertionerror.php                           13-Apr-2024 02:08                8432
class.attribute.php                                13-Apr-2024 02:08                8667
class.backedenum.php                               13-Apr-2024 02:08                4325
class.badfunctioncallexception.php                 13-Apr-2024 02:08                8556
class.badmethodcallexception.php                   13-Apr-2024 02:08                8573
class.cachingiterator.php                          13-Apr-2024 02:08               17200
class.callbackfilteriterator.php                   13-Apr-2024 02:08               11434
class.closedgeneratorexception.php                 13-Apr-2024 02:08                8708
class.closure.php                                  13-Apr-2024 02:08                6971
class.collator.php                                 13-Apr-2024 02:08               37387
class.collectable.php                              13-Apr-2024 02:08                2501
class.com-exception.php                            13-Apr-2024 02:08                8383
class.com-safearray-proxy.php                      13-Apr-2024 02:08                1867
class.com.php                                      13-Apr-2024 02:08               12485
class.commonmark-cql.php                           13-Apr-2024 02:08                7298
class.commonmark-interfaces-ivisitable.php         13-Apr-2024 02:08                2943
class.commonmark-interfaces-ivisitor.php           13-Apr-2024 02:08                4538
class.commonmark-node-blockquote.php               13-Apr-2024 02:08                8414
class.commonmark-node-bulletlist.php               13-Apr-2024 02:08               10586
class.commonmark-node-code.php                     13-Apr-2024 02:08                9408
class.commonmark-node-codeblock.php                13-Apr-2024 02:08               10790
class.commonmark-node-customblock.php              13-Apr-2024 02:08                9163
class.commonmark-node-custominline.php             13-Apr-2024 02:08                9143
class.commonmark-node-document.php                 13-Apr-2024 02:08                8376
class.commonmark-node-heading.php                  13-Apr-2024 02:08                9767
class.commonmark-node-htmlblock.php                13-Apr-2024 02:08                9466
class.commonmark-node-htmlinline.php               13-Apr-2024 02:08                9442
class.commonmark-node-image.php                    13-Apr-2024 02:08               10675
class.commonmark-node-item.php                     13-Apr-2024 02:08                8381
class.commonmark-node-linebreak.php                13-Apr-2024 02:08                8395
class.commonmark-node-link.php                     13-Apr-2024 02:08               10668
class.commonmark-node-orderedlist.php              13-Apr-2024 02:08               11552
class.commonmark-node-paragraph.php                13-Apr-2024 02:08                8420
class.commonmark-node-softbreak.php                13-Apr-2024 02:08                8413
class.commonmark-node-text-emphasis.php            13-Apr-2024 02:08                8442
class.commonmark-node-text-strong.php              13-Apr-2024 02:08                8431
class.commonmark-node-text.php                     13-Apr-2024 02:08                9805
class.commonmark-node-thematicbreak.php            13-Apr-2024 02:08                8442
class.commonmark-node.php                          13-Apr-2024 02:08                9316
class.commonmark-parser.php                        13-Apr-2024 02:08                3798
class.compersisthelper.php                         13-Apr-2024 02:08                7411
class.compileerror.php                             13-Apr-2024 02:08                8365
class.componere-abstract-definition.php            13-Apr-2024 02:08                4693
class.componere-definition.php                     13-Apr-2024 02:08               10215
class.componere-method.php                         13-Apr-2024 02:08                4290
class.componere-patch.php                          13-Apr-2024 02:08                8310
class.componere-value.php                          13-Apr-2024 02:08                5393
class.countable.php                                13-Apr-2024 02:08                2527
class.curlfile.php                                 13-Apr-2024 02:08                8400
class.curlhandle.php                               13-Apr-2024 02:08                1742
class.curlmultihandle.php                          13-Apr-2024 02:08                1780
class.curlsharehandle.php                          13-Apr-2024 02:08                1777
class.curlstringfile.php                           13-Apr-2024 02:08                5574
class.dateerror.php                                13-Apr-2024 02:08                9013
class.dateexception.php                            13-Apr-2024 02:08                9656
class.dateinterval.php                             13-Apr-2024 02:08               13944
class.dateinvalidoperationexception.php            13-Apr-2024 02:08                9119
class.dateinvalidtimezoneexception.php             13-Apr-2024 02:08                8697
class.datemalformedintervalstringexception.php     13-Apr-2024 02:08                8796
class.datemalformedperiodstringexception.php       13-Apr-2024 02:08                8778
class.datemalformedstringexception.php             13-Apr-2024 02:08                9077
class.dateobjecterror.php                          13-Apr-2024 02:08                8835
class.dateperiod.php                               13-Apr-2024 02:08               22362
class.daterangeerror.php                           13-Apr-2024 02:08                9023
class.datetime.php                                 13-Apr-2024 02:08               23240
class.datetimeimmutable.php                        13-Apr-2024 02:08               23338
class.datetimeinterface.php                        13-Apr-2024 02:08               19847
class.datetimezone.php                             13-Apr-2024 02:08               16834
class.deflatecontext.php                           13-Apr-2024 02:08                1772
class.directory.php                                13-Apr-2024 02:08                5489
class.directoryiterator.php                        13-Apr-2024 02:08               19976
class.divisionbyzeroerror.php                      13-Apr-2024 02:08                8404
class.domainexception.php                          13-Apr-2024 02:08                8488
class.domattr.php                                  13-Apr-2024 02:08               27504
class.domcdatasection.php                          13-Apr-2024 02:08               31314
class.domcharacterdata.php                         13-Apr-2024 02:08               32657
class.domchildnode.php                             13-Apr-2024 02:08                4184
class.domcomment.php                               13-Apr-2024 02:08               30037
class.domdocument.php                              13-Apr-2024 02:08               68348
class.domdocumentfragment.php                      13-Apr-2024 02:08               28335
class.domdocumenttype.php                          13-Apr-2024 02:08               26452
class.domelement.php                               13-Apr-2024 02:08               52195
class.domentity.php                                13-Apr-2024 02:08               27080
class.domentityreference.php                       13-Apr-2024 02:08               22573
class.domexception.php                             13-Apr-2024 02:08                9334
class.domimplementation.php                        13-Apr-2024 02:08                5887
class.domnamednodemap.php                          13-Apr-2024 02:08                7502
class.domnamespacenode.php                         13-Apr-2024 02:08                9373
class.domnode.php                                  13-Apr-2024 02:08               31491
class.domnodelist.php                              13-Apr-2024 02:08                6072
class.domnotation.php                              13-Apr-2024 02:08               22881
class.domparentnode.php                            13-Apr-2024 02:08                3854
class.domprocessinginstruction.php                 13-Apr-2024 02:08               24120
class.domtext.php                                  13-Apr-2024 02:08               33035
class.domxpath.php                                 13-Apr-2024 02:08                8757
class.dotnet.php                                   13-Apr-2024 02:08                7089
class.ds-collection.php                            13-Apr-2024 02:08                5974
class.ds-deque.php                                 13-Apr-2024 02:08               22065
class.ds-hashable.php                              13-Apr-2024 02:08                4066
class.ds-map.php                                   13-Apr-2024 02:08               23005
class.ds-pair.php                                  13-Apr-2024 02:08                4542
class.ds-priorityqueue.php                         13-Apr-2024 02:08                8324
class.ds-queue.php                                 13-Apr-2024 02:08                7808
class.ds-sequence.php                              13-Apr-2024 02:08               23590
class.ds-set.php                                   13-Apr-2024 02:08               18536
class.ds-stack.php                                 13-Apr-2024 02:08                7141
class.ds-vector.php                                13-Apr-2024 02:08               21601
class.emptyiterator.php                            13-Apr-2024 02:08                4029
class.enchantbroker.php                            13-Apr-2024 02:08                1784
class.enchantdictionary.php                        13-Apr-2024 02:08                1774
class.error.php                                    13-Apr-2024 02:08               10903
class.errorexception.php                           13-Apr-2024 02:08               14699
class.ev.php                                       13-Apr-2024 02:08               42297
class.evcheck.php                                  13-Apr-2024 02:08               10805
class.evchild.php                                  13-Apr-2024 02:08               12478
class.evembed.php                                  13-Apr-2024 02:08                9971
class.event.php                                    13-Apr-2024 02:08               18394
class.eventbase.php                                13-Apr-2024 02:08               14853
class.eventbuffer.php                              13-Apr-2024 02:08               23346
class.eventbufferevent.php                         13-Apr-2024 02:08               37838
class.eventconfig.php                              13-Apr-2024 02:08                7788
class.eventdnsbase.php                             13-Apr-2024 02:08               14223
class.eventexception.php                           13-Apr-2024 02:08                8504
class.eventhttp.php                                13-Apr-2024 02:08                9656
class.eventhttpconnection.php                      13-Apr-2024 02:08               10472
class.eventhttprequest.php                         13-Apr-2024 02:08               22809
class.eventlistener.php                            13-Apr-2024 02:08               12742
class.eventsslcontext.php                          13-Apr-2024 02:08               19107
class.eventutil.php                                13-Apr-2024 02:08               25508
class.evfork.php                                   13-Apr-2024 02:08                8971
class.evidle.php                                   13-Apr-2024 02:08                9798
class.evio.php                                     13-Apr-2024 02:08               12585
class.evloop.php                                   13-Apr-2024 02:08               31478
class.evperiodic.php                               13-Apr-2024 02:08               14900
class.evprepare.php                                13-Apr-2024 02:08               10944
class.evsignal.php                                 13-Apr-2024 02:08               11889
class.evstat.php                                   13-Apr-2024 02:08               14365
class.evtimer.php                                  13-Apr-2024 02:08               14278
class.evwatcher.php                                13-Apr-2024 02:08                9939
class.exception.php                                13-Apr-2024 02:08               11095
class.fannconnection.php                           13-Apr-2024 02:08                6510
class.ffi-cdata.php                                13-Apr-2024 02:08                6121
class.ffi-ctype.php                                13-Apr-2024 02:08               31206
class.ffi-exception.php                            13-Apr-2024 02:08                8190
class.ffi-parserexception.php                      13-Apr-2024 02:08                8245
class.ffi.php                                      13-Apr-2024 02:08               18338
class.fiber.php                                    13-Apr-2024 02:08                7905
class.fibererror.php                               13-Apr-2024 02:08                8064
class.filesystemiterator.php                       13-Apr-2024 02:08               31734
class.filteriterator.php                           13-Apr-2024 02:08                7281
class.finfo.php                                    13-Apr-2024 02:08                6255
class.ftp-connection.php                           13-Apr-2024 02:08                1760
class.gdfont.php                                   13-Apr-2024 02:08                1691
class.gdimage.php                                  13-Apr-2024 02:08                1688
class.gearmanclient.php                            13-Apr-2024 02:08               37732
class.gearmanexception.php                         13-Apr-2024 02:08                7198
class.gearmanjob.php                               13-Apr-2024 02:08                9194
class.gearmantask.php                              13-Apr-2024 02:08                8837
class.gearmanworker.php                            13-Apr-2024 02:08               13408
class.gender.php                                   13-Apr-2024 02:08               42179
class.generator.php                                13-Apr-2024 02:08                6640
class.globiterator.php                             13-Apr-2024 02:08               26468
class.gmagick.php                                  13-Apr-2024 02:08               87020
class.gmagickdraw.php                              13-Apr-2024 02:08               24412
class.gmagickpixel.php                             13-Apr-2024 02:08                5889
class.gmp.php                                      13-Apr-2024 02:08                4130
class.hashcontext.php                              13-Apr-2024 02:08                3324
class.hrtime-performancecounter.php                13-Apr-2024 02:08                3792
class.hrtime-stopwatch.php                         13-Apr-2024 02:08                7014
class.hrtime-unit.php                              13-Apr-2024 02:08                4380
class.imagick.php                                  13-Apr-2024 02:08              296658
class.imagickdraw.php                              13-Apr-2024 02:08               85533
class.imagickkernel.php                            13-Apr-2024 02:08                6501
class.imagickpixel.php                             13-Apr-2024 02:08               13967
class.imagickpixeliterator.php                     13-Apr-2024 02:08                9944
class.imap-connection.php                          13-Apr-2024 02:08                1767
class.infiniteiterator.php                         13-Apr-2024 02:08                5266
class.inflatecontext.php                           13-Apr-2024 02:08                1754
class.internaliterator.php                         13-Apr-2024 02:08                4796
class.intlbreakiterator.php                        13-Apr-2024 02:08               30466
class.intlcalendar.php                             13-Apr-2024 02:08               72071
class.intlchar.php                                 13-Apr-2024 02:08              473286
class.intlcodepointbreakiterator.php               13-Apr-2024 02:08               21498
class.intldateformatter.php                        13-Apr-2024 02:08               32946
class.intldatepatterngenerator.php                 13-Apr-2024 02:08                4683
class.intlexception.php                            13-Apr-2024 02:08                8607
class.intlgregoriancalendar.php                    13-Apr-2024 02:08               52925
class.intliterator.php                             13-Apr-2024 02:08                5013
class.intlpartsiterator.php                        13-Apr-2024 02:08                7101
class.intlrulebasedbreakiterator.php               13-Apr-2024 02:08               24413
class.intltimezone.php                             13-Apr-2024 02:08               28297
class.invalidargumentexception.php                 13-Apr-2024 02:08                8511
class.iterator.php                                 13-Apr-2024 02:08               11423
class.iteratoraggregate.php                        13-Apr-2024 02:08                6785
class.iteratoriterator.php                         13-Apr-2024 02:08                6262
class.jsonexception.php                            13-Apr-2024 02:08                9082
class.jsonserializable.php                         13-Apr-2024 02:08                2774
class.ldap-connection.php                          13-Apr-2024 02:08                1769
class.ldap-result-entry.php                        13-Apr-2024 02:08                1784
class.ldap-result.php                              13-Apr-2024 02:08                1761
class.lengthexception.php                          13-Apr-2024 02:08                8437
class.libxmlerror.php                              13-Apr-2024 02:08                5642
class.limititerator.php                            13-Apr-2024 02:08               11215
class.locale.php                                   13-Apr-2024 02:08               28972
class.logicexception.php                           13-Apr-2024 02:08                8497
class.lua.php                                      13-Apr-2024 02:08                7729
class.luaclosure.php                               13-Apr-2024 02:08                2642
class.luasandbox.php                               13-Apr-2024 02:08               14115
class.luasandboxerror.php                          13-Apr-2024 02:08               10071
class.luasandboxerrorerror.php                     13-Apr-2024 02:08                7609
class.luasandboxfatalerror.php                     13-Apr-2024 02:08                7731
class.luasandboxfunction.php                       13-Apr-2024 02:08                3901
class.luasandboxmemoryerror.php                    13-Apr-2024 02:08                7927
class.luasandboxruntimeerror.php                   13-Apr-2024 02:08                7751
class.luasandboxsyntaxerror.php                    13-Apr-2024 02:08                7613
class.luasandboxtimeouterror.php                   13-Apr-2024 02:08                7910
class.memcache.php                                 13-Apr-2024 02:08               19125
class.memcached.php                                13-Apr-2024 02:08               47460
class.memcachedexception.php                       13-Apr-2024 02:08                7492
class.messageformatter.php                         13-Apr-2024 02:08               12541
class.mongodb-bson-binary.php                      13-Apr-2024 02:08               16865
class.mongodb-bson-binaryinterface.php             13-Apr-2024 02:08                4693
class.mongodb-bson-dbpointer.php                   13-Apr-2024 02:08                6014
class.mongodb-bson-decimal128.php                  13-Apr-2024 02:08                7798
class.mongodb-bson-decimal128interface.php         13-Apr-2024 02:08                3820
class.mongodb-bson-document.php                    13-Apr-2024 02:08               11289
class.mongodb-bson-int64.php                       13-Apr-2024 02:08                7484
class.mongodb-bson-iterator.php                    13-Apr-2024 02:08                4966
class.mongodb-bson-javascript.php                  13-Apr-2024 02:08                8746
class.mongodb-bson-javascriptinterface.php         13-Apr-2024 02:08                4923
class.mongodb-bson-maxkey.php                      13-Apr-2024 02:08                5845
class.mongodb-bson-maxkeyinterface.php             13-Apr-2024 02:08                2181
class.mongodb-bson-minkey.php                      13-Apr-2024 02:08                5836
class.mongodb-bson-minkeyinterface.php             13-Apr-2024 02:08                2162
class.mongodb-bson-objectid.php                    13-Apr-2024 02:08                9205
class.mongodb-bson-objectidinterface.php           13-Apr-2024 02:08                4310
class.mongodb-bson-packedarray.php                 13-Apr-2024 02:08                9075
class.mongodb-bson-persistable.php                 13-Apr-2024 02:08                6129
class.mongodb-bson-regex.php                       13-Apr-2024 02:08                8177
class.mongodb-bson-regexinterface.php              13-Apr-2024 02:08                4712
class.mongodb-bson-serializable.php                13-Apr-2024 02:08                4207
class.mongodb-bson-symbol.php                      13-Apr-2024 02:08                5902
class.mongodb-bson-timestamp.php                   13-Apr-2024 02:08                8424
class.mongodb-bson-timestampinterface.php          13-Apr-2024 02:08                4870
class.mongodb-bson-type.php                        13-Apr-2024 02:08                2007
class.mongodb-bson-undefined.php                   13-Apr-2024 02:08                5990
class.mongodb-bson-unserializable.php              13-Apr-2024 02:08                3950
class.mongodb-bson-utcdatetime.php                 13-Apr-2024 02:08                8024
class.mongodb-bson-utcdatetimeinterface.php        13-Apr-2024 02:08                4383
class.mongodb-driver-bulkwrite.php                 13-Apr-2024 02:08               24105
class.mongodb-driver-clientencryption.php          13-Apr-2024 02:08               23446
class.mongodb-driver-command.php                   13-Apr-2024 02:08               14209
class.mongodb-driver-cursor.php                    13-Apr-2024 02:08               25795
class.mongodb-driver-cursorid.php                  13-Apr-2024 02:08                5533
class.mongodb-driver-cursorinterface.php           13-Apr-2024 02:08                6171
class.mongodb-driver-exception-authenticationex..> 13-Apr-2024 02:08                9163
class.mongodb-driver-exception-bulkwriteexcepti..> 13-Apr-2024 02:08               10017
class.mongodb-driver-exception-commandexception..> 13-Apr-2024 02:08               10919
class.mongodb-driver-exception-connectionexcept..> 13-Apr-2024 02:08                9232
class.mongodb-driver-exception-connectiontimeou..> 13-Apr-2024 02:08                9620
class.mongodb-driver-exception-encryptionexcept..> 13-Apr-2024 02:08                9166
class.mongodb-driver-exception-exception.php       13-Apr-2024 02:08                2176
class.mongodb-driver-exception-executiontimeout..> 13-Apr-2024 02:08               10277
class.mongodb-driver-exception-invalidargumente..> 13-Apr-2024 02:08                8192
class.mongodb-driver-exception-logicexception.php  13-Apr-2024 02:08                8076
class.mongodb-driver-exception-runtimeexception..> 13-Apr-2024 02:08               11674
class.mongodb-driver-exception-serverexception.php 13-Apr-2024 02:08                9243
class.mongodb-driver-exception-sslconnectionexc..> 13-Apr-2024 02:08                9509
class.mongodb-driver-exception-unexpectedvaluee..> 13-Apr-2024 02:08                8209
class.mongodb-driver-exception-writeexception.php  13-Apr-2024 02:08               12192
class.mongodb-driver-manager.php                   13-Apr-2024 02:08               21795
class.mongodb-driver-monitoring-commandfailedev..> 13-Apr-2024 02:08                8039
class.mongodb-driver-monitoring-commandstartede..> 13-Apr-2024 02:08                7543
class.mongodb-driver-monitoring-commandsubscrib..> 13-Apr-2024 02:08                6256
class.mongodb-driver-monitoring-commandsucceede..> 13-Apr-2024 02:08                7621
class.mongodb-driver-monitoring-logsubscriber.php  13-Apr-2024 02:08               10098
class.mongodb-driver-monitoring-sdamsubscriber.php 13-Apr-2024 02:08               11606
class.mongodb-driver-monitoring-serverchangedev..> 13-Apr-2024 02:08                5733
class.mongodb-driver-monitoring-serverclosedeve..> 13-Apr-2024 02:08                4380
class.mongodb-driver-monitoring-serverheartbeat..> 13-Apr-2024 02:08                5731
class.mongodb-driver-monitoring-serverheartbeat..> 13-Apr-2024 02:08                4558
class.mongodb-driver-monitoring-serverheartbeat..> 13-Apr-2024 02:08                5803
class.mongodb-driver-monitoring-serveropeningev..> 13-Apr-2024 02:08                4400
class.mongodb-driver-monitoring-subscriber.php     13-Apr-2024 02:08                2622
class.mongodb-driver-monitoring-topologychanged..> 13-Apr-2024 02:08                4728
class.mongodb-driver-monitoring-topologyclosede..> 13-Apr-2024 02:08                3339
class.mongodb-driver-monitoring-topologyopening..> 13-Apr-2024 02:08                3353
class.mongodb-driver-query.php                     13-Apr-2024 02:08                3412
class.mongodb-driver-readconcern.php               13-Apr-2024 02:08               17694
class.mongodb-driver-readpreference.php            13-Apr-2024 02:08               21896
class.mongodb-driver-server.php                    13-Apr-2024 02:08               27166
class.mongodb-driver-serverapi.php                 13-Apr-2024 02:08               14070
class.mongodb-driver-serverdescription.php         13-Apr-2024 02:08               16864
class.mongodb-driver-session.php                   13-Apr-2024 02:08               15523
class.mongodb-driver-topologydescription.php       13-Apr-2024 02:08               11628
class.mongodb-driver-writeconcern.php              13-Apr-2024 02:08               10281
class.mongodb-driver-writeconcernerror.php         13-Apr-2024 02:08                4371
class.mongodb-driver-writeerror.php                13-Apr-2024 02:08                4695
class.mongodb-driver-writeresult.php               13-Apr-2024 02:08                8673
class.multipleiterator.php                         13-Apr-2024 02:08               11511
class.mysql-xdevapi-baseresult.php                 13-Apr-2024 02:08                3036
class.mysql-xdevapi-client.php                     13-Apr-2024 02:08                3118
class.mysql-xdevapi-collection.php                 13-Apr-2024 02:08               10796
class.mysql-xdevapi-collectionadd.php              13-Apr-2024 02:08                2937
class.mysql-xdevapi-collectionfind.php             13-Apr-2024 02:08                8817
class.mysql-xdevapi-collectionmodify.php           13-Apr-2024 02:08               10274
class.mysql-xdevapi-collectionremove.php           13-Apr-2024 02:08                5211
class.mysql-xdevapi-columnresult.php               13-Apr-2024 02:08                6761
class.mysql-xdevapi-crudoperationbindable.php      13-Apr-2024 02:08                2973
class.mysql-xdevapi-crudoperationlimitable.php     13-Apr-2024 02:08                2979
class.mysql-xdevapi-crudoperationskippable.php     13-Apr-2024 02:08                2990
class.mysql-xdevapi-crudoperationsortable.php      13-Apr-2024 02:08                2966
class.mysql-xdevapi-databaseobject.php             13-Apr-2024 02:08                3537
class.mysql-xdevapi-docresult.php                  13-Apr-2024 02:08                4039
class.mysql-xdevapi-exception.php                  13-Apr-2024 02:08                2192
class.mysql-xdevapi-executable.php                 13-Apr-2024 02:08                2615
class.mysql-xdevapi-executionstatus.php            13-Apr-2024 02:08                4853
class.mysql-xdevapi-expression.php                 13-Apr-2024 02:08                3246
class.mysql-xdevapi-result.php                     13-Apr-2024 02:08                4423
class.mysql-xdevapi-rowresult.php                  13-Apr-2024 02:08                5136
class.mysql-xdevapi-schema.php                     13-Apr-2024 02:08                7850
class.mysql-xdevapi-schemaobject.php               13-Apr-2024 02:08                2800
class.mysql-xdevapi-session.php                    13-Apr-2024 02:08                9700
class.mysql-xdevapi-sqlstatement.php               13-Apr-2024 02:08                6658
class.mysql-xdevapi-sqlstatementresult.php         13-Apr-2024 02:08                7318
class.mysql-xdevapi-statement.php                  13-Apr-2024 02:08                5018
class.mysql-xdevapi-table.php                      13-Apr-2024 02:08                7419
class.mysql-xdevapi-tabledelete.php                13-Apr-2024 02:08                5176
class.mysql-xdevapi-tableinsert.php                13-Apr-2024 02:08                3497
class.mysql-xdevapi-tableselect.php                13-Apr-2024 02:08                8321
class.mysql-xdevapi-tableupdate.php                13-Apr-2024 02:08                6111
class.mysql-xdevapi-warning.php                    13-Apr-2024 02:08                3743
class.mysqli-driver.php                            13-Apr-2024 02:08                7997
class.mysqli-result.php                            13-Apr-2024 02:08               16053
class.mysqli-sql-exception.php                     13-Apr-2024 02:08               10044
class.mysqli-stmt.php                              13-Apr-2024 02:08               18743
class.mysqli-warning.php                           13-Apr-2024 02:08                4377
class.mysqli.php                                   13-Apr-2024 02:08               44883
class.norewinditerator.php                         13-Apr-2024 02:08                6703
class.normalizer.php                               13-Apr-2024 02:08               13806
class.numberformatter.php                          13-Apr-2024 02:08               75069
class.oauth.php                                    13-Apr-2024 02:08               19990
class.oauthexception.php                           13-Apr-2024 02:08                8539
class.oauthprovider.php                            13-Apr-2024 02:08               12914
class.ocicollection.php                            13-Apr-2024 02:08                7097
class.ocilob.php                                   13-Apr-2024 02:08               15326
class.opensslasymmetrickey.php                     13-Apr-2024 02:08                1858
class.opensslcertificate.php                       13-Apr-2024 02:08                1874
class.opensslcertificatesigningrequest.php         13-Apr-2024 02:08                1961
class.outeriterator.php                            13-Apr-2024 02:08                4329
class.outofboundsexception.php                     13-Apr-2024 02:08                8546
class.outofrangeexception.php                      13-Apr-2024 02:08                8548
class.overflowexception.php                        13-Apr-2024 02:08                8467
class.override.php                                 13-Apr-2024 02:08                4037
class.parallel-channel.php                         13-Apr-2024 02:08                8195
class.parallel-events-event-type.php               13-Apr-2024 02:08                3358
class.parallel-events-event.php                    13-Apr-2024 02:08                3511
class.parallel-events-input.php                    13-Apr-2024 02:08                4746
class.parallel-events.php                          13-Apr-2024 02:08                7115
class.parallel-future.php                          13-Apr-2024 02:08                7784
class.parallel-runtime.php                         13-Apr-2024 02:08                6395
class.parallel-sync.php                            13-Apr-2024 02:08                5216
class.parentiterator.php                           13-Apr-2024 02:08                9591
class.parle-errorinfo.php                          13-Apr-2024 02:08                3842
class.parle-lexer.php                              13-Apr-2024 02:08               13171
class.parle-lexerexception.php                     13-Apr-2024 02:08                7748
class.parle-parser.php                             13-Apr-2024 02:08               18099
class.parle-parserexception.php                    13-Apr-2024 02:08                7730
class.parle-rlexer.php                             13-Apr-2024 02:08               15406
class.parle-rparser.php                            13-Apr-2024 02:08               18272
class.parle-stack.php                              13-Apr-2024 02:08                4806
class.parle-token.php                              13-Apr-2024 02:08                4905
class.parseerror.php                               13-Apr-2024 02:08                8945
class.pdo.php                                      13-Apr-2024 02:08               43026
class.pdoexception.php                             13-Apr-2024 02:08               10450
class.pdorow.php                                   13-Apr-2024 02:08                4028
class.pdostatement.php                             13-Apr-2024 02:08               23637
class.pgsql-connection.php                         13-Apr-2024 02:08                1792
class.pgsql-lob.php                                13-Apr-2024 02:08                1734
class.pgsql-result.php                             13-Apr-2024 02:08                1766
class.phar.php                                     13-Apr-2024 02:08               74180
class.phardata.php                                 13-Apr-2024 02:08               49586
class.pharexception.php                            13-Apr-2024 02:08                8436
class.pharfileinfo.php                             13-Apr-2024 02:08               21643
class.php-user-filter.php                          13-Apr-2024 02:08                6498
class.phptoken.php                                 13-Apr-2024 02:08                9016
class.pool.php                                     13-Apr-2024 02:08                7692
class.pspell-config.php                            13-Apr-2024 02:08                1768
class.pspell-dictionary.php                        13-Apr-2024 02:08                1805
class.quickhashinthash.php                         13-Apr-2024 02:08               15080
class.quickhashintset.php                          13-Apr-2024 02:08               12863
class.quickhashintstringhash.php                   13-Apr-2024 02:08               15976
class.quickhashstringinthash.php                   13-Apr-2024 02:08               13645
class.random-brokenrandomengineerror.php           13-Apr-2024 02:08                8528
class.random-cryptosafeengine.php                  13-Apr-2024 02:08                2455
class.random-engine-mt19937.php                    13-Apr-2024 02:08                5347
class.random-engine-pcgoneseq128xslrr64.php        13-Apr-2024 02:08                6161
class.random-engine-secure.php                     13-Apr-2024 02:08                3388
class.random-engine-xoshiro256starstar.php         13-Apr-2024 02:08                6346
class.random-engine.php                            13-Apr-2024 02:08                3741
class.random-randomerror.php                       13-Apr-2024 02:08                8452
class.random-randomexception.php                   13-Apr-2024 02:08                8572
class.random-randomizer.php                        13-Apr-2024 02:08               10551
class.rangeexception.php                           13-Apr-2024 02:08                8676
class.rararchive.php                               13-Apr-2024 02:08                7708
class.rarentry.php                                 13-Apr-2024 02:08               49767
class.rarexception.php                             13-Apr-2024 02:08                8289
class.recursivearrayiterator.php                   13-Apr-2024 02:08               15899
class.recursivecachingiterator.php                 13-Apr-2024 02:08               14107
class.recursivecallbackfilteriterator.php          13-Apr-2024 02:08               13176
class.recursivedirectoryiterator.php               13-Apr-2024 02:08               29801
class.recursivefilteriterator.php                  13-Apr-2024 02:08                8222
class.recursiveiterator.php                        13-Apr-2024 02:08                4867
class.recursiveiteratoriterator.php                13-Apr-2024 02:08               14613
class.recursiveregexiterator.php                   13-Apr-2024 02:08               14745
class.recursivetreeiterator.php                    13-Apr-2024 02:08               25635
class.reflection.php                               13-Apr-2024 02:08                3494
class.reflectionattribute.php                      13-Apr-2024 02:08                6383
class.reflectionclass.php                          13-Apr-2024 02:08               38705
class.reflectionclassconstant.php                  13-Apr-2024 02:08               16357
class.reflectionenum.php                           13-Apr-2024 02:08               31667
class.reflectionenumbackedcase.php                 13-Apr-2024 02:08               12932
class.reflectionenumunitcase.php                   13-Apr-2024 02:08               12562
class.reflectionexception.php                      13-Apr-2024 02:08                8609
class.reflectionextension.php                      13-Apr-2024 02:08               10914
class.reflectionfiber.php                          13-Apr-2024 02:08                4939
class.reflectionfunction.php                       13-Apr-2024 02:08               21385
class.reflectionfunctionabstract.php               13-Apr-2024 02:08               20390
class.reflectiongenerator.php                      13-Apr-2024 02:08                6317
class.reflectionintersectiontype.php               13-Apr-2024 02:08                3425
class.reflectionmethod.php                         13-Apr-2024 02:08               32865
class.reflectionnamedtype.php                      13-Apr-2024 02:08                3738
class.reflectionobject.php                         13-Apr-2024 02:08               29495
class.reflectionparameter.php                      13-Apr-2024 02:08               17047
class.reflectionproperty.php                       13-Apr-2024 02:08               23055
class.reflectionreference.php                      13-Apr-2024 02:08                4112
class.reflectiontype.php                           13-Apr-2024 02:08                4484
class.reflectionuniontype.php                      13-Apr-2024 02:08                3211
class.reflectionzendextension.php                  13-Apr-2024 02:08                7859
class.reflector.php                                13-Apr-2024 02:08                3972
class.regexiterator.php                            13-Apr-2024 02:08               17589
class.resourcebundle.php                           13-Apr-2024 02:08               10412
class.returntypewillchange.php                     13-Apr-2024 02:08                3251
class.rnpffi.php                                   13-Apr-2024 02:08                1625
class.rrdcreator.php                               13-Apr-2024 02:08                4469
class.rrdgraph.php                                 13-Apr-2024 02:08                3891
class.rrdupdater.php                               13-Apr-2024 02:08                3277
class.runtimeexception.php                         13-Apr-2024 02:08                8454
class.seaslog.php                                  13-Apr-2024 02:08               21927
class.seekableiterator.php                         13-Apr-2024 02:08               11288
class.sensitiveparameter.php                       13-Apr-2024 02:08                6331
class.sensitiveparametervalue.php                  13-Apr-2024 02:08                5000
class.serializable.php                             13-Apr-2024 02:08                8342
class.sessionhandler.php                           13-Apr-2024 02:08               25927
class.sessionhandlerinterface.php                  13-Apr-2024 02:08               15773
class.sessionidinterface.php                       13-Apr-2024 02:08                3167
class.sessionupdatetimestamphandlerinterface.php   13-Apr-2024 02:08                4465
class.shmop.php                                    13-Apr-2024 02:08                1666
class.simdjsonexception.php                        13-Apr-2024 02:08                5004
class.simdjsonvalueerror.php                       13-Apr-2024 02:08                8325
class.simplexmlelement.php                         13-Apr-2024 02:08               18870
class.simplexmliterator.php                        13-Apr-2024 02:08               16609
class.snmp.php                                     13-Apr-2024 02:08               28262
class.snmpexception.php                            13-Apr-2024 02:08                9040
class.soapclient.php                               13-Apr-2024 02:08               34231
class.soapfault.php                                13-Apr-2024 02:08               14307
class.soapheader.php                               13-Apr-2024 02:08                6012
class.soapparam.php                                13-Apr-2024 02:08                3690
class.soapserver.php                               13-Apr-2024 02:08                9886
class.soapvar.php                                  13-Apr-2024 02:08                7824
class.socket.php                                   13-Apr-2024 02:08                1730
class.sodiumexception.php                          13-Apr-2024 02:08                8385
class.solrclient.php                               13-Apr-2024 02:08               24690
class.solrclientexception.php                      13-Apr-2024 02:08                9690
class.solrcollapsefunction.php                     13-Apr-2024 02:08               11750
class.solrdismaxquery.php                          13-Apr-2024 02:08              111862
class.solrdocument.php                             13-Apr-2024 02:08               23408
class.solrdocumentfield.php                        13-Apr-2024 02:08                4617
class.solrexception.php                            13-Apr-2024 02:08               10078
class.solrgenericresponse.php                      13-Apr-2024 02:08               12626
class.solrillegalargumentexception.php             13-Apr-2024 02:08                9814
class.solrillegaloperationexception.php            13-Apr-2024 02:08                9852
class.solrinputdocument.php                        13-Apr-2024 02:08               19447
class.solrmissingmandatoryparameterexception.php   13-Apr-2024 02:08                8984
class.solrmodifiableparams.php                     13-Apr-2024 02:08                8944
class.solrobject.php                               13-Apr-2024 02:08                5807
class.solrparams.php                               13-Apr-2024 02:08                9101
class.solrpingresponse.php                         13-Apr-2024 02:08               11095
class.solrquery.php                                13-Apr-2024 02:08              118960
class.solrqueryresponse.php                        13-Apr-2024 02:08               12545
class.solrresponse.php                             13-Apr-2024 02:08               14284
class.solrserverexception.php                      13-Apr-2024 02:08                9696
class.solrupdateresponse.php                       13-Apr-2024 02:08               12593
class.solrutils.php                                13-Apr-2024 02:08                4912
class.spldoublylinkedlist.php                      13-Apr-2024 02:08               17413
class.splfileinfo.php                              13-Apr-2024 02:08               17994
class.splfileobject.php                            13-Apr-2024 02:08               37214
class.splfixedarray.php                            13-Apr-2024 02:08               19830
class.splheap.php                                  13-Apr-2024 02:08                7719
class.splmaxheap.php                               13-Apr-2024 02:08                7163
class.splminheap.php                               13-Apr-2024 02:08                7173
class.splobjectstorage.php                         13-Apr-2024 02:08               21049
class.splobserver.php                              13-Apr-2024 02:08                2796
class.splpriorityqueue.php                         13-Apr-2024 02:08               11756
class.splqueue.php                                 13-Apr-2024 02:08               17127
class.splstack.php                                 13-Apr-2024 02:08               14346
class.splsubject.php                               13-Apr-2024 02:08                3665
class.spltempfileobject.php                        13-Apr-2024 02:08               31778
class.spoofchecker.php                             13-Apr-2024 02:08               17557
class.sqlite3.php                                  13-Apr-2024 02:08               40059
class.sqlite3exception.php                         13-Apr-2024 02:08                8377
class.sqlite3result.php                            13-Apr-2024 02:08                5845
class.sqlite3stmt.php                              13-Apr-2024 02:08                8372
class.stdclass.php                                 13-Apr-2024 02:08                6665
class.stomp.php                                    13-Apr-2024 02:08               21633
class.stompexception.php                           13-Apr-2024 02:08                5845
class.stompframe.php                               13-Apr-2024 02:08                4316
class.streamwrapper.php                            13-Apr-2024 02:08               20738
class.stringable.php                               13-Apr-2024 02:08                8248
class.svm.php                                      13-Apr-2024 02:08               18424
class.svmmodel.php                                 13-Apr-2024 02:08                6889
class.swoole-async.php                             13-Apr-2024 02:08                7981
class.swoole-atomic.php                            13-Apr-2024 02:08                5010
class.swoole-buffer.php                            13-Apr-2024 02:08                7465
class.swoole-channel.php                           13-Apr-2024 02:08                3908
class.swoole-client.php                            13-Apr-2024 02:08               16474
class.swoole-connection-iterator.php               13-Apr-2024 02:08                7461
class.swoole-coroutine.php                         13-Apr-2024 02:08               18597
class.swoole-event.php                             13-Apr-2024 02:08                7404
class.swoole-exception.php                         13-Apr-2024 02:08                4519
class.swoole-http-client.php                       13-Apr-2024 02:08               14724
class.swoole-http-request.php                      13-Apr-2024 02:08                2973
class.swoole-http-response.php                     13-Apr-2024 02:08               10849
class.swoole-http-server.php                       13-Apr-2024 02:08               26383
class.swoole-lock.php                              13-Apr-2024 02:08                4618
class.swoole-mmap.php                              13-Apr-2024 02:08                3019
class.swoole-mysql-exception.php                   13-Apr-2024 02:08                4560
class.swoole-mysql.php                             13-Apr-2024 02:08                5357
class.swoole-process.php                           13-Apr-2024 02:08               13606
class.swoole-redis-server.php                      13-Apr-2024 02:08               32015
class.swoole-serialize.php                         13-Apr-2024 02:08                3551
class.swoole-server.php                            13-Apr-2024 02:08               29516
class.swoole-table.php                             13-Apr-2024 02:08               12664
class.swoole-timer.php                             13-Apr-2024 02:08                4939
class.swoole-websocket-frame.php                   13-Apr-2024 02:08                1892
class.swoole-websocket-server.php                  13-Apr-2024 02:08                7776
class.syncevent.php                                13-Apr-2024 02:08                4837
class.syncmutex.php                                13-Apr-2024 02:08                4163
class.syncreaderwriter.php                         13-Apr-2024 02:08                5146
class.syncsemaphore.php                            13-Apr-2024 02:08                4594
class.syncsharedmemory.php                         13-Apr-2024 02:08                5444
class.sysvmessagequeue.php                         13-Apr-2024 02:08                1776
class.sysvsemaphore.php                            13-Apr-2024 02:08                1761
class.sysvsharedmemory.php                         13-Apr-2024 02:08                1764
class.thread.php                                   13-Apr-2024 02:08               11367
class.threaded.php                                 13-Apr-2024 02:08                8785
class.throwable.php                                13-Apr-2024 02:08                7363
class.tidy.php                                     13-Apr-2024 02:08               16199
class.tidynode.php                                 13-Apr-2024 02:08               12003
class.transliterator.php                           13-Apr-2024 02:08               10122
class.traversable.php                              13-Apr-2024 02:08                4301
class.typeerror.php                                13-Apr-2024 02:08                9418
class.uconverter.php                               13-Apr-2024 02:08               40965
class.ui-area.php                                  13-Apr-2024 02:08               12196
class.ui-control.php                               13-Apr-2024 02:08                5416
class.ui-controls-box.php                          13-Apr-2024 02:08               10063
class.ui-controls-button.php                       13-Apr-2024 02:08                6624
class.ui-controls-check.php                        13-Apr-2024 02:08                7468
class.ui-controls-colorbutton.php                  13-Apr-2024 02:08                6503
class.ui-controls-combo.php                        13-Apr-2024 02:08                6592
class.ui-controls-editablecombo.php                13-Apr-2024 02:08                6704
class.ui-controls-entry.php                        13-Apr-2024 02:08                9586
class.ui-controls-form.php                         13-Apr-2024 02:08                7992
class.ui-controls-grid.php                         13-Apr-2024 02:08               13094
class.ui-controls-group.php                        13-Apr-2024 02:08                8300
class.ui-controls-label.php                        13-Apr-2024 02:08                6375
class.ui-controls-multilineentry.php               13-Apr-2024 02:08                9829
class.ui-controls-picker.php                       13-Apr-2024 02:08                7514
class.ui-controls-progress.php                     13-Apr-2024 02:08                5876
class.ui-controls-radio.php                        13-Apr-2024 02:08                6571
class.ui-controls-separator.php                    13-Apr-2024 02:08                7018
class.ui-controls-slider.php                       13-Apr-2024 02:08                6959
class.ui-controls-spin.php                         13-Apr-2024 02:08                6829
class.ui-controls-tab.php                          13-Apr-2024 02:08                9098
class.ui-draw-brush-gradient.php                   13-Apr-2024 02:08                7284
class.ui-draw-brush-lineargradient.php             13-Apr-2024 02:08                6534
class.ui-draw-brush-radialgradient.php             13-Apr-2024 02:08                6720
class.ui-draw-brush.php                            13-Apr-2024 02:08                4376
class.ui-draw-color.php                            13-Apr-2024 02:08                8524
class.ui-draw-line-cap.php                         13-Apr-2024 02:08                3680
class.ui-draw-line-join.php                        13-Apr-2024 02:08                3664
class.ui-draw-matrix.php                           13-Apr-2024 02:08                5566
class.ui-draw-path.php                             13-Apr-2024 02:08               10702
class.ui-draw-pen.php                              13-Apr-2024 02:08                8073
class.ui-draw-stroke.php                           13-Apr-2024 02:08                6824
class.ui-draw-text-font-descriptor.php             13-Apr-2024 02:08                5986
class.ui-draw-text-font-italic.php                 13-Apr-2024 02:08                4039
class.ui-draw-text-font-stretch.php                13-Apr-2024 02:08                8235
class.ui-draw-text-font-weight.php                 13-Apr-2024 02:08                8837
class.ui-draw-text-font.php                        13-Apr-2024 02:08                4815
class.ui-draw-text-layout.php                      13-Apr-2024 02:08                5225
class.ui-exception-invalidargumentexception.php    13-Apr-2024 02:08                7762
class.ui-exception-runtimeexception.php            13-Apr-2024 02:08                7685
class.ui-executor.php                              13-Apr-2024 02:08                5376
class.ui-key.php                                   13-Apr-2024 02:08               21279
class.ui-menu.php                                  13-Apr-2024 02:08                6234
class.ui-menuitem.php                              13-Apr-2024 02:08                3704
class.ui-point.php                                 13-Apr-2024 02:08                6244
class.ui-size.php                                  13-Apr-2024 02:08                6345
class.ui-window.php                                13-Apr-2024 02:08               13042
class.underflowexception.php                       13-Apr-2024 02:08                8538
class.unexpectedvalueexception.php                 13-Apr-2024 02:08                8700
class.unhandledmatcherror.php                      13-Apr-2024 02:08                8522
class.unitenum.php                                 13-Apr-2024 02:08                2755
class.v8js.php                                     13-Apr-2024 02:08                8997
class.v8jsexception.php                            13-Apr-2024 02:08               11320
class.valueerror.php                               13-Apr-2024 02:08                8516
class.variant.php                                  13-Apr-2024 02:08                5938
class.varnishadmin.php                             13-Apr-2024 02:08               11476
class.varnishlog.php                               13-Apr-2024 02:08               34736
class.varnishstat.php                              13-Apr-2024 02:08                2953
class.volatile.php                                 13-Apr-2024 02:08               11688
class.vtiful-kernel-excel.php                      13-Apr-2024 02:08               11986
class.vtiful-kernel-format.php                     13-Apr-2024 02:08               16019
class.weakmap.php                                  13-Apr-2024 02:08                9271
class.weakreference.php                            13-Apr-2024 02:08                5635
class.win32serviceexception.php                    13-Apr-2024 02:08                7815
class.wkhtmltox-image-converter.php                13-Apr-2024 02:08                4103
class.wkhtmltox-pdf-converter.php                  13-Apr-2024 02:08                4445
class.wkhtmltox-pdf-object.php                     13-Apr-2024 02:08                2939
class.worker.php                                   13-Apr-2024 02:08                8498
class.xmldiff-base.php                             13-Apr-2024 02:08                4060
class.xmldiff-dom.php                              13-Apr-2024 02:08                5027
class.xmldiff-file.php                             13-Apr-2024 02:08                5003
class.xmldiff-memory.php                           13-Apr-2024 02:08                5035
class.xmlparser.php                                13-Apr-2024 02:08                1790
class.xmlreader.php                                13-Apr-2024 02:08               40172
class.xmlwriter.php                                13-Apr-2024 02:08               33155
class.xsltprocessor.php                            13-Apr-2024 02:08               11757
class.yac.php                                      13-Apr-2024 02:08                9506
class.yaconf.php                                   13-Apr-2024 02:08                3435
class.yaf-action-abstract.php                      13-Apr-2024 02:08               12684
class.yaf-application.php                          13-Apr-2024 02:08               12750
class.yaf-bootstrap-abstract.php                   13-Apr-2024 02:08                5504
class.yaf-config-abstract.php                      13-Apr-2024 02:08                5170
class.yaf-config-ini.php                           13-Apr-2024 02:08               17761
class.yaf-config-simple.php                        13-Apr-2024 02:08               13186
class.yaf-controller-abstract.php                  13-Apr-2024 02:08               19148
class.yaf-dispatcher.php                           13-Apr-2024 02:08               20206
class.yaf-exception-dispatchfailed.php             13-Apr-2024 02:08                2609
class.yaf-exception-loadfailed-action.php          13-Apr-2024 02:08                2680
class.yaf-exception-loadfailed-controller.php      13-Apr-2024 02:08                2705
class.yaf-exception-loadfailed-module.php          13-Apr-2024 02:08                2669
class.yaf-exception-loadfailed-view.php            13-Apr-2024 02:08                2609
class.yaf-exception-loadfailed.php                 13-Apr-2024 02:08                2583
class.yaf-exception-routerfailed.php               13-Apr-2024 02:08                2594
class.yaf-exception-startuperror.php               13-Apr-2024 02:08                2592
class.yaf-exception-typeerror.php                  13-Apr-2024 02:08                2563
class.yaf-exception.php                            13-Apr-2024 02:08                8463
class.yaf-loader.php                               13-Apr-2024 02:08               18701
class.yaf-plugin-abstract.php                      13-Apr-2024 02:08               15998
class.yaf-registry.php                             13-Apr-2024 02:08                5982
class.yaf-request-abstract.php                     13-Apr-2024 02:08               23694
class.yaf-request-http.php                         13-Apr-2024 02:08               23176
class.yaf-request-simple.php                       13-Apr-2024 02:08               22652
class.yaf-response-abstract.php                    13-Apr-2024 02:08               11764
class.yaf-route-interface.php                      13-Apr-2024 02:08                3687
class.yaf-route-map.php                            13-Apr-2024 02:08                6458
class.yaf-route-regex.php                          13-Apr-2024 02:08                8358
class.yaf-route-rewrite.php                        13-Apr-2024 02:08                7462
class.yaf-route-simple.php                         13-Apr-2024 02:08                6531
class.yaf-route-static.php                         13-Apr-2024 02:08                5007
class.yaf-route-supervar.php                       13-Apr-2024 02:08                4696
class.yaf-router.php                               13-Apr-2024 02:08               11936
class.yaf-session.php                              13-Apr-2024 02:08               12597
class.yaf-view-interface.php                       13-Apr-2024 02:08                6016
class.yaf-view-simple.php                          13-Apr-2024 02:08               11232
class.yar-client-exception.php                     13-Apr-2024 02:08                6600
class.yar-client.php                               13-Apr-2024 02:08                5785
class.yar-concurrent-client.php                    13-Apr-2024 02:08                6585
class.yar-server-exception.php                     13-Apr-2024 02:08                7057
class.yar-server.php                               13-Apr-2024 02:08                3440
class.ziparchive.php                               13-Apr-2024 02:08               90276
class.zmq.php                                      13-Apr-2024 02:08               41048
class.zmqcontext.php                               13-Apr-2024 02:08                5563
class.zmqdevice.php                                13-Apr-2024 02:08                7012
class.zmqpoll.php                                  13-Apr-2024 02:08                5148
class.zmqsocket.php                                13-Apr-2024 02:08               11425
class.zookeeper.php                                13-Apr-2024 02:08               56057
class.zookeeperauthenticationexception.php         13-Apr-2024 02:08                7692
class.zookeeperconfig.php                          13-Apr-2024 02:08                6396
class.zookeeperconnectionexception.php             13-Apr-2024 02:08                7687
class.zookeeperexception.php                       13-Apr-2024 02:08                7553
class.zookeepermarshallingexception.php            13-Apr-2024 02:08                7708
class.zookeepernonodeexception.php                 13-Apr-2024 02:08                7675
class.zookeeperoperationtimeoutexception.php       13-Apr-2024 02:08                7718
class.zookeepersessionexception.php                13-Apr-2024 02:08                7635
classobj.configuration.php                         13-Apr-2024 02:08                1271
classobj.constants.php                             13-Apr-2024 02:08                1158
classobj.examples.php                              13-Apr-2024 02:08               16396
classobj.installation.php                          13-Apr-2024 02:08                1234
classobj.requirements.php                          13-Apr-2024 02:08                1178
classobj.resources.php                             13-Apr-2024 02:08                1222
classobj.setup.php                                 13-Apr-2024 02:08                1575
closure.bind.php                                   13-Apr-2024 02:08                7978
closure.bindto.php                                 13-Apr-2024 02:08                9089
closure.call.php                                   13-Apr-2024 02:08                6273
closure.construct.php                              13-Apr-2024 02:08                2422
closure.fromcallable.php                           13-Apr-2024 02:08                3937
cmark.constants.php                                13-Apr-2024 02:08                4193
cmark.installation.php                             13-Apr-2024 02:08                1911
cmark.requirements.php                             13-Apr-2024 02:08                1260
cmark.setup.php                                    13-Apr-2024 02:08                1380
collator.asort.php                                 13-Apr-2024 02:08                9584
collator.compare.php                               13-Apr-2024 02:08               10752
collator.construct.php                             13-Apr-2024 02:08                5535
collator.create.php                                13-Apr-2024 02:08                5545
collator.getattribute.php                          13-Apr-2024 02:08                6174
collator.geterrorcode.php                          13-Apr-2024 02:08                5240
collator.geterrormessage.php                       13-Apr-2024 02:08                5301
collator.getlocale.php                             13-Apr-2024 02:08                6995
collator.getsortkey.php                            13-Apr-2024 02:08                7086
collator.getstrength.php                           13-Apr-2024 02:08                4956
collator.setattribute.php                          13-Apr-2024 02:08                6722
collator.setstrength.php                           13-Apr-2024 02:08               13713
collator.sort.php                                  13-Apr-2024 02:08                8676
collator.sortwithsortkeys.php                      13-Apr-2024 02:08                6627
collectable.isgarbage.php                          13-Apr-2024 02:08                3414
com.configuration.php                              13-Apr-2024 02:08                8569
com.constants.php                                  13-Apr-2024 02:08               26024
com.construct.php                                  13-Apr-2024 02:08                9663
com.error-handling.php                             13-Apr-2024 02:08                1511
com.examples.arrays.php                            13-Apr-2024 02:08                2126
com.examples.foreach.php                           13-Apr-2024 02:08                2790
com.examples.php                                   13-Apr-2024 02:08                1412
com.installation.php                               13-Apr-2024 02:08                1471
com.requirements.php                               13-Apr-2024 02:08                1255
com.resources.php                                  13-Apr-2024 02:08                1188
com.setup.php                                      13-Apr-2024 02:08                1532
commonmark-cql.construct.php                       13-Apr-2024 02:08                2190
commonmark-cql.invoke.php                          13-Apr-2024 02:08                3871
commonmark-interfaces-ivisitable.accept.php        13-Apr-2024 02:08                3113
commonmark-interfaces-ivisitor.enter.php           13-Apr-2024 02:08                4145
commonmark-interfaces-ivisitor.leave.php           13-Apr-2024 02:08                4147
commonmark-node-bulletlist.construct.php           13-Apr-2024 02:08                3176
commonmark-node-codeblock.construct.php            13-Apr-2024 02:08                2820
commonmark-node-heading.construct.php              13-Apr-2024 02:08                2617
commonmark-node-image.construct.php                13-Apr-2024 02:08                3263
commonmark-node-link.construct.php                 13-Apr-2024 02:08                3260
commonmark-node-orderedlist.construct.php          13-Apr-2024 02:08                4148
commonmark-node-text.construct.php                 13-Apr-2024 02:08                2648
commonmark-node.accept.php                         13-Apr-2024 02:08                2853
commonmark-node.appendchild.php                    13-Apr-2024 02:08                2691
commonmark-node.insertafter.php                    13-Apr-2024 02:08                2716
commonmark-node.insertbefore.php                   13-Apr-2024 02:08                2714
commonmark-node.prependchild.php                   13-Apr-2024 02:08                2718
commonmark-node.replace.php                        13-Apr-2024 02:08                2662
commonmark-node.unlink.php                         13-Apr-2024 02:08                2370
commonmark-parser.construct.php                    13-Apr-2024 02:08                3793
commonmark-parser.finish.php                       13-Apr-2024 02:08                2400
commonmark-parser.parse.php                        13-Apr-2024 02:08                2621
compersisthelper.construct.php                     13-Apr-2024 02:08                3683
compersisthelper.getcurfilename.php                13-Apr-2024 02:08                3127
compersisthelper.getmaxstreamsize.php              13-Apr-2024 02:08                3133
compersisthelper.initnew.php                       13-Apr-2024 02:08                3090
compersisthelper.loadfromfile.php                  13-Apr-2024 02:08                4296
compersisthelper.loadfromstream.php                13-Apr-2024 02:08                3513
compersisthelper.savetofile.php                    13-Apr-2024 02:08                6297
compersisthelper.savetostream.php                  13-Apr-2024 02:08                3540
componere-abstract-definition.addinterface.php     13-Apr-2024 02:08                3241
componere-abstract-definition.addmethod.php        13-Apr-2024 02:08                3967
componere-abstract-definition.addtrait.php         13-Apr-2024 02:08                3193
componere-abstract-definition.getreflector.php     13-Apr-2024 02:08                2360
componere-definition.addconstant.php               13-Apr-2024 02:08                4290
componere-definition.addproperty.php               13-Apr-2024 02:08                3699
componere-definition.construct.php                 13-Apr-2024 02:08                5929
componere-definition.getclosure.php                13-Apr-2024 02:08                3405
componere-definition.getclosures.php               13-Apr-2024 02:08                2642
componere-definition.isregistered.php              13-Apr-2024 02:08                2242
componere-definition.register.php                  13-Apr-2024 02:08                2388
componere-method.construct.php                     13-Apr-2024 02:08                2186
componere-method.getreflector.php                  13-Apr-2024 02:08                2163
componere-method.setprivate.php                    13-Apr-2024 02:08                2391
componere-method.setprotected.php                  13-Apr-2024 02:08                2406
componere-method.setstatic.php                     13-Apr-2024 02:08                1988
componere-patch.apply.php                          13-Apr-2024 02:08                1846
componere-patch.construct.php                      13-Apr-2024 02:08                3598
componere-patch.derive.php                         13-Apr-2024 02:08                3098
componere-patch.getclosure.php                     13-Apr-2024 02:08                3035
componere-patch.getclosures.php                    13-Apr-2024 02:08                2163
componere-patch.isapplied.php                      13-Apr-2024 02:08                1800
componere-patch.revert.php                         13-Apr-2024 02:08                1843
componere-value.construct.php                      13-Apr-2024 02:08                2619
componere-value.hasdefault.php                     13-Apr-2024 02:08                1849
componere-value.isprivate.php                      13-Apr-2024 02:08                1865
componere-value.isprotected.php                    13-Apr-2024 02:08                1875
componere-value.isstatic.php                       13-Apr-2024 02:08                1859
componere-value.setprivate.php                     13-Apr-2024 02:08                2414
componere-value.setprotected.php                   13-Apr-2024 02:08                2428
componere-value.setstatic.php                      13-Apr-2024 02:08                2005
componere.cast.php                                 13-Apr-2024 02:08                4878
componere.cast_by_ref.php                          13-Apr-2024 02:08                5043
componere.installation.php                         13-Apr-2024 02:08                1299
componere.requirements.php                         13-Apr-2024 02:08                1150
componere.setup.php                                13-Apr-2024 02:08                1419
configuration.changes.modes.php                    13-Apr-2024 02:08                3981
configuration.changes.php                          13-Apr-2024 02:08                9365
configuration.file.per-user.php                    13-Apr-2024 02:08                3171
configuration.file.php                             13-Apr-2024 02:08               10304
configuration.php                                  13-Apr-2024 02:08                1659
configure.about.php                                13-Apr-2024 02:08               13091
configure.php                                      13-Apr-2024 02:08                1432
context.ftp.php                                    13-Apr-2024 02:08                4377
context.http.php                                   13-Apr-2024 02:08               16040
context.params.php                                 13-Apr-2024 02:08                2533
context.phar.php                                   13-Apr-2024 02:08                2845
context.php                                        13-Apr-2024 02:08                3104
context.socket.php                                 13-Apr-2024 02:08                9606
context.ssl.php                                    13-Apr-2024 02:08               12810
context.zip.php                                    13-Apr-2024 02:08                4289
context.zlib.php                                   13-Apr-2024 02:08                2503
control-structures.alternative-syntax.php          13-Apr-2024 02:08                7048
control-structures.break.php                       13-Apr-2024 02:08                4732
control-structures.continue.php                    13-Apr-2024 02:08                8013
control-structures.declare.php                     13-Apr-2024 02:08               10282
control-structures.do.while.php                    13-Apr-2024 02:08                4504
control-structures.else.php                        13-Apr-2024 02:08                4809
control-structures.elseif.php                      13-Apr-2024 02:08                7608
control-structures.for.php                         13-Apr-2024 02:08               11728
control-structures.foreach.php                     13-Apr-2024 02:08               20820
control-structures.goto.php                        13-Apr-2024 02:08                7149
control-structures.if.php                          13-Apr-2024 02:08                4947
control-structures.intro.php                       13-Apr-2024 02:08                2397
control-structures.match.php                       13-Apr-2024 02:08               17696
control-structures.switch.php                      13-Apr-2024 02:08               18902
control-structures.while.php                       13-Apr-2024 02:08                4801
copyright.php                                      13-Apr-2024 02:08                2038
countable.count.php                                13-Apr-2024 02:08                5382
ctype.configuration.php                            13-Apr-2024 02:08                1250
ctype.constants.php                                13-Apr-2024 02:08                1159
ctype.installation.php                             13-Apr-2024 02:08                1466
ctype.requirements.php                             13-Apr-2024 02:08                1176
ctype.resources.php                                13-Apr-2024 02:08                1201
ctype.setup.php                                    13-Apr-2024 02:08                1541
cubrid.configuration.php                           13-Apr-2024 02:08                1202
cubrid.constants.php                               13-Apr-2024 02:08               13783
cubrid.examples.php                                13-Apr-2024 02:08               13792
cubrid.installation.php                            13-Apr-2024 02:08                2025
cubrid.requirements.php                            13-Apr-2024 02:08                1226
cubrid.resources.php                               13-Apr-2024 02:08                3091
cubrid.setup.php                                   13-Apr-2024 02:08                1555
cubridmysql.cubrid.php                             13-Apr-2024 02:08                4902
curl.configuration.php                             13-Apr-2024 02:08                2621
curl.constants.php                                 13-Apr-2024 02:08              187105
curl.examples-basic.php                            13-Apr-2024 02:08                4596
curl.examples.php                                  13-Apr-2024 02:08                1353
curl.installation.php                              13-Apr-2024 02:08                2440
curl.requirements.php                              13-Apr-2024 02:08                1438
curl.resources.php                                 13-Apr-2024 02:08                1382
curl.setup.php                                     13-Apr-2024 02:08                1549
curlfile.construct.php                             13-Apr-2024 02:08               21217
curlfile.getfilename.php                           13-Apr-2024 02:08                2142
curlfile.getmimetype.php                           13-Apr-2024 02:08                2233
curlfile.getpostfilename.php                       13-Apr-2024 02:08                2202
curlfile.setmimetype.php                           13-Apr-2024 02:08                2524
curlfile.setpostfilename.php                       13-Apr-2024 02:08                2559
curlstringfile.construct.php                       13-Apr-2024 02:08                6952
dateinterval.construct.php                         13-Apr-2024 02:08               13586
dateinterval.createfromdatestring.php              13-Apr-2024 02:08               15880
dateinterval.format.php                            13-Apr-2024 02:08               14682
dateperiod.construct.php                           13-Apr-2024 02:08               20181
dateperiod.createfromiso8601string.php             13-Apr-2024 02:08                7835
dateperiod.getdateinterval.php                     13-Apr-2024 02:08                4749
dateperiod.getenddate.php                          13-Apr-2024 02:08                7693
dateperiod.getrecurrences.php                      13-Apr-2024 02:08                8846
dateperiod.getstartdate.php                        13-Apr-2024 02:08                5224
datetime.add.php                                   13-Apr-2024 02:08                4858
datetime.configuration.php                         13-Apr-2024 02:08                6539
datetime.constants.php                             13-Apr-2024 02:08                2872
datetime.construct.php                             13-Apr-2024 02:08                6201
datetime.createfromformat.php                      13-Apr-2024 02:08                7305
datetime.createfromimmutable.php                   13-Apr-2024 02:08                4820
datetime.createfrominterface.php                   13-Apr-2024 02:08                4803
datetime.diff.php                                  13-Apr-2024 02:08               17161
datetime.error.tree.php                            13-Apr-2024 02:08                3263
datetime.examples-arithmetic.php                   13-Apr-2024 02:08               15081
datetime.examples.php                              13-Apr-2024 02:08                1391
datetime.format.php                                13-Apr-2024 02:08               26732
datetime.formats.php                               13-Apr-2024 02:08               55222
datetime.getlasterrors.php                         13-Apr-2024 02:08                1838
datetime.getoffset.php                             13-Apr-2024 02:08                7846
datetime.gettimestamp.php                          13-Apr-2024 02:08               10194
datetime.gettimezone.php                           13-Apr-2024 02:08                7775
datetime.installation.php                          13-Apr-2024 02:08                1628
datetime.modify.php                                13-Apr-2024 02:08               14194
datetime.requirements.php                          13-Apr-2024 02:08                1178
datetime.resources.php                             13-Apr-2024 02:08                1222
datetime.set-state.php                             13-Apr-2024 02:08                2828
datetime.setdate.php                               13-Apr-2024 02:08                5516
datetime.setisodate.php                            13-Apr-2024 02:08                5685
datetime.settime.php                               13-Apr-2024 02:08                7017
datetime.settimestamp.php                          13-Apr-2024 02:08                4980
datetime.settimezone.php                           13-Apr-2024 02:08                9290
datetime.setup.php                                 13-Apr-2024 02:08                1603
datetime.sub.php                                   13-Apr-2024 02:08                6220
datetime.wakeup.php                                13-Apr-2024 02:08                3009
datetimeimmutable.add.php                          13-Apr-2024 02:08               10453
datetimeimmutable.construct.php                    13-Apr-2024 02:08               18402
datetimeimmutable.createfromformat.php             13-Apr-2024 02:08               46989
datetimeimmutable.createfrominterface.php          13-Apr-2024 02:08                5067
datetimeimmutable.createfrommutable.php            13-Apr-2024 02:08                4977
datetimeimmutable.getlasterrors.php                13-Apr-2024 02:08                5581
datetimeimmutable.modify.php                       13-Apr-2024 02:08                9278
datetimeimmutable.set-state.php                    13-Apr-2024 02:08                2743
datetimeimmutable.setdate.php                      13-Apr-2024 02:08                9102
datetimeimmutable.setisodate.php                   13-Apr-2024 02:08               12686
datetimeimmutable.settime.php                      13-Apr-2024 02:08               11902
datetimeimmutable.settimestamp.php                 13-Apr-2024 02:08                5730
datetimeimmutable.settimezone.php                  13-Apr-2024 02:08                5937
datetimeimmutable.sub.php                          13-Apr-2024 02:08               11903
datetimezone.construct.php                         13-Apr-2024 02:08               10877
datetimezone.getlocation.php                       13-Apr-2024 02:08                5913
datetimezone.getname.php                           13-Apr-2024 02:08                3673
datetimezone.getoffset.php                         13-Apr-2024 02:08                6980
datetimezone.gettransitions.php                    13-Apr-2024 02:08               12105
datetimezone.listabbreviations.php                 13-Apr-2024 02:08                6034
datetimezone.listidentifiers.php                   13-Apr-2024 02:08               14563
dba.configuration.php                              13-Apr-2024 02:08                2366
dba.constants.php                                  13-Apr-2024 02:08                2137
dba.example.php                                    13-Apr-2024 02:08                6175
dba.examples.php                                   13-Apr-2024 02:08                1296
dba.installation.php                               13-Apr-2024 02:08                9443
dba.requirements.php                               13-Apr-2024 02:08                7226
dba.resources.php                                  13-Apr-2024 02:08                1455
dba.setup.php                                      13-Apr-2024 02:08                1536
dbase.configuration.php                            13-Apr-2024 02:08                1250
dbase.constants.php                                13-Apr-2024 02:08                3625
dbase.installation.php                             13-Apr-2024 02:08                1527
dbase.requirements.php                             13-Apr-2024 02:08                1157
dbase.resources.php                                13-Apr-2024 02:08                1467
dbase.setup.php                                    13-Apr-2024 02:08                1557
debugger-about.php                                 13-Apr-2024 02:08                1603
debugger.php                                       13-Apr-2024 02:08                1370
dio.configuration.php                              13-Apr-2024 02:08                1236
dio.constants.php                                  13-Apr-2024 02:08               10991
dio.installation.php                               13-Apr-2024 02:08                1936
dio.requirements.php                               13-Apr-2024 02:08                1143
dio.resources.php                                  13-Apr-2024 02:08                1333
dio.setup.php                                      13-Apr-2024 02:08                1532
dir.configuration.php                              13-Apr-2024 02:08                1236
dir.constants.php                                  13-Apr-2024 02:08                2768
dir.installation.php                               13-Apr-2024 02:08                1199
dir.requirements.php                               13-Apr-2024 02:08                1143
dir.resources.php                                  13-Apr-2024 02:08                1187
dir.setup.php                                      13-Apr-2024 02:08                1522
directory.close.php                                13-Apr-2024 02:08                2378
directory.read.php                                 13-Apr-2024 02:08                2504
directory.rewind.php                               13-Apr-2024 02:08                2394
directoryiterator.construct.php                    13-Apr-2024 02:08                5767
directoryiterator.current.php                      13-Apr-2024 02:08                6072
directoryiterator.getbasename.php                  13-Apr-2024 02:08                6379
directoryiterator.getextension.php                 13-Apr-2024 02:08                6112
directoryiterator.getfilename.php                  13-Apr-2024 02:08                5099
directoryiterator.isdot.php                        13-Apr-2024 02:08                5285
directoryiterator.key.php                          13-Apr-2024 02:08                6531
directoryiterator.next.php                         13-Apr-2024 02:08                5409
directoryiterator.rewind.php                       13-Apr-2024 02:08                5323
directoryiterator.seek.php                         13-Apr-2024 02:08                5262
directoryiterator.tostring.php                     13-Apr-2024 02:08                4604
directoryiterator.valid.php                        13-Apr-2024 02:08                5731
doc.changelog.php                                  13-Apr-2024 02:08                1272
dom.configuration.php                              13-Apr-2024 02:08                1236
dom.constants.php                                  13-Apr-2024 02:08               19813
dom.examples.php                                   13-Apr-2024 02:08                2954
dom.installation.php                               13-Apr-2024 02:08                1257
dom.requirements.php                               13-Apr-2024 02:08                1431
dom.resources.php                                  13-Apr-2024 02:08                1187
dom.setup.php                                      13-Apr-2024 02:08                1526
domattr.construct.php                              13-Apr-2024 02:08                5683
domattr.isid.php                                   13-Apr-2024 02:08                5207
domcdatasection.construct.php                      13-Apr-2024 02:08                5187
domcharacterdata.after.php                         13-Apr-2024 02:08                7705
domcharacterdata.appenddata.php                    13-Apr-2024 02:08                3843
domcharacterdata.before.php                        13-Apr-2024 02:08                7333
domcharacterdata.deletedata.php                    13-Apr-2024 02:08                5125
domcharacterdata.insertdata.php                    13-Apr-2024 02:08                4882
domcharacterdata.remove.php                        13-Apr-2024 02:08                5368
domcharacterdata.replacedata.php                   13-Apr-2024 02:08                5668
domcharacterdata.replacewith.php                   13-Apr-2024 02:08                7789
domcharacterdata.substringdata.php                 13-Apr-2024 02:08                4993
domchildnode.after.php                             13-Apr-2024 02:08                5631
domchildnode.before.php                            13-Apr-2024 02:08                5055
domchildnode.remove.php                            13-Apr-2024 02:08                3081
domchildnode.replacewith.php                       13-Apr-2024 02:08                5294
domcomment.construct.php                           13-Apr-2024 02:08                5376
domdocument.adoptnode.php                          13-Apr-2024 02:08                6674
domdocument.append.php                             13-Apr-2024 02:08                6756
domdocument.construct.php                          13-Apr-2024 02:08                4501
domdocument.createattribute.php                    13-Apr-2024 02:08                6038
domdocument.createattributens.php                  13-Apr-2024 02:08                6880
domdocument.createcdatasection.php                 13-Apr-2024 02:08                5651
domdocument.createcomment.php                      13-Apr-2024 02:08                6024
domdocument.createdocumentfragment.php             13-Apr-2024 02:08                5870
domdocument.createelement.php                      13-Apr-2024 02:08               11464
domdocument.createelementns.php                    13-Apr-2024 02:08               14234
domdocument.createentityreference.php              13-Apr-2024 02:08                6349
domdocument.createprocessinginstruction.php        13-Apr-2024 02:08                6667
domdocument.createtextnode.php                     13-Apr-2024 02:08                6069
domdocument.getelementbyid.php                     13-Apr-2024 02:08                6210
domdocument.getelementsbytagname.php               13-Apr-2024 02:08                5999
domdocument.getelementsbytagnamens.php             13-Apr-2024 02:08                7795
domdocument.importnode.php                         13-Apr-2024 02:08                9002
domdocument.load.php                               13-Apr-2024 02:08                6585
domdocument.loadhtml.php                           13-Apr-2024 02:08                7825
domdocument.loadhtmlfile.php                       13-Apr-2024 02:08                7921
domdocument.loadxml.php                            13-Apr-2024 02:08                6289
domdocument.normalizedocument.php                  13-Apr-2024 02:08                2946
domdocument.prepend.php                            13-Apr-2024 02:08                6848
domdocument.registernodeclass.php                  13-Apr-2024 02:08               21118
domdocument.relaxngvalidate.php                    13-Apr-2024 02:08                3978
domdocument.relaxngvalidatesource.php              13-Apr-2024 02:08                4020
domdocument.replacechildren.php                    13-Apr-2024 02:08                7145
domdocument.save.php                               13-Apr-2024 02:08                7559
domdocument.savehtml.php                           13-Apr-2024 02:08                7544
domdocument.savehtmlfile.php                       13-Apr-2024 02:08                7913
domdocument.savexml.php                            13-Apr-2024 02:08                9759
domdocument.schemavalidate.php                     13-Apr-2024 02:08                4460
domdocument.schemavalidatesource.php               13-Apr-2024 02:08                4464
domdocument.validate.php                           13-Apr-2024 02:08                6019
domdocument.xinclude.php                           13-Apr-2024 02:08                7739
domdocumentfragment.append.php                     13-Apr-2024 02:08                7446
domdocumentfragment.appendxml.php                  13-Apr-2024 02:08                5849
domdocumentfragment.construct.php                  13-Apr-2024 02:08                2112
domdocumentfragment.prepend.php                    13-Apr-2024 02:08                7504
domdocumentfragment.replacechildren.php            13-Apr-2024 02:08                7889
domelement.after.php                               13-Apr-2024 02:08                7383
domelement.append.php                              13-Apr-2024 02:08                7068
domelement.before.php                              13-Apr-2024 02:08                6968
domelement.construct.php                           13-Apr-2024 02:08                6974
domelement.getattribute.php                        13-Apr-2024 02:08                4168
domelement.getattributenames.php                   13-Apr-2024 02:08                3932
domelement.getattributenode.php                    13-Apr-2024 02:08                4107
domelement.getattributenodens.php                  13-Apr-2024 02:08                4644
domelement.getattributens.php                      13-Apr-2024 02:08                4089
domelement.getelementsbytagname.php                13-Apr-2024 02:08                3523
domelement.getelementsbytagnamens.php              13-Apr-2024 02:08                4859
domelement.hasattribute.php                        13-Apr-2024 02:08                3938
domelement.hasattributens.php                      13-Apr-2024 02:08                4462
domelement.insertadjacentelement.php               13-Apr-2024 02:08                6609
domelement.insertadjacenttext.php                  13-Apr-2024 02:08                6421
domelement.prepend.php                             13-Apr-2024 02:08                7118
domelement.remove.php                              13-Apr-2024 02:08                5011
domelement.removeattribute.php                     13-Apr-2024 02:08                4054
domelement.removeattributenode.php                 13-Apr-2024 02:08                4556
domelement.removeattributens.php                   13-Apr-2024 02:08                4467
domelement.replacechildren.php                     13-Apr-2024 02:08                7709
domelement.replacewith.php                         13-Apr-2024 02:08                7773
domelement.setattribute.php                        13-Apr-2024 02:08                6239
domelement.setattributenode.php                    13-Apr-2024 02:08                4916
domelement.setattributenodens.php                  13-Apr-2024 02:08                5028
domelement.setattributens.php                      13-Apr-2024 02:08                5196
domelement.setidattribute.php                      13-Apr-2024 02:08                4842
domelement.setidattributenode.php                  13-Apr-2024 02:08                4907
domelement.setidattributens.php                    13-Apr-2024 02:08                5324
domelement.toggleattribute.php                     13-Apr-2024 02:08                6382
domentityreference.construct.php                   13-Apr-2024 02:08                5013
domimplementation.construct.php                    13-Apr-2024 02:08                2219
domimplementation.createdocument.php               13-Apr-2024 02:08                7694
domimplementation.createdocumenttype.php           13-Apr-2024 02:08                9984
domimplementation.hasfeature.php                   13-Apr-2024 02:08                9067
domnamednodemap.count.php                          13-Apr-2024 02:08                2424
domnamednodemap.getiterator.php                    13-Apr-2024 02:08                3232
domnamednodemap.getnameditem.php                   13-Apr-2024 02:08                3319
domnamednodemap.getnameditemns.php                 13-Apr-2024 02:08                3800
domnamednodemap.item.php                           13-Apr-2024 02:08                3050
domnode.appendchild.php                            13-Apr-2024 02:08                8895
domnode.c14n.php                                   13-Apr-2024 02:08                5335
domnode.c14nfile.php                               13-Apr-2024 02:08                5665
domnode.clonenode.php                              13-Apr-2024 02:08                2739
domnode.contains.php                               13-Apr-2024 02:08                5317
domnode.getlineno.php                              13-Apr-2024 02:08                4854
domnode.getnodepath.php                            13-Apr-2024 02:08                5140
domnode.getrootnode.php                            13-Apr-2024 02:08                4251
domnode.hasattributes.php                          13-Apr-2024 02:08                3076
domnode.haschildnodes.php                          13-Apr-2024 02:08                2942
domnode.insertbefore.php                           13-Apr-2024 02:08                5555
domnode.isdefaultnamespace.php                     13-Apr-2024 02:08                2969
domnode.isequalnode.php                            13-Apr-2024 02:08                4656
domnode.issamenode.php                             13-Apr-2024 02:08                2754
domnode.issupported.php                            13-Apr-2024 02:08                3867
domnode.lookupnamespaceuri.php                     13-Apr-2024 02:08                3660
domnode.lookupprefix.php                           13-Apr-2024 02:08                3348
domnode.normalize.php                              13-Apr-2024 02:08                2796
domnode.removechild.php                            13-Apr-2024 02:08                6893
domnode.replacechild.php                           13-Apr-2024 02:08                5879
domnodelist.count.php                              13-Apr-2024 02:08                2359
domnodelist.getiterator.php                        13-Apr-2024 02:08                3135
domnodelist.item.php                               13-Apr-2024 02:08                6989
domparentnode.append.php                           13-Apr-2024 02:08                4731
domparentnode.prepend.php                          13-Apr-2024 02:08                4771
domparentnode.replacechildren.php                  13-Apr-2024 02:08                6572
domprocessinginstruction.construct.php             13-Apr-2024 02:08                6623
domtext.construct.php                              13-Apr-2024 02:08                4835
domtext.iselementcontentwhitespace.php             13-Apr-2024 02:08                2884
domtext.iswhitespaceinelementcontent.php           13-Apr-2024 02:08                2826
domtext.splittext.php                              13-Apr-2024 02:08                3151
domxpath.construct.php                             13-Apr-2024 02:08                2982
domxpath.evaluate.php                              13-Apr-2024 02:08                7504
domxpath.query.php                                 13-Apr-2024 02:08               12070
domxpath.registernamespace.php                     13-Apr-2024 02:08                3412
domxpath.registerphpfunctions.php                  13-Apr-2024 02:08               13808
dotnet.construct.php                               13-Apr-2024 02:08                3045
ds-collection.clear.php                            13-Apr-2024 02:08                3883
ds-collection.copy.php                             13-Apr-2024 02:08                4291
ds-collection.isempty.php                          13-Apr-2024 02:08                4219
ds-collection.toarray.php                          13-Apr-2024 02:08                4213
ds-deque.allocate.php                              13-Apr-2024 02:08                4637
ds-deque.apply.php                                 13-Apr-2024 02:08                4927
ds-deque.capacity.php                              13-Apr-2024 02:08                3918
ds-deque.clear.php                                 13-Apr-2024 02:08                3800
ds-deque.construct.php                             13-Apr-2024 02:08                4278
ds-deque.contains.php                              13-Apr-2024 02:08                7048
ds-deque.copy.php                                  13-Apr-2024 02:08                4157
ds-deque.count.php                                 13-Apr-2024 02:08                1533
ds-deque.filter.php                                13-Apr-2024 02:08                7575
ds-deque.find.php                                  13-Apr-2024 02:08                5390
ds-deque.first.php                                 13-Apr-2024 02:08                3729
ds-deque.get.php                                   13-Apr-2024 02:08                6552
ds-deque.insert.php                                13-Apr-2024 02:08                6631
ds-deque.isempty.php                               13-Apr-2024 02:08                4105
ds-deque.join.php                                  13-Apr-2024 02:08                5700
ds-deque.jsonserialize.php                         13-Apr-2024 02:08                1818
ds-deque.last.php                                  13-Apr-2024 02:08                3717
ds-deque.map.php                                   13-Apr-2024 02:08                5286
ds-deque.merge.php                                 13-Apr-2024 02:08                4836
ds-deque.pop.php                                   13-Apr-2024 02:08                4214
ds-deque.push.php                                  13-Apr-2024 02:08                4631
ds-deque.reduce.php                                13-Apr-2024 02:08                7946
ds-deque.remove.php                                13-Apr-2024 02:08                4831
ds-deque.reverse.php                               13-Apr-2024 02:08                3636
ds-deque.reversed.php                              13-Apr-2024 02:08                3987
ds-deque.rotate.php                                13-Apr-2024 02:08                5017
ds-deque.set.php                                   13-Apr-2024 02:08                6024
ds-deque.shift.php                                 13-Apr-2024 02:08                4315
ds-deque.slice.php                                 13-Apr-2024 02:08                7109
ds-deque.sort.php                                  13-Apr-2024 02:08                7440
ds-deque.sorted.php                                13-Apr-2024 02:08                7462
ds-deque.sum.php                                   13-Apr-2024 02:08                5234
ds-deque.toarray.php                               13-Apr-2024 02:08                4099
ds-deque.unshift.php                               13-Apr-2024 02:08                4715
ds-hashable.equals.php                             13-Apr-2024 02:08                3662
ds-hashable.hash.php                               13-Apr-2024 02:08                7428
ds-map.allocate.php                                13-Apr-2024 02:08                4503
ds-map.apply.php                                   13-Apr-2024 02:08                5623
ds-map.capacity.php                                13-Apr-2024 02:08                3208
ds-map.clear.php                                   13-Apr-2024 02:08                4276
ds-map.construct.php                               13-Apr-2024 02:08                4780
ds-map.copy.php                                    13-Apr-2024 02:08                4017
ds-map.count.php                                   13-Apr-2024 02:08                1494
ds-map.diff.php                                    13-Apr-2024 02:08                5416
ds-map.filter.php                                  13-Apr-2024 02:08                8359
ds-map.first.php                                   13-Apr-2024 02:08                4028
ds-map.get.php                                     13-Apr-2024 02:08                8382
ds-map.haskey.php                                  13-Apr-2024 02:08                4644
ds-map.hasvalue.php                                13-Apr-2024 02:08                4688
ds-map.intersect.php                               13-Apr-2024 02:08                5942
ds-map.isempty.php                                 13-Apr-2024 02:08                4327
ds-map.jsonserialize.php                           13-Apr-2024 02:08                1796
ds-map.keys.php                                    13-Apr-2024 02:08                3918
ds-map.ksort.php                                   13-Apr-2024 02:08                8127
ds-map.ksorted.php                                 13-Apr-2024 02:08                8211
ds-map.last.php                                    13-Apr-2024 02:08                4013
ds-map.map.php                                     13-Apr-2024 02:08                6267
ds-map.merge.php                                   13-Apr-2024 02:08                5821
ds-map.pairs.php                                   13-Apr-2024 02:08                4333
ds-map.put.php                                     13-Apr-2024 02:08               13905
ds-map.putall.php                                  13-Apr-2024 02:08                5501
ds-map.reduce.php                                  13-Apr-2024 02:08                8881
ds-map.remove.php                                  13-Apr-2024 02:08                6936
ds-map.reverse.php                                 13-Apr-2024 02:08                4088
ds-map.reversed.php                                13-Apr-2024 02:08                4197
ds-map.skip.php                                    13-Apr-2024 02:08                4581
ds-map.slice.php                                   13-Apr-2024 02:08                7961
ds-map.sort.php                                    13-Apr-2024 02:08                8050
ds-map.sorted.php                                  13-Apr-2024 02:08                8190
ds-map.sum.php                                     13-Apr-2024 02:08                5701
ds-map.toarray.php                                 13-Apr-2024 02:08                5094
ds-map.union.php                                   13-Apr-2024 02:08                5926
ds-map.values.php                                  13-Apr-2024 02:08                3917
ds-map.xor.php                                     13-Apr-2024 02:08                5482
ds-pair.clear.php                                  13-Apr-2024 02:08                3705
ds-pair.construct.php                              13-Apr-2024 02:08                2557
ds-pair.copy.php                                   13-Apr-2024 02:08                4071
ds-pair.isempty.php                                13-Apr-2024 02:08                4055
ds-pair.jsonserialize.php                          13-Apr-2024 02:08                1816
ds-pair.toarray.php                                13-Apr-2024 02:08                4033
ds-priorityqueue.allocate.php                      13-Apr-2024 02:08                4803
ds-priorityqueue.capacity.php                      13-Apr-2024 02:08                3417
ds-priorityqueue.clear.php                         13-Apr-2024 02:08                4457
ds-priorityqueue.construct.php                     13-Apr-2024 02:08                2871
ds-priorityqueue.copy.php                          13-Apr-2024 02:08                4460
ds-priorityqueue.count.php                         13-Apr-2024 02:08                1642
ds-priorityqueue.isempty.php                       13-Apr-2024 02:08                5015
ds-priorityqueue.jsonserialize.php                 13-Apr-2024 02:08                1936
ds-priorityqueue.peek.php                          13-Apr-2024 02:08                4707
ds-priorityqueue.pop.php                           13-Apr-2024 02:08                5482
ds-priorityqueue.push.php                          13-Apr-2024 02:08                5557
ds-priorityqueue.toarray.php                       13-Apr-2024 02:08                5203
ds-queue.allocate.php                              13-Apr-2024 02:08                4835
ds-queue.capacity.php                              13-Apr-2024 02:08                3924
ds-queue.clear.php                                 13-Apr-2024 02:08                3785
ds-queue.construct.php                             13-Apr-2024 02:08                4276
ds-queue.copy.php                                  13-Apr-2024 02:08                4259
ds-queue.count.php                                 13-Apr-2024 02:08                1530
ds-queue.isempty.php                               13-Apr-2024 02:08                4121
ds-queue.jsonserialize.php                         13-Apr-2024 02:08                1824
ds-queue.peek.php                                  13-Apr-2024 02:08                4311
ds-queue.pop.php                                   13-Apr-2024 02:08                4845
ds-queue.push.php                                  13-Apr-2024 02:08                4666
ds-queue.toarray.php                               13-Apr-2024 02:08                4268
ds-sequence.allocate.php                           13-Apr-2024 02:08                4536
ds-sequence.apply.php                              13-Apr-2024 02:08                5042
ds-sequence.capacity.php                           13-Apr-2024 02:08                4473
ds-sequence.contains.php                           13-Apr-2024 02:08                7175
ds-sequence.filter.php                             13-Apr-2024 02:08                7714
ds-sequence.find.php                               13-Apr-2024 02:08                5502
ds-sequence.first.php                              13-Apr-2024 02:08                3844
ds-sequence.get.php                                13-Apr-2024 02:08                6680
ds-sequence.insert.php                             13-Apr-2024 02:08                6750
ds-sequence.join.php                               13-Apr-2024 02:08                5796
ds-sequence.last.php                               13-Apr-2024 02:08                3811
ds-sequence.map.php                                13-Apr-2024 02:08                5415
ds-sequence.merge.php                              13-Apr-2024 02:08                4962
ds-sequence.pop.php                                13-Apr-2024 02:08                4326
ds-sequence.push.php                               13-Apr-2024 02:08                4753
ds-sequence.reduce.php                             13-Apr-2024 02:08                8065
ds-sequence.remove.php                             13-Apr-2024 02:08                4943
ds-sequence.reverse.php                            13-Apr-2024 02:08                3749
ds-sequence.reversed.php                           13-Apr-2024 02:08                4110
ds-sequence.rotate.php                             13-Apr-2024 02:08                5154
ds-sequence.set.php                                13-Apr-2024 02:08                6148
ds-sequence.shift.php                              13-Apr-2024 02:08                4427
ds-sequence.slice.php                              13-Apr-2024 02:08                7274
ds-sequence.sort.php                               13-Apr-2024 02:08                7567
ds-sequence.sorted.php                             13-Apr-2024 02:08                7589
ds-sequence.sum.php                                13-Apr-2024 02:08                5359
ds-sequence.unshift.php                            13-Apr-2024 02:08                4826
ds-set.add.php                                     13-Apr-2024 02:08               12133
ds-set.allocate.php                                13-Apr-2024 02:08                4512
ds-set.capacity.php                                13-Apr-2024 02:08                3876
ds-set.clear.php                                   13-Apr-2024 02:08                3731
ds-set.construct.php                               13-Apr-2024 02:08                4230
ds-set.contains.php                                13-Apr-2024 02:08                7245
ds-set.copy.php                                    13-Apr-2024 02:08                4198
ds-set.count.php                                   13-Apr-2024 02:08                1494
ds-set.diff.php                                    13-Apr-2024 02:08                4706
ds-set.filter.php                                  13-Apr-2024 02:08                7523
ds-set.first.php                                   13-Apr-2024 02:08                3682
ds-set.get.php                                     13-Apr-2024 02:08                6496
ds-set.intersect.php                               13-Apr-2024 02:08                4937
ds-set.isempty.php                                 13-Apr-2024 02:08                4063
ds-set.join.php                                    13-Apr-2024 02:08                5646
ds-set.jsonserialize.php                           13-Apr-2024 02:08                1790
ds-set.last.php                                    13-Apr-2024 02:08                3683
ds-set.merge.php                                   13-Apr-2024 02:08                4762
ds-set.reduce.php                                  13-Apr-2024 02:08                7892
ds-set.remove.php                                  13-Apr-2024 02:08                4937
ds-set.reverse.php                                 13-Apr-2024 02:08                3584
ds-set.reversed.php                                13-Apr-2024 02:08                3925
ds-set.slice.php                                   13-Apr-2024 02:08                7023
ds-set.sort.php                                    13-Apr-2024 02:08                7376
ds-set.sorted.php                                  13-Apr-2024 02:08                7398
ds-set.sum.php                                     13-Apr-2024 02:08                5174
ds-set.toarray.php                                 13-Apr-2024 02:08                4045
ds-set.union.php                                   13-Apr-2024 02:08                4900
ds-set.xor.php                                     13-Apr-2024 02:08                4876
ds-stack.allocate.php                              13-Apr-2024 02:08                2818
ds-stack.capacity.php                              13-Apr-2024 02:08                2157
ds-stack.clear.php                                 13-Apr-2024 02:08                3781
ds-stack.construct.php                             13-Apr-2024 02:08                4242
ds-stack.copy.php                                  13-Apr-2024 02:08                4259
ds-stack.count.php                                 13-Apr-2024 02:08                1530
ds-stack.isempty.php                               13-Apr-2024 02:08                4121
ds-stack.jsonserialize.php                         13-Apr-2024 02:08                1824
ds-stack.peek.php                                  13-Apr-2024 02:08                4305
ds-stack.pop.php                                   13-Apr-2024 02:08                4839
ds-stack.push.php                                  13-Apr-2024 02:08                4666
ds-stack.toarray.php                               13-Apr-2024 02:08                4090
ds-vector.allocate.php                             13-Apr-2024 02:08                4453
ds-vector.apply.php                                13-Apr-2024 02:08                4953
ds-vector.capacity.php                             13-Apr-2024 02:08                4378
ds-vector.clear.php                                13-Apr-2024 02:08                3812
ds-vector.construct.php                            13-Apr-2024 02:08                4310
ds-vector.contains.php                             13-Apr-2024 02:08                7078
ds-vector.copy.php                                 13-Apr-2024 02:08                4283
ds-vector.count.php                                13-Apr-2024 02:08                1547
ds-vector.filter.php                               13-Apr-2024 02:08                7609
ds-vector.find.php                                 13-Apr-2024 02:08                5415
ds-vector.first.php                                13-Apr-2024 02:08                3755
ds-vector.get.php                                  13-Apr-2024 02:08                6583
ds-vector.insert.php                               13-Apr-2024 02:08                6661
ds-vector.isempty.php                              13-Apr-2024 02:08                4129
ds-vector.join.php                                 13-Apr-2024 02:08                5727
ds-vector.jsonserialize.php                        13-Apr-2024 02:08                1832
ds-vector.last.php                                 13-Apr-2024 02:08                3742
ds-vector.map.php                                  13-Apr-2024 02:08                5318
ds-vector.merge.php                                13-Apr-2024 02:08                4867
ds-vector.pop.php                                  13-Apr-2024 02:08                4239
ds-vector.push.php                                 13-Apr-2024 02:08                4660
ds-vector.reduce.php                               13-Apr-2024 02:08                7974
ds-vector.remove.php                               13-Apr-2024 02:08                4856
ds-vector.reverse.php                              13-Apr-2024 02:08                3662
ds-vector.reversed.php                             13-Apr-2024 02:08                4017
ds-vector.rotate.php                               13-Apr-2024 02:08                5051
ds-vector.set.php                                  13-Apr-2024 02:08                6055
ds-vector.shift.php                                13-Apr-2024 02:08                4340
ds-vector.slice.php                                13-Apr-2024 02:08                7155
ds-vector.sort.php                                 13-Apr-2024 02:08                7472
ds-vector.sorted.php                               13-Apr-2024 02:08                7494
ds-vector.sum.php                                  13-Apr-2024 02:08                5264
ds-vector.toarray.php                              13-Apr-2024 02:08                4124
ds-vector.unshift.php                              13-Apr-2024 02:08                4745
ds.constants.php                                   13-Apr-2024 02:08                1107
ds.examples.php                                    13-Apr-2024 02:08                4665
ds.installation.php                                13-Apr-2024 02:08                2462
ds.requirements.php                                13-Apr-2024 02:08                1151
ds.setup.php                                       13-Apr-2024 02:08                1356
eio.configuration.php                              13-Apr-2024 02:08                1234
eio.constants.php                                  13-Apr-2024 02:08               21816
eio.examples.php                                   13-Apr-2024 02:08               27013
eio.installation.php                               13-Apr-2024 02:08                1661
eio.requirements.php                               13-Apr-2024 02:08                1271
eio.resources.php                                  13-Apr-2024 02:08                1221
eio.setup.php                                      13-Apr-2024 02:08                1538
emptyiterator.current.php                          13-Apr-2024 02:08                2710
emptyiterator.key.php                              13-Apr-2024 02:08                2674
emptyiterator.next.php                             13-Apr-2024 02:08                2370
emptyiterator.rewind.php                           13-Apr-2024 02:08                2392
emptyiterator.valid.php                            13-Apr-2024 02:08                2715
enchant.configuration.php                          13-Apr-2024 02:08                1264
enchant.constants.php                              13-Apr-2024 02:08                2897
enchant.examples.php                               13-Apr-2024 02:08                5375
enchant.installation.php                           13-Apr-2024 02:08                3212
enchant.requirements.php                           13-Apr-2024 02:08                1754
enchant.resources.php                              13-Apr-2024 02:08                1328
enchant.setup.php                                  13-Apr-2024 02:08                1583
error.clone.php                                    13-Apr-2024 02:08                2809
error.construct.php                                13-Apr-2024 02:08                3394
error.getcode.php                                  13-Apr-2024 02:08                4040
error.getfile.php                                  13-Apr-2024 02:08                3779
error.getline.php                                  13-Apr-2024 02:08                4007
error.getmessage.php                               13-Apr-2024 02:08                3854
error.getprevious.php                              13-Apr-2024 02:08                6623
error.gettrace.php                                 13-Apr-2024 02:08                4374
error.gettraceasstring.php                         13-Apr-2024 02:08                4130
error.tostring.php                                 13-Apr-2024 02:08                3820
errorexception.construct.php                       13-Apr-2024 02:08                6255
errorexception.getseverity.php                     13-Apr-2024 02:08                4364
errorfunc.configuration.php                        13-Apr-2024 02:08               27584
errorfunc.constants.php                            13-Apr-2024 02:08               11708
errorfunc.examples.php                             13-Apr-2024 02:08               19311
errorfunc.installation.php                         13-Apr-2024 02:08                1241
errorfunc.requirements.php                         13-Apr-2024 02:08                1185
errorfunc.resources.php                            13-Apr-2024 02:08                1229
errorfunc.setup.php                                13-Apr-2024 02:08                1593
ev.backend.php                                     13-Apr-2024 02:08                3371
ev.configuration.php                               13-Apr-2024 02:08                1229
ev.depth.php                                       13-Apr-2024 02:08                3241
ev.embeddablebackends.php                          13-Apr-2024 02:08                6439
ev.examples.php                                    13-Apr-2024 02:08               41730
ev.feedsignal.php                                  13-Apr-2024 02:08                3355
ev.feedsignalevent.php                             13-Apr-2024 02:08                3142
ev.global.constants.php                            13-Apr-2024 02:08                1278
ev.installation.php                                13-Apr-2024 02:08                1640
ev.iteration.php                                   13-Apr-2024 02:08                2617
ev.now.php                                         13-Apr-2024 02:08                3088
ev.nowupdate.php                                   13-Apr-2024 02:08                3167
ev.periodic-modes.php                              13-Apr-2024 02:08                7610
ev.recommendedbackends.php                         13-Apr-2024 02:08                7131
ev.requirements.php                                13-Apr-2024 02:08                1206
ev.resources.php                                   13-Apr-2024 02:08                1187
ev.resume.php                                      13-Apr-2024 02:08                3689
ev.run.php                                         13-Apr-2024 02:08                5053
ev.setup.php                                       13-Apr-2024 02:08                1493
ev.sleep.php                                       13-Apr-2024 02:08                2409
ev.stop.php                                        13-Apr-2024 02:08                2854
ev.supportedbackends.php                           13-Apr-2024 02:08                6421
ev.suspend.php                                     13-Apr-2024 02:08                3456
ev.time.php                                        13-Apr-2024 02:08                2662
ev.verify.php                                      13-Apr-2024 02:08                2242
ev.watcher-callbacks.php                           13-Apr-2024 02:08                4485
ev.watchers.php                                    13-Apr-2024 02:08                3358
evcheck.construct.php                              13-Apr-2024 02:08                3631
evcheck.createstopped.php                          13-Apr-2024 02:08                3740
evchild.construct.php                              13-Apr-2024 02:08                6708
evchild.createstopped.php                          13-Apr-2024 02:08                5111
evchild.set.php                                    13-Apr-2024 02:08                3191
evembed.construct.php                              13-Apr-2024 02:08                7923
evembed.createstopped.php                          13-Apr-2024 02:08                4753
evembed.set.php                                    13-Apr-2024 02:08                2533
evembed.sweep.php                                  13-Apr-2024 02:08                3052
event.add.php                                      13-Apr-2024 02:08               10279
event.addsignal.php                                13-Apr-2024 02:08                1645
event.addtimer.php                                 13-Apr-2024 02:08                1654
event.callbacks.php                                13-Apr-2024 02:08                5640
event.configuration.php                            13-Apr-2024 02:08                1250
event.construct.php                                13-Apr-2024 02:08                4559
event.constructing.signal.events.php               13-Apr-2024 02:08                5999
event.del.php                                      13-Apr-2024 02:08                2630
event.delsignal.php                                13-Apr-2024 02:08                1645
event.deltimer.php                                 13-Apr-2024 02:08                1642
event.examples.php                                 13-Apr-2024 02:08              164993
event.flags.php                                    13-Apr-2024 02:08                2571
event.free.php                                     13-Apr-2024 02:08                3010
event.getsupportedmethods.php                      13-Apr-2024 02:08                2659
event.installation.php                             13-Apr-2024 02:08                1667
event.pending.php                                  13-Apr-2024 02:08                3097
event.persistence.php                              13-Apr-2024 02:08                2894
event.requirements.php                             13-Apr-2024 02:08                1424
event.resources.php                                13-Apr-2024 02:08                1188
event.set.php                                      13-Apr-2024 02:08                4681
event.setpriority.php                              13-Apr-2024 02:08                2597
event.settimer.php                                 13-Apr-2024 02:08                4115
event.setup.php                                    13-Apr-2024 02:08                1532
event.signal.php                                   13-Apr-2024 02:08                4293
event.timer.php                                    13-Apr-2024 02:08                3578
eventbase.construct.php                            13-Apr-2024 02:08                3035
eventbase.dispatch.php                             13-Apr-2024 02:08                3323
eventbase.exit.php                                 13-Apr-2024 02:08                3101
eventbase.free.php                                 13-Apr-2024 02:08                3365
eventbase.getfeatures.php                          13-Apr-2024 02:08                5761
eventbase.getmethod.php                            13-Apr-2024 02:08                4551
eventbase.gettimeofdaycached.php                   13-Apr-2024 02:08                2725
eventbase.gotexit.php                              13-Apr-2024 02:08                3350
eventbase.gotstop.php                              13-Apr-2024 02:08                3322
eventbase.loop.php                                 13-Apr-2024 02:08                3643
eventbase.priorityinit.php                         13-Apr-2024 02:08                3078
eventbase.reinit.php                               13-Apr-2024 02:08                2409
eventbase.stop.php                                 13-Apr-2024 02:08                2883
eventbuffer.add.php                                13-Apr-2024 02:08                3079
eventbuffer.addbuffer.php                          13-Apr-2024 02:08                3431
eventbuffer.appendfrom.php                         13-Apr-2024 02:08                4923
eventbuffer.construct.php                          13-Apr-2024 02:08                1961
eventbuffer.copyout.php                            13-Apr-2024 02:08                3967
eventbuffer.drain.php                              13-Apr-2024 02:08                3554
eventbuffer.enablelocking.php                      13-Apr-2024 02:08                2893
eventbuffer.expand.php                             13-Apr-2024 02:08                2870
eventbuffer.freeze.php                             13-Apr-2024 02:08                3127
eventbuffer.lock.php                               13-Apr-2024 02:08                3018
eventbuffer.prepend.php                            13-Apr-2024 02:08                3554
eventbuffer.prependbuffer.php                      13-Apr-2024 02:08                3716
eventbuffer.pullup.php                             13-Apr-2024 02:08                4674
eventbuffer.read.php                               13-Apr-2024 02:08                4948
eventbuffer.readfrom.php                           13-Apr-2024 02:08                4380
eventbuffer.readline.php                           13-Apr-2024 02:08                4301
eventbuffer.search.php                             13-Apr-2024 02:08                8450
eventbuffer.searcheol.php                          13-Apr-2024 02:08                4990
eventbuffer.substr.php                             13-Apr-2024 02:08                3587
eventbuffer.unfreeze.php                           13-Apr-2024 02:08                3141
eventbuffer.unlock.php                             13-Apr-2024 02:08                2858
eventbuffer.write.php                              13-Apr-2024 02:08                3493
eventbufferevent.about.callbacks.php               13-Apr-2024 02:08                6105
eventbufferevent.close.php                         13-Apr-2024 02:08                2577
eventbufferevent.connect.php                       13-Apr-2024 02:08               23927
eventbufferevent.connecthost.php                   13-Apr-2024 02:08               17828
eventbufferevent.construct.php                     13-Apr-2024 02:08                6881
eventbufferevent.createpair.php                    13-Apr-2024 02:08                4334
eventbufferevent.disable.php                       13-Apr-2024 02:08                3582
eventbufferevent.enable.php                        13-Apr-2024 02:08                4052
eventbufferevent.free.php                          13-Apr-2024 02:08                2798
eventbufferevent.getdnserrorstring.php             13-Apr-2024 02:08                3129
eventbufferevent.getenabled.php                    13-Apr-2024 02:08                3078
eventbufferevent.getinput.php                      13-Apr-2024 02:08                5019
eventbufferevent.getoutput.php                     13-Apr-2024 02:08                7900
eventbufferevent.read.php                          13-Apr-2024 02:08                3089
eventbufferevent.readbuffer.php                    13-Apr-2024 02:08                3268
eventbufferevent.setcallbacks.php                  13-Apr-2024 02:08                4578
eventbufferevent.setpriority.php                   13-Apr-2024 02:08                2979
eventbufferevent.settimeouts.php                   13-Apr-2024 02:08                3204
eventbufferevent.setwatermark.php                  13-Apr-2024 02:08                4105
eventbufferevent.sslerror.php                      13-Apr-2024 02:08                5906
eventbufferevent.sslfilter.php                     13-Apr-2024 02:08               34511
eventbufferevent.sslgetcipherinfo.php              13-Apr-2024 02:08                2940
eventbufferevent.sslgetciphername.php              13-Apr-2024 02:08                2843
eventbufferevent.sslgetcipherversion.php           13-Apr-2024 02:08                2872
eventbufferevent.sslgetprotocol.php                13-Apr-2024 02:08                2749
eventbufferevent.sslrenegotiate.php                13-Apr-2024 02:08                2833
eventbufferevent.sslsocket.php                     13-Apr-2024 02:08                5912
eventbufferevent.write.php                         13-Apr-2024 02:08                3264
eventbufferevent.writebuffer.php                   13-Apr-2024 02:08                3386
eventconfig.avoidmethod.php                        13-Apr-2024 02:08                4425
eventconfig.construct.php                          13-Apr-2024 02:08                4059
eventconfig.requirefeatures.php                    13-Apr-2024 02:08                6026
eventconfig.setflags.php                           13-Apr-2024 02:08                3381
eventconfig.setmaxdispatchinterval.php             13-Apr-2024 02:08                4577
eventdnsbase.addnameserverip.php                   13-Apr-2024 02:08                3006
eventdnsbase.addsearch.php                         13-Apr-2024 02:08                2563
eventdnsbase.clearsearch.php                       13-Apr-2024 02:08                2824
eventdnsbase.construct.php                         13-Apr-2024 02:08                7530
eventdnsbase.countnameservers.php                  13-Apr-2024 02:08                2551
eventdnsbase.loadhosts.php                         13-Apr-2024 02:08                2879
eventdnsbase.parseresolvconf.php                   13-Apr-2024 02:08                4255
eventdnsbase.setoption.php                         13-Apr-2024 02:08                3453
eventdnsbase.setsearchndots.php                    13-Apr-2024 02:08                2942
eventhttp.accept.php                               13-Apr-2024 02:08               12431
eventhttp.addserveralias.php                       13-Apr-2024 02:08                6467
eventhttp.bind.php                                 13-Apr-2024 02:08                7889
eventhttp.construct.php                            13-Apr-2024 02:08               17403
eventhttp.removeserveralias.php                    13-Apr-2024 02:08                3274
eventhttp.setallowedmethods.php                    13-Apr-2024 02:08                3402
eventhttp.setcallback.php                          13-Apr-2024 02:08               18088
eventhttp.setdefaultcallback.php                   13-Apr-2024 02:08                7885
eventhttp.setmaxbodysize.php                       13-Apr-2024 02:08                2922
eventhttp.setmaxheaderssize.php                    13-Apr-2024 02:08                2834
eventhttp.settimeout.php                           13-Apr-2024 02:08                2516
eventhttpconnection.construct.php                  13-Apr-2024 02:08                5124
eventhttpconnection.getbase.php                    13-Apr-2024 02:08                2626
eventhttpconnection.getpeer.php                    13-Apr-2024 02:08                3032
eventhttpconnection.makerequest.php                13-Apr-2024 02:08               11696
eventhttpconnection.setclosecallback.php           13-Apr-2024 02:08                9436
eventhttpconnection.setlocaladdress.php            13-Apr-2024 02:08                3221
eventhttpconnection.setlocalport.php               13-Apr-2024 02:08                3110
eventhttpconnection.setmaxbodysize.php             13-Apr-2024 02:08                3146
eventhttpconnection.setmaxheaderssize.php          13-Apr-2024 02:08                3167
eventhttpconnection.setretries.php                 13-Apr-2024 02:08                2746
eventhttpconnection.settimeout.php                 13-Apr-2024 02:08                2643
eventhttprequest.addheader.php                     13-Apr-2024 02:08                3996
eventhttprequest.cancel.php                        13-Apr-2024 02:08                2852
eventhttprequest.clearheaders.php                  13-Apr-2024 02:08                2809
eventhttprequest.closeconnection.php               13-Apr-2024 02:08                2407
eventhttprequest.construct.php                     13-Apr-2024 02:08               11414
eventhttprequest.findheader.php                    13-Apr-2024 02:08                3552
eventhttprequest.free.php                          13-Apr-2024 02:08                2315
eventhttprequest.getbufferevent.php                13-Apr-2024 02:08                3690
eventhttprequest.getcommand.php                    13-Apr-2024 02:08                2690
eventhttprequest.getconnection.php                 13-Apr-2024 02:08                4444
eventhttprequest.gethost.php                       13-Apr-2024 02:08                2872
eventhttprequest.getinputbuffer.php                13-Apr-2024 02:08                2774
eventhttprequest.getinputheaders.php               13-Apr-2024 02:08                2865
eventhttprequest.getoutputbuffer.php               13-Apr-2024 02:08                2833
eventhttprequest.getoutputheaders.php              13-Apr-2024 02:08                2816
eventhttprequest.getresponsecode.php               13-Apr-2024 02:08                3152
eventhttprequest.geturi.php                        13-Apr-2024 02:08                3065
eventhttprequest.removeheader.php                  13-Apr-2024 02:08                3512
eventhttprequest.senderror.php                     13-Apr-2024 02:08                5848
eventhttprequest.sendreply.php                     13-Apr-2024 02:08                4057
eventhttprequest.sendreplychunk.php                13-Apr-2024 02:08                3429
eventhttprequest.sendreplyend.php                  13-Apr-2024 02:08                3042
eventhttprequest.sendreplystart.php                13-Apr-2024 02:08                4316
eventlistener.construct.php                        13-Apr-2024 02:08               22410
eventlistener.disable.php                          13-Apr-2024 02:08                2834
eventlistener.enable.php                           13-Apr-2024 02:08                2820
eventlistener.getbase.php                          13-Apr-2024 02:08                2329
eventlistener.getsocketname.php                    13-Apr-2024 02:08                3374
eventlistener.setcallback.php                      13-Apr-2024 02:08                6024
eventlistener.seterrorcallback.php                 13-Apr-2024 02:08                4401
eventsslcontext.construct.php                      13-Apr-2024 02:08                5286
eventutil.construct.php                            13-Apr-2024 02:08                2155
eventutil.getlastsocketerrno.php                   13-Apr-2024 02:08                3301
eventutil.getlastsocketerror.php                   13-Apr-2024 02:08                3117
eventutil.getsocketfd.php                          13-Apr-2024 02:08                3214
eventutil.getsocketname.php                        13-Apr-2024 02:08                3777
eventutil.setsocketoption.php                      13-Apr-2024 02:08                5756
eventutil.sslrandpoll.php                          13-Apr-2024 02:08                2380
evfork.construct.php                               13-Apr-2024 02:08                3657
evfork.createstopped.php                           13-Apr-2024 02:08                3942
evidle.construct.php                               13-Apr-2024 02:08                3661
evidle.createstopped.php                           13-Apr-2024 02:08                4140
evio.construct.php                                 13-Apr-2024 02:08                4809
evio.createstopped.php                             13-Apr-2024 02:08                5146
evio.set.php                                       13-Apr-2024 02:08                2828
evloop.backend.php                                 13-Apr-2024 02:08                2718
evloop.check.php                                   13-Apr-2024 02:08                3297
evloop.child.php                                   13-Apr-2024 02:08                3779
evloop.construct.php                               13-Apr-2024 02:08                4028
evloop.defaultloop.php                             13-Apr-2024 02:08                4626
evloop.embed.php                                   13-Apr-2024 02:08                3822
evloop.fork.php                                    13-Apr-2024 02:08                3379
evloop.idle.php                                    13-Apr-2024 02:08                3399
evloop.invokepending.php                           13-Apr-2024 02:08                2222
evloop.io.php                                      13-Apr-2024 02:08                3835
evloop.loopfork.php                                13-Apr-2024 02:08                2560
evloop.now.php                                     13-Apr-2024 02:08                2832
evloop.nowupdate.php                               13-Apr-2024 02:08                3146
evloop.periodic.php                                13-Apr-2024 02:08                3973
evloop.prepare.php                                 13-Apr-2024 02:08                3397
evloop.resume.php                                  13-Apr-2024 02:08                2806
evloop.run.php                                     13-Apr-2024 02:08                5036
evloop.signal.php                                  13-Apr-2024 02:08                3702
evloop.stat.php                                    13-Apr-2024 02:08                3883
evloop.stop.php                                    13-Apr-2024 02:08                2966
evloop.suspend.php                                 13-Apr-2024 02:08                2798
evloop.timer.php                                   13-Apr-2024 02:08                3900
evloop.verify.php                                  13-Apr-2024 02:08                2571
evperiodic.again.php                               13-Apr-2024 02:08                2561
evperiodic.at.php                                  13-Apr-2024 02:08                2630
evperiodic.construct.php                           13-Apr-2024 02:08               10009
evperiodic.createstopped.php                       13-Apr-2024 02:08                5848
evperiodic.set.php                                 13-Apr-2024 02:08                3185
evprepare.construct.php                            13-Apr-2024 02:08                3564
evprepare.createstopped.php                        13-Apr-2024 02:08                4303
evsignal.construct.php                             13-Apr-2024 02:08                5485
evsignal.createstopped.php                         13-Apr-2024 02:08                4828
evsignal.set.php                                   13-Apr-2024 02:08                2485
evstat.attr.php                                    13-Apr-2024 02:08                8217
evstat.construct.php                               13-Apr-2024 02:08                7199
evstat.createstopped.php                           13-Apr-2024 02:08                5204
evstat.prev.php                                    13-Apr-2024 02:08                2930
evstat.set.php                                     13-Apr-2024 02:08                2844
evstat.stat.php                                    13-Apr-2024 02:08                2987
evtimer.again.php                                  13-Apr-2024 02:08                3056
evtimer.construct.php                              13-Apr-2024 02:08               12651
evtimer.createstopped.php                          13-Apr-2024 02:08                8343
evtimer.set.php                                    13-Apr-2024 02:08                3001
evwatcher.clear.php                                13-Apr-2024 02:08                2817
evwatcher.construct.php                            13-Apr-2024 02:08                2096
evwatcher.feed.php                                 13-Apr-2024 02:08                2598
evwatcher.getloop.php                              13-Apr-2024 02:08                2303
evwatcher.invoke.php                               13-Apr-2024 02:08                2605
evwatcher.keepalive.php                            13-Apr-2024 02:08                5319
evwatcher.setcallback.php                          13-Apr-2024 02:08                2560
evwatcher.start.php                                13-Apr-2024 02:08                2503
evwatcher.stop.php                                 13-Apr-2024 02:08                2472
example.xml-external-entity.php                    13-Apr-2024 02:08               21364
example.xml-map-tags.php                           13-Apr-2024 02:08                8220
example.xml-structure.php                          13-Apr-2024 02:08                6224
example.xmlwriter-namespace.php                    13-Apr-2024 02:08                5440
example.xmlwriter-oop.php                          13-Apr-2024 02:08                3466
example.xmlwriter-simple.php                       13-Apr-2024 02:08                8676
exception.clone.php                                13-Apr-2024 02:08                3061
exception.construct.php                            13-Apr-2024 02:08                3775
exception.getcode.php                              13-Apr-2024 02:08                4740
exception.getfile.php                              13-Apr-2024 02:08                3877
exception.getline.php                              13-Apr-2024 02:08                4133
exception.getmessage.php                           13-Apr-2024 02:08                3937
exception.getprevious.php                          13-Apr-2024 02:08                6830
exception.gettrace.php                             13-Apr-2024 02:08                4363
exception.gettraceasstring.php                     13-Apr-2024 02:08                4250
exception.tostring.php                             13-Apr-2024 02:08                4168
exec.configuration.php                             13-Apr-2024 02:08                1243
exec.constants.php                                 13-Apr-2024 02:08                1148
exec.installation.php                              13-Apr-2024 02:08                1206
exec.requirements.php                              13-Apr-2024 02:08                1150
exec.resources.php                                 13-Apr-2024 02:08                1351
exec.setup.php                                     13-Apr-2024 02:08                1539
exif.configuration.php                             13-Apr-2024 02:08                7919
exif.constants.php                                 13-Apr-2024 02:08                2001
exif.installation.php                              13-Apr-2024 02:08                1719
exif.requirements.php                              13-Apr-2024 02:08                1774
exif.resources.php                                 13-Apr-2024 02:08                1194
exif.setup.php                                     13-Apr-2024 02:08                1551
expect.configuration.php                           13-Apr-2024 02:08                5651
expect.constants.php                               13-Apr-2024 02:08                3859
expect.examples-usage.php                          13-Apr-2024 02:08               12165
expect.examples.php                                13-Apr-2024 02:08                1360
expect.installation.php                            13-Apr-2024 02:08                2288
expect.requirements.php                            13-Apr-2024 02:08                1277
expect.resources.php                               13-Apr-2024 02:08                1405
expect.setup.php                                   13-Apr-2024 02:08                1576
extensions.alphabetical.php                        13-Apr-2024 02:08               20682
extensions.membership.php                          13-Apr-2024 02:08               20508
extensions.php                                     13-Apr-2024 02:08                1617
extensions.state.php                               13-Apr-2024 02:08                2769
fann.configuration.php                             13-Apr-2024 02:08                1243
fann.constants.php                                 13-Apr-2024 02:08               23583
fann.examples-1.php                                13-Apr-2024 02:08                8473
fann.examples.php                                  13-Apr-2024 02:08                1314
fann.installation.php                              13-Apr-2024 02:08                4865
fann.requirements.php                              13-Apr-2024 02:08                1132
fann.resources.php                                 13-Apr-2024 02:08                1142
fann.setup.php                                     13-Apr-2024 02:08                1523
fannconnection.construct.php                       13-Apr-2024 02:08                2985
fannconnection.getfromneuron.php                   13-Apr-2024 02:08                2356
fannconnection.gettoneuron.php                     13-Apr-2024 02:08                2344
fannconnection.getweight.php                       13-Apr-2024 02:08                2279
fannconnection.setweight.php                       13-Apr-2024 02:08                2912
faq.build.php                                      13-Apr-2024 02:08               24461
faq.com.php                                        13-Apr-2024 02:08               12729
faq.databases.php                                  13-Apr-2024 02:08                8224
faq.general.php                                    13-Apr-2024 02:08                4854
faq.html.php                                       13-Apr-2024 02:08               20078
faq.installation.php                               13-Apr-2024 02:08               25762
faq.mailinglist.php                                13-Apr-2024 02:08               10685
faq.misc.php                                       13-Apr-2024 02:08                4375
faq.obtaining.php                                  13-Apr-2024 02:08               10913
faq.passwords.php                                  13-Apr-2024 02:08               10207
faq.php                                            13-Apr-2024 02:08                1979
faq.using.php                                      13-Apr-2024 02:08               23467
fdf.configuration.php                              13-Apr-2024 02:08                1236
fdf.constants.php                                  13-Apr-2024 02:08                9196
fdf.examples.php                                   13-Apr-2024 02:08                5967
fdf.installation.php                               13-Apr-2024 02:08                3396
fdf.requirements.php                               13-Apr-2024 02:08                1469
fdf.resources.php                                  13-Apr-2024 02:08                1702
fdf.setup.php                                      13-Apr-2024 02:08                1531
features.commandline.differences.php               13-Apr-2024 02:08               12192
features.commandline.ini.php                       13-Apr-2024 02:08                2389
features.commandline.interactive.php               13-Apr-2024 02:08                8861
features.commandline.introduction.php              13-Apr-2024 02:08                7193
features.commandline.io-streams.php                13-Apr-2024 02:08                5934
features.commandline.options.php                   13-Apr-2024 02:08               26212
features.commandline.php                           13-Apr-2024 02:08                2056
features.commandline.usage.php                     13-Apr-2024 02:08               14483
features.commandline.webserver.php                 13-Apr-2024 02:08               12364
features.connection-handling.php                   13-Apr-2024 02:08                5724
features.cookies.php                               13-Apr-2024 02:08                3036
features.dtrace.dtrace.php                         13-Apr-2024 02:08               13912
features.dtrace.introduction.php                   13-Apr-2024 02:08                3080
features.dtrace.php                                13-Apr-2024 02:08                1605
features.dtrace.systemtap.php                      13-Apr-2024 02:08                8012
features.file-upload.common-pitfalls.php           13-Apr-2024 02:08                4919
features.file-upload.errors.php                    13-Apr-2024 02:08                3732
features.file-upload.errors.seealso.php            13-Apr-2024 02:08                1336
features.file-upload.multiple.php                  13-Apr-2024 02:08                6660
features.file-upload.php                           13-Apr-2024 02:08                1938
features.file-upload.post-method.php               13-Apr-2024 02:08               16563
features.file-upload.put-method.php                13-Apr-2024 02:08                5608
features.gc.collecting-cycles.php                  13-Apr-2024 02:08                7909
features.gc.performance-considerations.php         13-Apr-2024 02:08               13779
features.gc.php                                    13-Apr-2024 02:08                1701
features.gc.refcounting-basics.php                 13-Apr-2024 02:08               21395
features.http-auth.php                             13-Apr-2024 02:08               23415
features.persistent-connections.php                13-Apr-2024 02:08                8468
features.php                                       13-Apr-2024 02:08                4212
features.remote-files.php                          13-Apr-2024 02:08                8127
features.session.security.management.php           13-Apr-2024 02:08               26816
features.sessions.php                              13-Apr-2024 02:08                1405
features.xforms.php                                13-Apr-2024 02:08                5313
ffi-ctype.getalignment.php                         13-Apr-2024 02:08                2333
ffi-ctype.getarrayelementtype.php                  13-Apr-2024 02:08                2419
ffi-ctype.getarraylength.php                       13-Apr-2024 02:08                2376
ffi-ctype.getattributes.php                        13-Apr-2024 02:08                2352
ffi-ctype.getenumkind.php                          13-Apr-2024 02:08                2328
ffi-ctype.getfuncabi.php                           13-Apr-2024 02:08                2336
ffi-ctype.getfuncparametercount.php                13-Apr-2024 02:08                2442
ffi-ctype.getfuncparametertype.php                 13-Apr-2024 02:08                2676
ffi-ctype.getfuncreturntype.php                    13-Apr-2024 02:08                2401
ffi-ctype.getkind.php                              13-Apr-2024 02:08                2290
ffi-ctype.getname.php                              13-Apr-2024 02:08                2296
ffi-ctype.getpointertype.php                       13-Apr-2024 02:08                2345
ffi-ctype.getsize.php                              13-Apr-2024 02:08                2308
ffi-ctype.getstructfieldnames.php                  13-Apr-2024 02:08                2418
ffi-ctype.getstructfieldoffset.php                 13-Apr-2024 02:08                2672
ffi-ctype.getstructfieldtype.php                   13-Apr-2024 02:08                2634
ffi.addr.php                                       13-Apr-2024 02:08                2760
ffi.alignof.php                                    13-Apr-2024 02:08                2890
ffi.arraytype.php                                  13-Apr-2024 02:08                4590
ffi.cast.php                                       13-Apr-2024 02:08                4804
ffi.cdef.php                                       13-Apr-2024 02:08                4432
ffi.configuration.php                              13-Apr-2024 02:08                4455
ffi.constants.php                                  13-Apr-2024 02:08                1118
ffi.examples-basic.php                             13-Apr-2024 02:08               15769
ffi.examples-callback.php                          13-Apr-2024 02:08                4727
ffi.examples-complete.php                          13-Apr-2024 02:08                5408
ffi.examples.php                                   13-Apr-2024 02:08                1471
ffi.free.php                                       13-Apr-2024 02:08                2399
ffi.installation.php                               13-Apr-2024 02:08                1389
ffi.isnull.php                                     13-Apr-2024 02:08                2503
ffi.load.php                                       13-Apr-2024 02:08                4278
ffi.memcmp.php                                     13-Apr-2024 02:08                4068
ffi.memcpy.php                                     13-Apr-2024 02:08                3251
ffi.memset.php                                     13-Apr-2024 02:08                3091
ffi.new.php                                        13-Apr-2024 02:08                5136
ffi.requirements.php                               13-Apr-2024 02:08                1228
ffi.resources.php                                  13-Apr-2024 02:08                1187
ffi.scope.php                                      13-Apr-2024 02:08                3117
ffi.setup.php                                      13-Apr-2024 02:08                1521
ffi.sizeof.php                                     13-Apr-2024 02:08                2731
ffi.string.php                                     13-Apr-2024 02:08                4173
ffi.type.php                                       13-Apr-2024 02:08                3550
ffi.typeof.php                                     13-Apr-2024 02:08                2824
fiber.construct.php                                13-Apr-2024 02:08                2284
fiber.getcurrent.php                               13-Apr-2024 02:08                2497
fiber.getreturn.php                                13-Apr-2024 02:08                2549
fiber.isrunning.php                                13-Apr-2024 02:08                2713
fiber.isstarted.php                                13-Apr-2024 02:08                2295
fiber.issuspended.php                              13-Apr-2024 02:08                2307
fiber.isterminated.php                             13-Apr-2024 02:08                2360
fiber.resume.php                                   13-Apr-2024 02:08                3393
fiber.start.php                                    13-Apr-2024 02:08                3073
fiber.suspend.php                                  13-Apr-2024 02:08                4027
fiber.throw.php                                    13-Apr-2024 02:08                3232
fibererror.construct.php                           13-Apr-2024 02:08                2183
fileinfo.configuration.php                         13-Apr-2024 02:08                1271
fileinfo.constants.php                             13-Apr-2024 02:08                6198
fileinfo.installation.php                          13-Apr-2024 02:08                1741
fileinfo.requirements.php                          13-Apr-2024 02:08                1178
fileinfo.resources.php                             13-Apr-2024 02:08                1432
fileinfo.setup.php                                 13-Apr-2024 02:08                1597
filesystem.configuration.php                       13-Apr-2024 02:08                8208
filesystem.constants.php                           13-Apr-2024 02:08               12538
filesystem.installation.php                        13-Apr-2024 02:08                1248
filesystem.requirements.php                        13-Apr-2024 02:08                1192
filesystem.resources.php                           13-Apr-2024 02:08                1287
filesystem.setup.php                               13-Apr-2024 02:08                1622
filesystemiterator.construct.php                   13-Apr-2024 02:08                7513
filesystemiterator.current.php                     13-Apr-2024 02:08                5366
filesystemiterator.getflags.php                    13-Apr-2024 02:08                3187
filesystemiterator.key.php                         13-Apr-2024 02:08                5084
filesystemiterator.next.php                        13-Apr-2024 02:08                4493
filesystemiterator.rewind.php                      13-Apr-2024 02:08                5122
filesystemiterator.setflags.php                    13-Apr-2024 02:08                6634
filter.configuration.php                           13-Apr-2024 02:08                5198
filter.constants.php                               13-Apr-2024 02:08               24967
filter.examples.php                                13-Apr-2024 02:08                1421
filter.examples.sanitization.php                   13-Apr-2024 02:08                5531
filter.examples.validation.php                     13-Apr-2024 02:08               10103
filter.filters.flags.php                           13-Apr-2024 02:08               16810
filter.filters.misc.php                            13-Apr-2024 02:08                1887
filter.filters.php                                 13-Apr-2024 02:08                1574
filter.filters.sanitize.php                        13-Apr-2024 02:08               13575
filter.filters.validate.php                        13-Apr-2024 02:08               13896
filter.installation.php                            13-Apr-2024 02:08                1279
filter.requirements.php                            13-Apr-2024 02:08                1164
filter.resources.php                               13-Apr-2024 02:08                1197
filter.setup.php                                   13-Apr-2024 02:08                1560
filteriterator.accept.php                          13-Apr-2024 02:08                5277
filteriterator.construct.php                       13-Apr-2024 02:08                3057
filteriterator.current.php                         13-Apr-2024 02:08                2953
filteriterator.key.php                             13-Apr-2024 02:08                2893
filteriterator.next.php                            13-Apr-2024 02:08                2908
filteriterator.rewind.php                          13-Apr-2024 02:08                3086
filteriterator.valid.php                           13-Apr-2024 02:08                2798
filters.compression.php                            13-Apr-2024 02:08               16192
filters.convert.php                                13-Apr-2024 02:08               13271
filters.encryption.php                             13-Apr-2024 02:08               41007
filters.php                                        13-Apr-2024 02:08                3412
filters.string.php                                 13-Apr-2024 02:08               10366
finfo.buffer.php                                   13-Apr-2024 02:08                2857
finfo.construct.php                                13-Apr-2024 02:08                3122
finfo.file.php                                     13-Apr-2024 02:08                2848
finfo.set-flags.php                                13-Apr-2024 02:08                2067
fpm.observability.php                              13-Apr-2024 02:08                1342
fpm.setup.php                                      13-Apr-2024 02:08                1235
fpm.status.php                                     13-Apr-2024 02:08               10050
ftp.configuration.php                              13-Apr-2024 02:08                1236
ftp.constants.php                                  13-Apr-2024 02:08                5388
ftp.examples-basic.php                             13-Apr-2024 02:08                4903
ftp.examples.php                                   13-Apr-2024 02:08                1318
ftp.installation.php                               13-Apr-2024 02:08                1437
ftp.requirements.php                               13-Apr-2024 02:08                1143
ftp.resources.php                                  13-Apr-2024 02:08                1524
ftp.setup.php                                      13-Apr-2024 02:08                1531
funchand.configuration.php                         13-Apr-2024 02:08                1271
funchand.constants.php                             13-Apr-2024 02:08                1171
funchand.installation.php                          13-Apr-2024 02:08                1234
funchand.requirements.php                          13-Apr-2024 02:08                1178
funchand.resources.php                             13-Apr-2024 02:08                1222
funchand.setup.php                                 13-Apr-2024 02:08                1575
funcref.php                                        13-Apr-2024 02:08               14618
function.abs.php                                   13-Apr-2024 02:08                5560
function.acos.php                                  13-Apr-2024 02:08                3453
function.acosh.php                                 13-Apr-2024 02:08                3227
function.addcslashes.php                           13-Apr-2024 02:08                7991
function.addslashes.php                            13-Apr-2024 02:08                6428
function.apache-child-terminate.php                13-Apr-2024 02:08                3389
function.apache-get-modules.php                    13-Apr-2024 02:08                3319
function.apache-get-version.php                    13-Apr-2024 02:08                3932
function.apache-getenv.php                         13-Apr-2024 02:08                5248
function.apache-lookup-uri.php                     13-Apr-2024 02:08                5618
function.apache-note.php                           13-Apr-2024 02:08                7289
function.apache-request-headers.php                13-Apr-2024 02:08                5793
function.apache-response-headers.php               13-Apr-2024 02:08                4478
function.apache-setenv.php                         13-Apr-2024 02:08                5805
function.apcu-add.php                              13-Apr-2024 02:08                8478
function.apcu-cache-info.php                       13-Apr-2024 02:08                6723
function.apcu-cas.php                              13-Apr-2024 02:08                8778
function.apcu-clear-cache.php                      13-Apr-2024 02:08                2597
function.apcu-dec.php                              13-Apr-2024 02:08                8248
function.apcu-delete.php                           13-Apr-2024 02:08                6069
function.apcu-enabled.php                          13-Apr-2024 02:08                2381
function.apcu-entry.php                            13-Apr-2024 02:08                8448
function.apcu-exists.php                           13-Apr-2024 02:08                6944
function.apcu-fetch.php                            13-Apr-2024 02:08                5776
function.apcu-inc.php                              13-Apr-2024 02:08                8232
function.apcu-key-info.php                         13-Apr-2024 02:08                4965
function.apcu-sma-info.php                         13-Apr-2024 02:08                4613
function.apcu-store.php                            13-Apr-2024 02:08                7357
function.array-change-key-case.php                 13-Apr-2024 02:08                5385
function.array-chunk.php                           13-Apr-2024 02:08                7809
function.array-column.php                          13-Apr-2024 02:08               16991
function.array-combine.php                         13-Apr-2024 02:08                7459
function.array-count-values.php                    13-Apr-2024 02:08                5928
function.array-diff-assoc.php                      13-Apr-2024 02:08               11258
function.array-diff-key.php                        13-Apr-2024 02:08               12942
function.array-diff-uassoc.php                     13-Apr-2024 02:08               12204
function.array-diff-ukey.php                       13-Apr-2024 02:08               12518
function.array-diff.php                            13-Apr-2024 02:08               12237
function.array-fill-keys.php                       13-Apr-2024 02:08                5404
function.array-fill.php                            13-Apr-2024 02:08                8884
function.array-filter.php                          13-Apr-2024 02:08               16961
function.array-flip.php                            13-Apr-2024 02:08                7239
function.array-intersect-assoc.php                 13-Apr-2024 02:08                8860
function.array-intersect-key.php                   13-Apr-2024 02:08               10393
function.array-intersect-uassoc.php                13-Apr-2024 02:08                9326
function.array-intersect-ukey.php                  13-Apr-2024 02:08               12392
function.array-intersect.php                       13-Apr-2024 02:08                7026
function.array-is-list.php                         13-Apr-2024 02:08                6985
function.array-key-exists.php                      13-Apr-2024 02:08                8991
function.array-key-first.php                       13-Apr-2024 02:08                7132
function.array-key-last.php                        13-Apr-2024 02:08                3395
function.array-keys.php                            13-Apr-2024 02:08                8534
function.array-map.php                             13-Apr-2024 02:08               27659
function.array-merge-recursive.php                 13-Apr-2024 02:08                6780
function.array-merge.php                           13-Apr-2024 02:08               12466
function.array-multisort.php                       13-Apr-2024 02:08               23916
function.array-pad.php                             13-Apr-2024 02:08                7133
function.array-pop.php                             13-Apr-2024 02:08                5655
function.array-product.php                         13-Apr-2024 02:08                4400
function.array-push.php                            13-Apr-2024 02:08                6985
function.array-rand.php                            13-Apr-2024 02:08                8233
function.array-reduce.php                          13-Apr-2024 02:08               10153
function.array-replace-recursive.php               13-Apr-2024 02:08               10984
function.array-replace.php                         13-Apr-2024 02:08                6610
function.array-reverse.php                         13-Apr-2024 02:08                6197
function.array-search.php                          13-Apr-2024 02:08                8596
function.array-shift.php                           13-Apr-2024 02:08                5693
function.array-slice.php                           13-Apr-2024 02:08               14027
function.array-splice.php                          13-Apr-2024 02:08               18682
function.array-sum.php                             13-Apr-2024 02:08                5069
function.array-udiff-assoc.php                     13-Apr-2024 02:08               14979
function.array-udiff-uassoc.php                    13-Apr-2024 02:08               16468
function.array-udiff.php                           13-Apr-2024 02:08               27264
function.array-uintersect-assoc.php                13-Apr-2024 02:08                8824
function.array-uintersect-uassoc.php               13-Apr-2024 02:08                9475
function.array-uintersect.php                      13-Apr-2024 02:08                8352
function.array-unique.php                          13-Apr-2024 02:08                9836
function.array-unshift.php                         13-Apr-2024 02:08               11090
function.array-values.php                          13-Apr-2024 02:08                4672
function.array-walk-recursive.php                  13-Apr-2024 02:08                7743
function.array-walk.php                            13-Apr-2024 02:08               14406
function.array.php                                 13-Apr-2024 02:08               11965
function.arsort.php                                13-Apr-2024 02:08                9298
function.asin.php                                  13-Apr-2024 02:08                3448
function.asinh.php                                 13-Apr-2024 02:08                3223
function.asort.php                                 13-Apr-2024 02:08                9557
function.assert-options.php                        13-Apr-2024 02:08               14416
function.assert.php                                13-Apr-2024 02:08               30740
function.atan.php                                  13-Apr-2024 02:08                3461
function.atan2.php                                 13-Apr-2024 02:08                3417
function.atanh.php                                 13-Apr-2024 02:08                3248
function.autoload.php                              13-Apr-2024 02:08                3182
function.base-convert.php                          13-Apr-2024 02:08                6594
function.base64-decode.php                         13-Apr-2024 02:08                5120
function.base64-encode.php                         13-Apr-2024 02:08                4732
function.basename.php                              13-Apr-2024 02:08                7514
function.bcadd.php                                 13-Apr-2024 02:08                5936
function.bccomp.php                                13-Apr-2024 02:08                5876
function.bcdiv.php                                 13-Apr-2024 02:08                5492
function.bcmod.php                                 13-Apr-2024 02:08                7613
function.bcmul.php                                 13-Apr-2024 02:08                7362
function.bcpow.php                                 13-Apr-2024 02:08                7366
function.bcpowmod.php                              13-Apr-2024 02:08                7513
function.bcscale.php                               13-Apr-2024 02:08                5723
function.bcsqrt.php                                13-Apr-2024 02:08                6355
function.bcsub.php                                 13-Apr-2024 02:08                5932
function.bin2hex.php                               13-Apr-2024 02:08                4727
function.bind-textdomain-codeset.php               13-Apr-2024 02:08                4656
function.bindec.php                                13-Apr-2024 02:08               14852
function.bindtextdomain.php                        13-Apr-2024 02:08                5604
function.boolval.php                               13-Apr-2024 02:08               10249
function.bzclose.php                               13-Apr-2024 02:08                3149
function.bzcompress.php                            13-Apr-2024 02:08                5333
function.bzdecompress.php                          13-Apr-2024 02:08                6683
function.bzerrno.php                               13-Apr-2024 02:08                3190
function.bzerror.php                               13-Apr-2024 02:08                4459
function.bzerrstr.php                              13-Apr-2024 02:08                3211
function.bzflush.php                               13-Apr-2024 02:08                3453
function.bzopen.php                                13-Apr-2024 02:08                5262
function.bzread.php                                13-Apr-2024 02:08                6676
function.bzwrite.php                               13-Apr-2024 02:08                6556
function.cal-days-in-month.php                     13-Apr-2024 02:08                4628
function.cal-from-jd.php                           13-Apr-2024 02:08                7162
function.cal-info.php                              13-Apr-2024 02:08                6045
function.cal-to-jd.php                             13-Apr-2024 02:08                6353
function.call-user-func-array.php                  13-Apr-2024 02:08               18164
function.call-user-func.php                        13-Apr-2024 02:08               14603
function.ceil.php                                  13-Apr-2024 02:08                5137
function.chdir.php                                 13-Apr-2024 02:08                5759
function.checkdate.php                             13-Apr-2024 02:08                5610
function.checkdnsrr.php                            13-Apr-2024 02:08                5149
function.chgrp.php                                 13-Apr-2024 02:08                6616
function.chmod.php                                 13-Apr-2024 02:08                8780
function.chop.php                                  13-Apr-2024 02:08                1959
function.chown.php                                 13-Apr-2024 02:08                6870
function.chr.php                                   13-Apr-2024 02:08                8853
function.chroot.php                                13-Apr-2024 02:08                4769
function.chunk-split.php                           13-Apr-2024 02:08                5344
function.class-alias.php                           13-Apr-2024 02:08                8416
function.class-exists.php                          13-Apr-2024 02:08                7152
function.class-implements.php                      13-Apr-2024 02:08                7358
function.class-parents.php                         13-Apr-2024 02:08                7030
function.class-uses.php                            13-Apr-2024 02:08                6332
function.clearstatcache.php                        13-Apr-2024 02:08               11167
function.cli-get-process-title.php                 13-Apr-2024 02:08                4584
function.cli-set-process-title.php                 13-Apr-2024 02:08                6113
function.closedir.php                              13-Apr-2024 02:08                5230
function.closelog.php                              13-Apr-2024 02:08                2988
function.com-create-guid.php                       13-Apr-2024 02:08                2873
function.com-event-sink.php                        13-Apr-2024 02:08               10611
function.com-get-active-object.php                 13-Apr-2024 02:08                5862
function.com-load-typelib.php                      13-Apr-2024 02:08                5256
function.com-message-pump.php                      13-Apr-2024 02:08                4003
function.com-print-typeinfo.php                    13-Apr-2024 02:08                5115
function.commonmark-parse.php                      13-Apr-2024 02:08                4138
function.commonmark-render-html.php                13-Apr-2024 02:08                4679
function.commonmark-render-latex.php               13-Apr-2024 02:08                5009
function.commonmark-render-man.php                 13-Apr-2024 02:08                4991
function.commonmark-render-xml.php                 13-Apr-2024 02:08                4636
function.commonmark-render.php                     13-Apr-2024 02:08                4937
function.compact.php                               13-Apr-2024 02:08                8362
function.connection-aborted.php                    13-Apr-2024 02:08                3144
function.connection-status.php                     13-Apr-2024 02:08                3224
function.constant.php                              13-Apr-2024 02:08                9252
function.convert-cyr-string.php                    13-Apr-2024 02:08                5164
function.convert-uudecode.php                      13-Apr-2024 02:08                4604
function.convert-uuencode.php                      13-Apr-2024 02:08                5470
function.copy.php                                  13-Apr-2024 02:08                6051
function.cos.php                                   13-Apr-2024 02:08                3933
function.cosh.php                                  13-Apr-2024 02:08                3168
function.count-chars.php                           13-Apr-2024 02:08                7280
function.count.php                                 13-Apr-2024 02:08               16139
function.crc32.php                                 13-Apr-2024 02:08                7704
function.create-function.php                       13-Apr-2024 02:08               31292
function.crypt.php                                 13-Apr-2024 02:08               13831
function.ctype-alnum.php                           13-Apr-2024 02:08                6992
function.ctype-alpha.php                           13-Apr-2024 02:08                7285
function.ctype-cntrl.php                           13-Apr-2024 02:08                6881
function.ctype-digit.php                           13-Apr-2024 02:08                8981
function.ctype-graph.php                           13-Apr-2024 02:08                7701
function.ctype-lower.php                           13-Apr-2024 02:08                6913
function.ctype-print.php                           13-Apr-2024 02:08                7733
function.ctype-punct.php                           13-Apr-2024 02:08                7030
function.ctype-space.php                           13-Apr-2024 02:08                7627
function.ctype-upper.php                           13-Apr-2024 02:08                6982
function.ctype-xdigit.php                          13-Apr-2024 02:08                6759
function.cubrid-affected-rows.php                  13-Apr-2024 02:08                9397
function.cubrid-bind.php                           13-Apr-2024 02:08               20708
function.cubrid-client-encoding.php                13-Apr-2024 02:08                5277
function.cubrid-close-prepare.php                  13-Apr-2024 02:08                6251
function.cubrid-close-request.php                  13-Apr-2024 02:08                6262
function.cubrid-close.php                          13-Apr-2024 02:08                6392
function.cubrid-col-get.php                        13-Apr-2024 02:08                8551
function.cubrid-col-size.php                       13-Apr-2024 02:08                8669
function.cubrid-column-names.php                   13-Apr-2024 02:08                8515
function.cubrid-column-types.php                   13-Apr-2024 02:08                8495
function.cubrid-commit.php                         13-Apr-2024 02:08               15332
function.cubrid-connect-with-url.php               13-Apr-2024 02:08               15115
function.cubrid-connect.php                        13-Apr-2024 02:08               12329
function.cubrid-current-oid.php                    13-Apr-2024 02:08                5996
function.cubrid-data-seek.php                      13-Apr-2024 02:08                7490
function.cubrid-db-name.php                        13-Apr-2024 02:08                6549
function.cubrid-disconnect.php                     13-Apr-2024 02:08                7158
function.cubrid-drop.php                           13-Apr-2024 02:08               11427
function.cubrid-errno.php                          13-Apr-2024 02:08                6806
function.cubrid-error-code-facility.php            13-Apr-2024 02:08                5825
function.cubrid-error-code.php                     13-Apr-2024 02:08                5735
function.cubrid-error-msg.php                      13-Apr-2024 02:08                5185
function.cubrid-error.php                          13-Apr-2024 02:08                6366
function.cubrid-execute.php                        13-Apr-2024 02:08               14379
function.cubrid-fetch-array.php                    13-Apr-2024 02:08                9807
function.cubrid-fetch-assoc.php                    13-Apr-2024 02:08                9041
function.cubrid-fetch-field.php                    13-Apr-2024 02:08               14080
function.cubrid-fetch-lengths.php                  13-Apr-2024 02:08                6123
function.cubrid-fetch-object.php                   13-Apr-2024 02:08               11986
function.cubrid-fetch-row.php                      13-Apr-2024 02:08                8965
function.cubrid-fetch.php                          13-Apr-2024 02:08                9941
function.cubrid-field-flags.php                    13-Apr-2024 02:08                7776
function.cubrid-field-len.php                      13-Apr-2024 02:08                8285
function.cubrid-field-name.php                     13-Apr-2024 02:08                7191
function.cubrid-field-seek.php                     13-Apr-2024 02:08               10943
function.cubrid-field-table.php                    13-Apr-2024 02:08                7396
function.cubrid-field-type.php                     13-Apr-2024 02:08                7458
function.cubrid-free-result.php                    13-Apr-2024 02:08                5935
function.cubrid-get-autocommit.php                 13-Apr-2024 02:08                3798
function.cubrid-get-charset.php                    13-Apr-2024 02:08                5008
function.cubrid-get-class-name.php                 13-Apr-2024 02:08                6338
function.cubrid-get-client-info.php                13-Apr-2024 02:08                8137
function.cubrid-get-db-parameter.php               13-Apr-2024 02:08               14305
function.cubrid-get-query-timeout.php              13-Apr-2024 02:08                6724
function.cubrid-get-server-info.php                13-Apr-2024 02:08                8428
function.cubrid-get.php                            13-Apr-2024 02:08                9851
function.cubrid-insert-id.php                      13-Apr-2024 02:08                7135
function.cubrid-is-instance.php                    13-Apr-2024 02:08                7175
function.cubrid-list-dbs.php                       13-Apr-2024 02:08                4538
function.cubrid-load-from-glo.php                  13-Apr-2024 02:08                6884
function.cubrid-lob-close.php                      13-Apr-2024 02:08                7252
function.cubrid-lob-export.php                     13-Apr-2024 02:08                7831
function.cubrid-lob-get.php                        13-Apr-2024 02:08                7635
function.cubrid-lob-send.php                       13-Apr-2024 02:08                7006
function.cubrid-lob-size.php                       13-Apr-2024 02:08                5834
function.cubrid-lob2-bind.php                      13-Apr-2024 02:08                9716
function.cubrid-lob2-close.php                     13-Apr-2024 02:08                3408
function.cubrid-lob2-export.php                    13-Apr-2024 02:08                8709
function.cubrid-lob2-import.php                    13-Apr-2024 02:08                8578
function.cubrid-lob2-new.php                       13-Apr-2024 02:08                3933
function.cubrid-lob2-read.php                      13-Apr-2024 02:08               13679
function.cubrid-lob2-seek.php                      13-Apr-2024 02:08               11240
function.cubrid-lob2-seek64.php                    13-Apr-2024 02:08               12665
function.cubrid-lob2-size.php                      13-Apr-2024 02:08                4314
function.cubrid-lob2-size64.php                    13-Apr-2024 02:08                4494
function.cubrid-lob2-tell.php                      13-Apr-2024 02:08                4333
function.cubrid-lob2-tell64.php                    13-Apr-2024 02:08                4531
function.cubrid-lob2-write.php                     13-Apr-2024 02:08               14000
function.cubrid-lock-read.php                      13-Apr-2024 02:08                9148
function.cubrid-lock-write.php                     13-Apr-2024 02:08                9536
function.cubrid-move-cursor.php                    13-Apr-2024 02:08                9520
function.cubrid-new-glo.php                        13-Apr-2024 02:08                6935
function.cubrid-next-result.php                    13-Apr-2024 02:08               16307
function.cubrid-num-cols.php                       13-Apr-2024 02:08                5972
function.cubrid-num-fields.php                     13-Apr-2024 02:08                5685
function.cubrid-num-rows.php                       13-Apr-2024 02:08                7156
function.cubrid-pconnect-with-url.php              13-Apr-2024 02:08               14442
function.cubrid-pconnect.php                       13-Apr-2024 02:08               12110
function.cubrid-ping.php                           13-Apr-2024 02:08                6069
function.cubrid-prepare.php                        13-Apr-2024 02:08               10265
function.cubrid-put.php                            13-Apr-2024 02:08               11369
function.cubrid-query.php                          13-Apr-2024 02:08               14710
function.cubrid-real-escape-string.php             13-Apr-2024 02:08                8206
function.cubrid-result.php                         13-Apr-2024 02:08                7416
function.cubrid-rollback.php                       13-Apr-2024 02:08               14627
function.cubrid-save-to-glo.php                    13-Apr-2024 02:08                6797
function.cubrid-schema.php                         13-Apr-2024 02:08               20460
function.cubrid-send-glo.php                       13-Apr-2024 02:08                6264
function.cubrid-seq-drop.php                       13-Apr-2024 02:08                9797
function.cubrid-seq-insert.php                     13-Apr-2024 02:08               10303
function.cubrid-seq-put.php                        13-Apr-2024 02:08               10230
function.cubrid-set-add.php                        13-Apr-2024 02:08                9569
function.cubrid-set-autocommit.php                 13-Apr-2024 02:08                4171
function.cubrid-set-db-parameter.php               13-Apr-2024 02:08                8189
function.cubrid-set-drop.php                       13-Apr-2024 02:08                9546
function.cubrid-set-query-timeout.php              13-Apr-2024 02:08                3559
function.cubrid-unbuffered-query.php               13-Apr-2024 02:08                7003
function.cubrid-version.php                        13-Apr-2024 02:08                8687
function.curl-close.php                            13-Apr-2024 02:08                6137
function.curl-copy-handle.php                      13-Apr-2024 02:08                6457
function.curl-errno.php                            13-Apr-2024 02:08                5797
function.curl-error.php                            13-Apr-2024 02:08                5959
function.curl-escape.php                           13-Apr-2024 02:08                7520
function.curl-exec.php                             13-Apr-2024 02:08                7562
function.curl-getinfo.php                          13-Apr-2024 02:08               37216
function.curl-init.php                             13-Apr-2024 02:08                7419
function.curl-multi-add-handle.php                 13-Apr-2024 02:08               10714
function.curl-multi-close.php                      13-Apr-2024 02:08                9692
function.curl-multi-errno.php                      13-Apr-2024 02:08                3918
function.curl-multi-exec.php                       13-Apr-2024 02:08               10720
function.curl-multi-getcontent.php                 13-Apr-2024 02:08                4427
function.curl-multi-info-read.php                  13-Apr-2024 02:08               12133
function.curl-multi-init.php                       13-Apr-2024 02:08                9133
function.curl-multi-remove-handle.php              13-Apr-2024 02:08                5506
function.curl-multi-select.php                     13-Apr-2024 02:08                4386
function.curl-multi-setopt.php                     13-Apr-2024 02:08               12898
function.curl-multi-strerror.php                   13-Apr-2024 02:08                7108
function.curl-pause.php                            13-Apr-2024 02:08                3874
function.curl-reset.php                            13-Apr-2024 02:08                6415
function.curl-setopt-array.php                     13-Apr-2024 02:08                7595
function.curl-setopt.php                           13-Apr-2024 02:08              173278
function.curl-share-close.php                      13-Apr-2024 02:08                8092
function.curl-share-errno.php                      13-Apr-2024 02:08                3947
function.curl-share-init.php                       13-Apr-2024 02:08                7693
function.curl-share-setopt.php                     13-Apr-2024 02:08               10305
function.curl-share-strerror.php                   13-Apr-2024 02:08                3481
function.curl-strerror.php                         13-Apr-2024 02:08                6280
function.curl-unescape.php                         13-Apr-2024 02:08                8020
function.curl-version.php                          13-Apr-2024 02:08                6967
function.curl_upkeep.php                           13-Apr-2024 02:08                6885
function.current.php                               13-Apr-2024 02:08               11355
function.date-add.php                              13-Apr-2024 02:08                1717
function.date-create-from-format.php               13-Apr-2024 02:08                1891
function.date-create-immutable-from-format.php     13-Apr-2024 02:08                2002
function.date-create-immutable.php                 13-Apr-2024 02:08                4219
function.date-create.php                           13-Apr-2024 02:08                4413
function.date-date-set.php                         13-Apr-2024 02:08                1776
function.date-default-timezone-get.php             13-Apr-2024 02:08                7123
function.date-default-timezone-set.php             13-Apr-2024 02:08                5827
function.date-diff.php                             13-Apr-2024 02:08                1736
function.date-format.php                           13-Apr-2024 02:08                1744
function.date-get-last-errors.php                  13-Apr-2024 02:08                1909
function.date-interval-create-from-date-string.php 13-Apr-2024 02:08                2020
function.date-interval-format.php                  13-Apr-2024 02:08                1871
function.date-isodate-set.php                      13-Apr-2024 02:08                1799
function.date-modify.php                           13-Apr-2024 02:08                1748
function.date-offset-get.php                       13-Apr-2024 02:08                1792
function.date-parse-from-format.php                13-Apr-2024 02:08               13969
function.date-parse.php                            13-Apr-2024 02:08               19453
function.date-sub.php                              13-Apr-2024 02:08                2328
function.date-sun-info.php                         13-Apr-2024 02:08               15887
function.date-sunrise.php                          13-Apr-2024 02:08               14193
function.date-sunset.php                           13-Apr-2024 02:08               14225
function.date-time-set.php                         13-Apr-2024 02:08                1762
function.date-timestamp-get.php                    13-Apr-2024 02:08                1821
function.date-timestamp-set.php                    13-Apr-2024 02:08                1829
function.date-timezone-get.php                     13-Apr-2024 02:08                1818
function.date-timezone-set.php                     13-Apr-2024 02:08                1790
function.date.php                                  13-Apr-2024 02:08               22154
function.db2-autocommit.php                        13-Apr-2024 02:08               11031
function.db2-bind-param.php                        13-Apr-2024 02:08               22480
function.db2-client-info.php                       13-Apr-2024 02:08               11658
function.db2-close.php                             13-Apr-2024 02:08                5647
function.db2-column-privileges.php                 13-Apr-2024 02:08                9134
function.db2-columns.php                           13-Apr-2024 02:08               11183
function.db2-commit.php                            13-Apr-2024 02:08                3715
function.db2-conn-error.php                        13-Apr-2024 02:08                6921
function.db2-conn-errormsg.php                     13-Apr-2024 02:08                6713
function.db2-connect.php                           13-Apr-2024 02:08               38703
function.db2-cursor-type.php                       13-Apr-2024 02:08                3180
function.db2-escape-string.php                     13-Apr-2024 02:08                7558
function.db2-exec.php                              13-Apr-2024 02:08               26268
function.db2-execute.php                           13-Apr-2024 02:08               25643
function.db2-fetch-array.php                       13-Apr-2024 02:08               11294
function.db2-fetch-assoc.php                       13-Apr-2024 02:08               11286
function.db2-fetch-both.php                        13-Apr-2024 02:08               11819
function.db2-fetch-object.php                      13-Apr-2024 02:08                8996
function.db2-fetch-row.php                         13-Apr-2024 02:08               16283
function.db2-field-display-size.php                13-Apr-2024 02:08                5098
function.db2-field-name.php                        13-Apr-2024 02:08                4986
function.db2-field-num.php                         13-Apr-2024 02:08                4994
function.db2-field-precision.php                   13-Apr-2024 02:08                5026
function.db2-field-scale.php                       13-Apr-2024 02:08                4988
function.db2-field-type.php                        13-Apr-2024 02:08                4991
function.db2-field-width.php                       13-Apr-2024 02:08                5196
function.db2-foreign-keys.php                      13-Apr-2024 02:08                9039
function.db2-free-result.php                       13-Apr-2024 02:08                3373
function.db2-free-stmt.php                         13-Apr-2024 02:08                3361
function.db2-get-option.php                        13-Apr-2024 02:08               24102
function.db2-last-insert-id.php                    13-Apr-2024 02:08                8128
function.db2-lob-read.php                          13-Apr-2024 02:08               16365
function.db2-next-result.php                       13-Apr-2024 02:08                8802
function.db2-num-fields.php                        13-Apr-2024 02:08                7152
function.db2-num-rows.php                          13-Apr-2024 02:08                4729
function.db2-pclose.php                            13-Apr-2024 02:08                5845
function.db2-pconnect.php                          13-Apr-2024 02:08               31836
function.db2-prepare.php                           13-Apr-2024 02:08               10553
function.db2-primary-keys.php                      13-Apr-2024 02:08                7673
function.db2-procedure-columns.php                 13-Apr-2024 02:08               12141
function.db2-procedures.php                        13-Apr-2024 02:08                8002
function.db2-result.php                            13-Apr-2024 02:08                7955
function.db2-rollback.php                          13-Apr-2024 02:08                9299
function.db2-server-info.php                       13-Apr-2024 02:08               22480
function.db2-set-option.php                        13-Apr-2024 02:08               65998
function.db2-special-columns.php                   13-Apr-2024 02:08               10254
function.db2-statistics.php                        13-Apr-2024 02:08               12525
function.db2-stmt-error.php                        13-Apr-2024 02:08                4603
function.db2-stmt-errormsg.php                     13-Apr-2024 02:08                4234
function.db2-table-privileges.php                  13-Apr-2024 02:08                8563
function.db2-tables.php                            13-Apr-2024 02:08                8893
function.dba-close.php                             13-Apr-2024 02:08                3169
function.dba-delete.php                            13-Apr-2024 02:08                4119
function.dba-exists.php                            13-Apr-2024 02:08                4143
function.dba-fetch.php                             13-Apr-2024 02:08                7096
function.dba-firstkey.php                          13-Apr-2024 02:08                3642
function.dba-handlers.php                          13-Apr-2024 02:08                5507
function.dba-insert.php                            13-Apr-2024 02:08                4757
function.dba-key-split.php                         13-Apr-2024 02:08                3932
function.dba-list.php                              13-Apr-2024 02:08                2215
function.dba-nextkey.php                           13-Apr-2024 02:08                3564
function.dba-open.php                              13-Apr-2024 02:08               13827
function.dba-optimize.php                          13-Apr-2024 02:08                3203
function.dba-popen.php                             13-Apr-2024 02:08                9152
function.dba-replace.php                           13-Apr-2024 02:08                4585
function.dba-sync.php                              13-Apr-2024 02:08                3223
function.dbase-add-record.php                      13-Apr-2024 02:08                6914
function.dbase-close.php                           13-Apr-2024 02:08                5246
function.dbase-create.php                          13-Apr-2024 02:08                8228
function.dbase-delete-record.php                   13-Apr-2024 02:08                4991
function.dbase-get-header-info.php                 13-Apr-2024 02:08                6980
function.dbase-get-record-with-names.php           13-Apr-2024 02:08                8831
function.dbase-get-record.php                      13-Apr-2024 02:08                5781
function.dbase-numfields.php                       13-Apr-2024 02:08                5957
function.dbase-numrecords.php                      13-Apr-2024 02:08                6908
function.dbase-open.php                            13-Apr-2024 02:08                6577
function.dbase-pack.php                            13-Apr-2024 02:08                6338
function.dbase-replace-record.php                  13-Apr-2024 02:08                9476
function.dcgettext.php                             13-Apr-2024 02:08                3609
function.dcngettext.php                            13-Apr-2024 02:08                4286
function.debug-backtrace.php                       13-Apr-2024 02:08               11764
function.debug-print-backtrace.php                 13-Apr-2024 02:08                6707
function.debug-zval-dump.php                       13-Apr-2024 02:08                9958
function.decbin.php                                13-Apr-2024 02:08                8740
function.dechex.php                                13-Apr-2024 02:08                7132
function.decoct.php                                13-Apr-2024 02:08                4773
function.define.php                                13-Apr-2024 02:08               12174
function.defined.php                               13-Apr-2024 02:08                7852
function.deflate-add.php                           13-Apr-2024 02:08                5958
function.deflate-init.php                          13-Apr-2024 02:08                7899
function.deg2rad.php                               13-Apr-2024 02:08                3984
function.delete.php                                13-Apr-2024 02:08                2431
function.dgettext.php                              13-Apr-2024 02:08                3260
function.die.php                                   13-Apr-2024 02:08                1551
function.dio-close.php                             13-Apr-2024 02:08                4032
function.dio-fcntl.php                             13-Apr-2024 02:08                9960
function.dio-open.php                              13-Apr-2024 02:08                8637
function.dio-read.php                              13-Apr-2024 02:08                3608
function.dio-seek.php                              13-Apr-2024 02:08                7454
function.dio-stat.php                              13-Apr-2024 02:08                4394
function.dio-tcsetattr.php                         13-Apr-2024 02:08                6971
function.dio-truncate.php                          13-Apr-2024 02:08                3687
function.dio-write.php                             13-Apr-2024 02:08                3942
function.dir.php                                   13-Apr-2024 02:08                7233
function.dirname.php                               13-Apr-2024 02:08                9542
function.disk-free-space.php                       13-Apr-2024 02:08                5595
function.disk-total-space.php                      13-Apr-2024 02:08                5234
function.diskfreespace.php                         13-Apr-2024 02:08                1757
function.dl.php                                    13-Apr-2024 02:08                9893
function.dngettext.php                             13-Apr-2024 02:08                3972
function.dns-check-record.php                      13-Apr-2024 02:08                1719
function.dns-get-mx.php                            13-Apr-2024 02:08                1690
function.dns-get-record.php                        13-Apr-2024 02:08               24849
function.dom-import-simplexml.php                  13-Apr-2024 02:08                7170
function.doubleval.php                             13-Apr-2024 02:08                1679
function.each.php                                  13-Apr-2024 02:08               11263
function.easter-date.php                           13-Apr-2024 02:08               14361
function.easter-days.php                           13-Apr-2024 02:08                7548
function.echo.php                                  13-Apr-2024 02:08               17621
function.eio-busy.php                              13-Apr-2024 02:08                4910
function.eio-cancel.php                            13-Apr-2024 02:08                7472
function.eio-chmod.php                             13-Apr-2024 02:08                6151
function.eio-chown.php                             13-Apr-2024 02:08                6353
function.eio-close.php                             13-Apr-2024 02:08                5584
function.eio-custom.php                            13-Apr-2024 02:08               10236
function.eio-dup2.php                              13-Apr-2024 02:08                5629
function.eio-event-loop.php                        13-Apr-2024 02:08                5770
function.eio-fallocate.php                         13-Apr-2024 02:08                7489
function.eio-fchmod.php                            13-Apr-2024 02:08                6111
function.eio-fchown.php                            13-Apr-2024 02:08                6413
function.eio-fdatasync.php                         13-Apr-2024 02:08                5493
function.eio-fstat.php                             13-Apr-2024 02:08               11482
function.eio-fstatvfs.php                          13-Apr-2024 02:08                5626
function.eio-fsync.php                             13-Apr-2024 02:08                5600
function.eio-ftruncate.php                         13-Apr-2024 02:08                6129
function.eio-futime.php                            13-Apr-2024 02:08                6435
function.eio-get-event-stream.php                  13-Apr-2024 02:08                8028
function.eio-get-last-error.php                    13-Apr-2024 02:08                3107
function.eio-grp-add.php                           13-Apr-2024 02:08               11417
function.eio-grp-cancel.php                        13-Apr-2024 02:08                3104
function.eio-grp-limit.php                         13-Apr-2024 02:08                3018
function.eio-grp.php                               13-Apr-2024 02:08               11678
function.eio-init.php                              13-Apr-2024 02:08                2571
function.eio-link.php                              13-Apr-2024 02:08               12482
function.eio-lstat.php                             13-Apr-2024 02:08                9855
function.eio-mkdir.php                             13-Apr-2024 02:08                9168
function.eio-mknod.php                             13-Apr-2024 02:08               11459
function.eio-nop.php                               13-Apr-2024 02:08                5257
function.eio-npending.php                          13-Apr-2024 02:08                2988
function.eio-nready.php                            13-Apr-2024 02:08                2736
function.eio-nreqs.php                             13-Apr-2024 02:08                5520
function.eio-nthreads.php                          13-Apr-2024 02:08                3410
function.eio-open.php                              13-Apr-2024 02:08               11437
function.eio-poll.php                              13-Apr-2024 02:08                5653
function.eio-read.php                              13-Apr-2024 02:08               12452
function.eio-readahead.php                         13-Apr-2024 02:08                6162
function.eio-readdir.php                           13-Apr-2024 02:08               18187
function.eio-readlink.php                          13-Apr-2024 02:08               12179
function.eio-realpath.php                          13-Apr-2024 02:08                5313
function.eio-rename.php                            13-Apr-2024 02:08                9248
function.eio-rmdir.php                             13-Apr-2024 02:08                8199
function.eio-seek.php                              13-Apr-2024 02:08                6972
function.eio-sendfile.php                          13-Apr-2024 02:08                6487
function.eio-set-max-idle.php                      13-Apr-2024 02:08                3107
function.eio-set-max-parallel.php                  13-Apr-2024 02:08                3156
function.eio-set-max-poll-reqs.php                 13-Apr-2024 02:08                2469
function.eio-set-max-poll-time.php                 13-Apr-2024 02:08                2539
function.eio-set-min-parallel.php                  13-Apr-2024 02:08                3147
function.eio-stat.php                              13-Apr-2024 02:08                9832
function.eio-statvfs.php                           13-Apr-2024 02:08                8322
function.eio-symlink.php                           13-Apr-2024 02:08               10813
function.eio-sync-file-range.php                   13-Apr-2024 02:08                7267
function.eio-sync.php                              13-Apr-2024 02:08                2881
function.eio-syncfs.php                            13-Apr-2024 02:08                5176
function.eio-truncate.php                          13-Apr-2024 02:08                6106
function.eio-unlink.php                            13-Apr-2024 02:08                5282
function.eio-utime.php                             13-Apr-2024 02:08                6144
function.eio-write.php                             13-Apr-2024 02:08                6862
function.empty.php                                 13-Apr-2024 02:08                9338
function.enchant-broker-describe.php               13-Apr-2024 02:08                6043
function.enchant-broker-dict-exists.php            13-Apr-2024 02:08                5721
function.enchant-broker-free-dict.php              13-Apr-2024 02:08                4804
function.enchant-broker-free.php                   13-Apr-2024 02:08                4356
function.enchant-broker-get-dict-path.php          13-Apr-2024 02:08                5326
function.enchant-broker-get-error.php              13-Apr-2024 02:08                3667
function.enchant-broker-init.php                   13-Apr-2024 02:08                3485
function.enchant-broker-list-dicts.php             13-Apr-2024 02:08                6924
function.enchant-broker-request-dict.php           13-Apr-2024 02:08                7052
function.enchant-broker-request-pwl-dict.php       13-Apr-2024 02:08                5376
function.enchant-broker-set-dict-path.php          13-Apr-2024 02:08                5608
function.enchant-broker-set-ordering.php           13-Apr-2024 02:08                4805
function.enchant-dict-add-to-personal.php          13-Apr-2024 02:08                2180
function.enchant-dict-add-to-session.php           13-Apr-2024 02:08                4434
function.enchant-dict-add.php                      13-Apr-2024 02:08                6354
function.enchant-dict-check.php                    13-Apr-2024 02:08                4248
function.enchant-dict-describe.php                 13-Apr-2024 02:08                6535
function.enchant-dict-get-error.php                13-Apr-2024 02:08                3870
function.enchant-dict-is-added.php                 13-Apr-2024 02:08                4484
function.enchant-dict-is-in-session.php            13-Apr-2024 02:08                2166
function.enchant-dict-quick-check.php              13-Apr-2024 02:08                8296
function.enchant-dict-store-replacement.php        13-Apr-2024 02:08                4716
function.enchant-dict-suggest.php                  13-Apr-2024 02:08                7443
function.end.php                                   13-Apr-2024 02:08                6593
function.enum-exists.php                           13-Apr-2024 02:08                5398
function.error-clear-last.php                      13-Apr-2024 02:08                4595
function.error-get-last.php                        13-Apr-2024 02:08                4872
function.error-log.php                             13-Apr-2024 02:08               10917
function.error-reporting.php                       13-Apr-2024 02:08                8922
function.escapeshellarg.php                        13-Apr-2024 02:08                5525
function.escapeshellcmd.php                        13-Apr-2024 02:08                7720
function.eval.php                                  13-Apr-2024 02:08                9148
function.exec.php                                  13-Apr-2024 02:08               10994
function.exif-imagetype.php                        13-Apr-2024 02:08               10199
function.exif-read-data.php                        13-Apr-2024 02:08               22870
function.exif-tagname.php                          13-Apr-2024 02:08                4784
function.exif-thumbnail.php                        13-Apr-2024 02:08                9225
function.exit.php                                  13-Apr-2024 02:08                9319
function.exp.php                                   13-Apr-2024 02:08                4295
function.expect-expectl.php                        13-Apr-2024 02:08               11063
function.expect-popen.php                          13-Apr-2024 02:08                4621
function.explode.php                               13-Apr-2024 02:08               14845
function.expm1.php                                 13-Apr-2024 02:08                3453
function.extension-loaded.php                      13-Apr-2024 02:08                5591
function.extract.php                               13-Apr-2024 02:08               14223
function.ezmlm-hash.php                            13-Apr-2024 02:08                4596
function.fann-cascadetrain-on-data.php             13-Apr-2024 02:08                6589
function.fann-cascadetrain-on-file.php             13-Apr-2024 02:08                5555
function.fann-clear-scaling-params.php             13-Apr-2024 02:08                2681
function.fann-copy.php                             13-Apr-2024 02:08                3205
function.fann-create-from-file.php                 13-Apr-2024 02:08                3232
function.fann-create-shortcut-array.php            13-Apr-2024 02:08                4141
function.fann-create-shortcut.php                  13-Apr-2024 02:08                5161
function.fann-create-sparse-array.php              13-Apr-2024 02:08                4780
function.fann-create-sparse.php                    13-Apr-2024 02:08                5538
function.fann-create-standard-array.php            13-Apr-2024 02:08                4454
function.fann-create-standard.php                  13-Apr-2024 02:08                5229
function.fann-create-train-from-callback.php       13-Apr-2024 02:08                9026
function.fann-create-train.php                     13-Apr-2024 02:08                4554
function.fann-descale-input.php                    13-Apr-2024 02:08                3746
function.fann-descale-output.php                   13-Apr-2024 02:08                3762
function.fann-descale-train.php                    13-Apr-2024 02:08                3688
function.fann-destroy-train.php                    13-Apr-2024 02:08                2636
function.fann-destroy.php                          13-Apr-2024 02:08                2668
function.fann-duplicate-train-data.php             13-Apr-2024 02:08                2820
function.fann-get-activation-function.php          13-Apr-2024 02:08                5218
function.fann-get-activation-steepness.php         13-Apr-2024 02:08                5631
function.fann-get-bias-array.php                   13-Apr-2024 02:08                2553
function.fann-get-bit-fail-limit.php               13-Apr-2024 02:08                3778
function.fann-get-bit-fail.php                     13-Apr-2024 02:08                4866
function.fann-get-cascade-activation-functions-..> 13-Apr-2024 02:08                3815
function.fann-get-cascade-activation-functions.php 13-Apr-2024 02:08                4631
function.fann-get-cascade-activation-steepnesse..> 13-Apr-2024 02:08                3871
function.fann-get-cascade-activation-steepnesse..> 13-Apr-2024 02:08                4022
function.fann-get-cascade-candidate-change-frac..> 13-Apr-2024 02:08                5128
function.fann-get-cascade-candidate-limit.php      13-Apr-2024 02:08                3518
function.fann-get-cascade-candidate-stagnation-..> 13-Apr-2024 02:08                4254
function.fann-get-cascade-max-cand-epochs.php      13-Apr-2024 02:08                3400
function.fann-get-cascade-max-out-epochs.php       13-Apr-2024 02:08                3321
function.fann-get-cascade-min-cand-epochs.php      13-Apr-2024 02:08                3700
function.fann-get-cascade-min-out-epochs.php       13-Apr-2024 02:08                3657
function.fann-get-cascade-num-candidate-groups.php 13-Apr-2024 02:08                3798
function.fann-get-cascade-num-candidates.php       13-Apr-2024 02:08                5932
function.fann-get-cascade-output-change-fractio..> 13-Apr-2024 02:08                5056
function.fann-get-cascade-output-stagnation-epo..> 13-Apr-2024 02:08                4197
function.fann-get-cascade-weight-multiplier.php    13-Apr-2024 02:08                3476
function.fann-get-connection-array.php             13-Apr-2024 02:08                2580
function.fann-get-connection-rate.php              13-Apr-2024 02:08                2703
function.fann-get-errno.php                        13-Apr-2024 02:08                3095
function.fann-get-errstr.php                       13-Apr-2024 02:08                3100
function.fann-get-layer-array.php                  13-Apr-2024 02:08                2654
function.fann-get-learning-momentum.php            13-Apr-2024 02:08                3859
function.fann-get-learning-rate.php                13-Apr-2024 02:08                3795
function.fann-get-mse.php                          13-Apr-2024 02:08                3181
function.fann-get-network-type.php                 13-Apr-2024 02:08                2673
function.fann-get-num-input.php                    13-Apr-2024 02:08                2560
function.fann-get-num-layers.php                   13-Apr-2024 02:08                2615
function.fann-get-num-output.php                   13-Apr-2024 02:08                2579
function.fann-get-quickprop-decay.php              13-Apr-2024 02:08                3333
function.fann-get-quickprop-mu.php                 13-Apr-2024 02:08                3226
function.fann-get-rprop-decrease-factor.php        13-Apr-2024 02:08                3287
function.fann-get-rprop-delta-max.php              13-Apr-2024 02:08                3349
function.fann-get-rprop-delta-min.php              13-Apr-2024 02:08                3160
function.fann-get-rprop-delta-zero.php             13-Apr-2024 02:08                3533
function.fann-get-rprop-increase-factor.php        13-Apr-2024 02:08                3312
function.fann-get-sarprop-step-error-shift.php     13-Apr-2024 02:08                3617
function.fann-get-sarprop-step-error-threshold-..> 13-Apr-2024 02:08                3769
function.fann-get-sarprop-temperature.php          13-Apr-2024 02:08                3531
function.fann-get-sarprop-weight-decay-shift.php   13-Apr-2024 02:08                3598
function.fann-get-total-connections.php            13-Apr-2024 02:08                2752
function.fann-get-total-neurons.php                13-Apr-2024 02:08                2799
function.fann-get-train-error-function.php         13-Apr-2024 02:08                3565
function.fann-get-train-stop-function.php          13-Apr-2024 02:08                3551
function.fann-get-training-algorithm.php           13-Apr-2024 02:08                3785
function.fann-init-weights.php                     13-Apr-2024 02:08                4339
function.fann-length-train-data.php                13-Apr-2024 02:08                2877
function.fann-merge-train-data.php                 13-Apr-2024 02:08                3163
function.fann-num-input-train-data.php             13-Apr-2024 02:08                3519
function.fann-num-output-train-data.php            13-Apr-2024 02:08                3517
function.fann-print-error.php                      13-Apr-2024 02:08                2843
function.fann-randomize-weights.php                13-Apr-2024 02:08                3936
function.fann-read-train-from-file.php             13-Apr-2024 02:08                4963
function.fann-reset-errno.php                      13-Apr-2024 02:08                3019
function.fann-reset-errstr.php                     13-Apr-2024 02:08                3000
function.fann-reset-mse.php                        13-Apr-2024 02:08                3423
function.fann-run.php                              13-Apr-2024 02:08                2869
function.fann-save-train.php                       13-Apr-2024 02:08                3488
function.fann-save.php                             13-Apr-2024 02:08                4299
function.fann-scale-input-train-data.php           13-Apr-2024 02:08                4115
function.fann-scale-input.php                      13-Apr-2024 02:08                3760
function.fann-scale-output-train-data.php          13-Apr-2024 02:08                4143
function.fann-scale-output.php                     13-Apr-2024 02:08                3764
function.fann-scale-train-data.php                 13-Apr-2024 02:08                4113
function.fann-scale-train.php                      13-Apr-2024 02:08                3706
function.fann-set-activation-function-hidden.php   13-Apr-2024 02:08                4455
function.fann-set-activation-function-layer.php    13-Apr-2024 02:08                4969
function.fann-set-activation-function-output.php   13-Apr-2024 02:08                4471
function.fann-set-activation-function.php          13-Apr-2024 02:08                6446
function.fann-set-activation-steepness-hidden.php  13-Apr-2024 02:08                4741
function.fann-set-activation-steepness-layer.php   13-Apr-2024 02:08                5206
function.fann-set-activation-steepness-output.php  13-Apr-2024 02:08                4722
function.fann-set-activation-steepness.php         13-Apr-2024 02:08                6102
function.fann-set-bit-fail-limit.php               13-Apr-2024 02:08                3444
function.fann-set-callback.php                     13-Apr-2024 02:08                5617
function.fann-set-cascade-activation-functions.php 13-Apr-2024 02:08                4100
function.fann-set-cascade-activation-steepnesse..> 13-Apr-2024 02:08                4313
function.fann-set-cascade-candidate-change-frac..> 13-Apr-2024 02:08                3795
function.fann-set-cascade-candidate-limit.php      13-Apr-2024 02:08                3602
function.fann-set-cascade-candidate-stagnation-..> 13-Apr-2024 02:08                3857
function.fann-set-cascade-max-cand-epochs.php      13-Apr-2024 02:08                3603
function.fann-set-cascade-max-out-epochs.php       13-Apr-2024 02:08                3554
function.fann-set-cascade-min-cand-epochs.php      13-Apr-2024 02:08                3908
function.fann-set-cascade-min-out-epochs.php       13-Apr-2024 02:08                3890
function.fann-set-cascade-num-candidate-groups.php 13-Apr-2024 02:08                3688
function.fann-set-cascade-output-change-fractio..> 13-Apr-2024 02:08                3752
function.fann-set-cascade-output-stagnation-epo..> 13-Apr-2024 02:08                3818
function.fann-set-cascade-weight-multiplier.php    13-Apr-2024 02:08                3587
function.fann-set-error-log.php                    13-Apr-2024 02:08                2859
function.fann-set-input-scaling-params.php         13-Apr-2024 02:08                4466
function.fann-set-learning-momentum.php            13-Apr-2024 02:08                3828
function.fann-set-learning-rate.php                13-Apr-2024 02:08                3754
function.fann-set-output-scaling-params.php        13-Apr-2024 02:08                4486
function.fann-set-quickprop-decay.php              13-Apr-2024 02:08                3515
function.fann-set-quickprop-mu.php                 13-Apr-2024 02:08                3370
function.fann-set-rprop-decrease-factor.php        13-Apr-2024 02:08                3572
function.fann-set-rprop-delta-max.php              13-Apr-2024 02:08                3684
function.fann-set-rprop-delta-min.php              13-Apr-2024 02:08                3490
function.fann-set-rprop-delta-zero.php             13-Apr-2024 02:08                3872
function.fann-set-rprop-increase-factor.php        13-Apr-2024 02:08                3598
function.fann-set-sarprop-step-error-shift.php     13-Apr-2024 02:08                3958
function.fann-set-sarprop-step-error-threshold-..> 13-Apr-2024 02:08                4152
function.fann-set-sarprop-temperature.php          13-Apr-2024 02:08                3869
function.fann-set-sarprop-weight-decay-shift.php   13-Apr-2024 02:08                3952
function.fann-set-scaling-params.php               13-Apr-2024 02:08                5503
function.fann-set-train-error-function.php         13-Apr-2024 02:08                3784
function.fann-set-train-stop-function.php          13-Apr-2024 02:08                3772
function.fann-set-training-algorithm.php           13-Apr-2024 02:08                3720
function.fann-set-weight-array.php                 13-Apr-2024 02:08                3223
function.fann-set-weight.php                       13-Apr-2024 02:08                3671
function.fann-shuffle-train-data.php               13-Apr-2024 02:08                2836
function.fann-subset-train-data.php                13-Apr-2024 02:08                4192
function.fann-test-data.php                        13-Apr-2024 02:08                4099
function.fann-test.php                             13-Apr-2024 02:08                4479
function.fann-train-epoch.php                      13-Apr-2024 02:08                4473
function.fann-train-on-data.php                    13-Apr-2024 02:08                6413
function.fann-train-on-file.php                    13-Apr-2024 02:08                6428
function.fann-train.php                            13-Apr-2024 02:08                4555
function.fastcgi-finish-request.php                13-Apr-2024 02:08                2594
function.fbird-add-user.php                        13-Apr-2024 02:08                2308
function.fbird-affected-rows.php                   13-Apr-2024 02:08                2321
function.fbird-backup.php                          13-Apr-2024 02:08                1737
function.fbird-blob-add.php                        13-Apr-2024 02:08                2637
function.fbird-blob-cancel.php                     13-Apr-2024 02:08                3691
function.fbird-blob-close.php                      13-Apr-2024 02:08                2668
function.fbird-blob-create.php                     13-Apr-2024 02:08                2668
function.fbird-blob-echo.php                       13-Apr-2024 02:08                2471
function.fbird-blob-get.php                        13-Apr-2024 02:08                2464
function.fbird-blob-import.php                     13-Apr-2024 02:08                2664
function.fbird-blob-info.php                       13-Apr-2024 02:08                1769
function.fbird-blob-open.php                       13-Apr-2024 02:08                2461
function.fbird-close.php                           13-Apr-2024 02:08                2244
function.fbird-commit-ret.php                      13-Apr-2024 02:08                1762
function.fbird-commit.php                          13-Apr-2024 02:08                1730
function.fbird-connect.php                         13-Apr-2024 02:08                2250
function.fbird-db-info.php                         13-Apr-2024 02:08                1743
function.fbird-delete-user.php                     13-Apr-2024 02:08                2318
function.fbird-drop-db.php                         13-Apr-2024 02:08                2266
function.fbird-errcode.php                         13-Apr-2024 02:08                2086
function.fbird-errmsg.php                          13-Apr-2024 02:08                2079
function.fbird-execute.php                         13-Apr-2024 02:08                2091
function.fbird-fetch-assoc.php                     13-Apr-2024 02:08                2334
function.fbird-fetch-object.php                    13-Apr-2024 02:08                2345
function.fbird-fetch-row.php                       13-Apr-2024 02:08                2322
function.fbird-field-info.php                      13-Apr-2024 02:08                2161
function.fbird-free-event-handler.php              13-Apr-2024 02:08                2265
function.fbird-free-query.php                      13-Apr-2024 02:08                1798
function.fbird-free-result.php                     13-Apr-2024 02:08                1783
function.fbird-gen-id.php                          13-Apr-2024 02:08                1740
function.fbird-maintain-db.php                     13-Apr-2024 02:08                1785
function.fbird-modify-user.php                     13-Apr-2024 02:08                2334
function.fbird-name-result.php                     13-Apr-2024 02:08                2317
function.fbird-num-fields.php                      13-Apr-2024 02:08                2150
function.fbird-num-params.php                      13-Apr-2024 02:08                2312
function.fbird-param-info.php                      13-Apr-2024 02:08                2317
function.fbird-pconnect.php                        13-Apr-2024 02:08                2267
function.fbird-prepare.php                         13-Apr-2024 02:08                1733
function.fbird-query.php                           13-Apr-2024 02:08                2589
function.fbird-restore.php                         13-Apr-2024 02:08                1740
function.fbird-rollback-ret.php                    13-Apr-2024 02:08                1792
function.fbird-rollback.php                        13-Apr-2024 02:08                1764
function.fbird-server-info.php                     13-Apr-2024 02:08                1795
function.fbird-service-attach.php                  13-Apr-2024 02:08                1834
function.fbird-service-detach.php                  13-Apr-2024 02:08                1846
function.fbird-set-event-handler.php               13-Apr-2024 02:08                2427
function.fbird-trans.php                           13-Apr-2024 02:08                1739
function.fbird-wait-event.php                      13-Apr-2024 02:08                2352
function.fclose.php                                13-Apr-2024 02:08                4539
function.fdatasync.php                             13-Apr-2024 02:08                6041
function.fdf-add-doc-javascript.php                13-Apr-2024 02:08                5515
function.fdf-add-template.php                      13-Apr-2024 02:08                2870
function.fdf-close.php                             13-Apr-2024 02:08                3059
function.fdf-create.php                            13-Apr-2024 02:08                5569
function.fdf-enum-values.php                       13-Apr-2024 02:08                2443
function.fdf-errno.php                             13-Apr-2024 02:08                2748
function.fdf-error.php                             13-Apr-2024 02:08                3183
function.fdf-get-ap.php                            13-Apr-2024 02:08                4403
function.fdf-get-attachment.php                    13-Apr-2024 02:08                6060
function.fdf-get-encoding.php                      13-Apr-2024 02:08                3365
function.fdf-get-file.php                          13-Apr-2024 02:08                3185
function.fdf-get-flags.php                         13-Apr-2024 02:08                2363
function.fdf-get-opt.php                           13-Apr-2024 02:08                2402
function.fdf-get-status.php                        13-Apr-2024 02:08                3204
function.fdf-get-value.php                         13-Apr-2024 02:08                4508
function.fdf-get-version.php                       13-Apr-2024 02:08                3564
function.fdf-header.php                            13-Apr-2024 02:08                2311
function.fdf-next-field-name.php                   13-Apr-2024 02:08                5357
function.fdf-open-string.php                       13-Apr-2024 02:08                4813
function.fdf-open.php                              13-Apr-2024 02:08                5824
function.fdf-remove-item.php                       13-Apr-2024 02:08                2376
function.fdf-save-string.php                       13-Apr-2024 02:08                5590
function.fdf-save.php                              13-Apr-2024 02:08                4080
function.fdf-set-ap.php                            13-Apr-2024 02:08                4630
function.fdf-set-encoding.php                      13-Apr-2024 02:08                3758
function.fdf-set-file.php                          13-Apr-2024 02:08                6698
function.fdf-set-flags.php                         13-Apr-2024 02:08                4386
function.fdf-set-javascript-action.php             13-Apr-2024 02:08                4583
function.fdf-set-on-import-javascript.php          13-Apr-2024 02:08                3158
function.fdf-set-opt.php                           13-Apr-2024 02:08                4669
function.fdf-set-status.php                        13-Apr-2024 02:08                3799
function.fdf-set-submit-form-action.php            13-Apr-2024 02:08                4882
function.fdf-set-target-frame.php                  13-Apr-2024 02:08                3799
function.fdf-set-value.php                         13-Apr-2024 02:08                5241
function.fdf-set-version.php                       13-Apr-2024 02:08                4023
function.fdiv.php                                  13-Apr-2024 02:08                6150
function.feof.php                                  13-Apr-2024 02:08                5694
function.fflush.php                                13-Apr-2024 02:08                5670
function.fgetc.php                                 13-Apr-2024 02:08                6712
function.fgetcsv.php                               13-Apr-2024 02:08               12882
function.fgets.php                                 13-Apr-2024 02:08                8668
function.fgetss.php                                13-Apr-2024 02:08                9670
function.file-exists.php                           13-Apr-2024 02:08                7280
function.file-get-contents.php                     13-Apr-2024 02:08               18750
function.file-put-contents.php                     13-Apr-2024 02:08               13139
function.file.php                                  13-Apr-2024 02:08               12272
function.fileatime.php                             13-Apr-2024 02:08                7007
function.filectime.php                             13-Apr-2024 02:08                7111
function.filegroup.php                             13-Apr-2024 02:08                5701
function.fileinode.php                             13-Apr-2024 02:08                5450
function.filemtime.php                             13-Apr-2024 02:08                6794
function.fileowner.php                             13-Apr-2024 02:08                5674
function.fileperms.php                             13-Apr-2024 02:08               16392
function.filesize.php                              13-Apr-2024 02:08                5908
function.filetype.php                              13-Apr-2024 02:08                6799
function.filter-has-var.php                        13-Apr-2024 02:08                3397
function.filter-id.php                             13-Apr-2024 02:08                2956
function.filter-input-array.php                    13-Apr-2024 02:08               13194
function.filter-input.php                          13-Apr-2024 02:08                8437
function.filter-list.php                           13-Apr-2024 02:08                3654
function.filter-var-array.php                      13-Apr-2024 02:08               12073
function.filter-var.php                            13-Apr-2024 02:08               14172
function.finfo-buffer.php                          13-Apr-2024 02:08                8700
function.finfo-close.php                           13-Apr-2024 02:08                3536
function.finfo-file.php                            13-Apr-2024 02:08                9140
function.finfo-open.php                            13-Apr-2024 02:08               10341
function.finfo-set-flags.php                       13-Apr-2024 02:08                4772
function.floatval.php                              13-Apr-2024 02:08                7033
function.flock.php                                 13-Apr-2024 02:08               13404
function.floor.php                                 13-Apr-2024 02:08                4924
function.flush.php                                 13-Apr-2024 02:08                4820
function.fmod.php                                  13-Apr-2024 02:08                4988
function.fnmatch.php                               13-Apr-2024 02:08                9279
function.fopen.php                                 13-Apr-2024 02:08               23816
function.forward-static-call-array.php             13-Apr-2024 02:08                9643
function.forward-static-call.php                   13-Apr-2024 02:08                9047
function.fpassthru.php                             13-Apr-2024 02:08                7293
function.fpm-get-status.php                        13-Apr-2024 02:08                2781
function.fprintf.php                               13-Apr-2024 02:08               23077
function.fputcsv.php                               13-Apr-2024 02:08               10578
function.fputs.php                                 13-Apr-2024 02:08                1642
function.fread.php                                 13-Apr-2024 02:08               14705
function.frenchtojd.php                            13-Apr-2024 02:08                4171
function.fscanf.php                                13-Apr-2024 02:08                9431
function.fseek.php                                 13-Apr-2024 02:08                8126
function.fsockopen.php                             13-Apr-2024 02:08               17392
function.fstat.php                                 13-Apr-2024 02:08                6040
function.fsync.php                                 13-Apr-2024 02:08                5803
function.ftell.php                                 13-Apr-2024 02:08                6279
function.ftok.php                                  13-Apr-2024 02:08                3631
function.ftp-alloc.php                             13-Apr-2024 02:08                8286
function.ftp-append.php                            13-Apr-2024 02:08                4511
function.ftp-cdup.php                              13-Apr-2024 02:08                6613
function.ftp-chdir.php                             13-Apr-2024 02:08                7541
function.ftp-chmod.php                             13-Apr-2024 02:08                7177
function.ftp-close.php                             13-Apr-2024 02:08                5995
function.ftp-connect.php                           13-Apr-2024 02:08                6671
function.ftp-delete.php                            13-Apr-2024 02:08                6251
function.ftp-exec.php                              13-Apr-2024 02:08                6724
function.ftp-fget.php                              13-Apr-2024 02:08                9911
function.ftp-fput.php                              13-Apr-2024 02:08                9561
function.ftp-get-option.php                        13-Apr-2024 02:08                6321
function.ftp-get.php                               13-Apr-2024 02:08                9179
function.ftp-login.php                             13-Apr-2024 02:08                6828
function.ftp-mdtm.php                              13-Apr-2024 02:08                7121
function.ftp-mkdir.php                             13-Apr-2024 02:08                6859
function.ftp-mlsd.php                              13-Apr-2024 02:08                9173
function.ftp-nb-continue.php                       13-Apr-2024 02:08                5516
function.ftp-nb-fget.php                           13-Apr-2024 02:08               10488
function.ftp-nb-fput.php                           13-Apr-2024 02:08               10402
function.ftp-nb-get.php                            13-Apr-2024 02:08               14462
function.ftp-nb-put.php                            13-Apr-2024 02:08               11696
function.ftp-nlist.php                             13-Apr-2024 02:08                7138
function.ftp-pasv.php                              13-Apr-2024 02:08                7645
function.ftp-put.php                               13-Apr-2024 02:08                9355
function.ftp-pwd.php                               13-Apr-2024 02:08                6239
function.ftp-quit.php                              13-Apr-2024 02:08                1651
function.ftp-raw.php                               13-Apr-2024 02:08                5584
function.ftp-rawlist.php                           13-Apr-2024 02:08                8546
function.ftp-rename.php                            13-Apr-2024 02:08                7211
function.ftp-rmdir.php                             13-Apr-2024 02:08                6521
function.ftp-set-option.php                        13-Apr-2024 02:08                7346
function.ftp-site.php                              13-Apr-2024 02:08                6732
function.ftp-size.php                              13-Apr-2024 02:08                6868
function.ftp-ssl-connect.php                       13-Apr-2024 02:08                8900
function.ftp-systype.php                           13-Apr-2024 02:08                5548
function.ftruncate.php                             13-Apr-2024 02:08                6562
function.func-get-arg.php                          13-Apr-2024 02:08               11748
function.func-get-args.php                         13-Apr-2024 02:08               12393
function.func-num-args.php                         13-Apr-2024 02:08                6346
function.function-exists.php                       13-Apr-2024 02:08                6096
function.fwrite.php                                13-Apr-2024 02:08               14578
function.gc-collect-cycles.php                     13-Apr-2024 02:08                2687
function.gc-disable.php                            13-Apr-2024 02:08                2582
function.gc-enable.php                             13-Apr-2024 02:08                2555
function.gc-enabled.php                            13-Apr-2024 02:08                3421
function.gc-mem-caches.php                         13-Apr-2024 02:08                2521
function.gc-status.php                             13-Apr-2024 02:08                5846
function.gd-info.php                               13-Apr-2024 02:08                9974
function.geoip-asnum-by-name.php                   13-Apr-2024 02:08                4211
function.geoip-continent-code-by-name.php          13-Apr-2024 02:08                5724
function.geoip-country-code-by-name.php            13-Apr-2024 02:08                5445
function.geoip-country-code3-by-name.php           13-Apr-2024 02:08                5010
function.geoip-country-name-by-name.php            13-Apr-2024 02:08                4974
function.geoip-database-info.php                   13-Apr-2024 02:08                4292
function.geoip-db-avail.php                        13-Apr-2024 02:08                4508
function.geoip-db-filename.php                     13-Apr-2024 02:08                4168
function.geoip-db-get-all-info.php                 13-Apr-2024 02:08                6749
function.geoip-domain-by-name.php                  13-Apr-2024 02:08                4443
function.geoip-id-by-name.php                      13-Apr-2024 02:08                5515
function.geoip-isp-by-name.php                     13-Apr-2024 02:08                4447
function.geoip-netspeedcell-by-name.php            13-Apr-2024 02:08                5185
function.geoip-org-by-name.php                     13-Apr-2024 02:08                4466
function.geoip-record-by-name.php                  13-Apr-2024 02:08                7792
function.geoip-region-by-name.php                  13-Apr-2024 02:08                5127
function.geoip-region-name-by-code.php             13-Apr-2024 02:08                7176
function.geoip-setup-custom-directory.php          13-Apr-2024 02:08                4208
function.geoip-time-zone-by-country-and-region.php 13-Apr-2024 02:08                7386
function.get-browser.php                           13-Apr-2024 02:08                8688
function.get-called-class.php                      13-Apr-2024 02:08                6313
function.get-cfg-var.php                           13-Apr-2024 02:08                3956
function.get-class-methods.php                     13-Apr-2024 02:08                7022
function.get-class-vars.php                        13-Apr-2024 02:08                9793
function.get-class.php                             13-Apr-2024 02:08               13578
function.get-current-user.php                      13-Apr-2024 02:08                4489
function.get-debug-type.php                        13-Apr-2024 02:08                9631
function.get-declared-classes.php                  13-Apr-2024 02:08                5369
function.get-declared-interfaces.php               13-Apr-2024 02:08                4306
function.get-declared-traits.php                   13-Apr-2024 02:08                2914
function.get-defined-constants.php                 13-Apr-2024 02:08                7704
function.get-defined-functions.php                 13-Apr-2024 02:08                7339
function.get-defined-vars.php                      13-Apr-2024 02:08                6302
function.get-extension-funcs.php                   13-Apr-2024 02:08                5713
function.get-headers.php                           13-Apr-2024 02:08                9550
function.get-html-translation-table.php            13-Apr-2024 02:08               14659
function.get-include-path.php                      13-Apr-2024 02:08                4481
function.get-included-files.php                    13-Apr-2024 02:08                5897
function.get-loaded-extensions.php                 13-Apr-2024 02:08                5262
function.get-magic-quotes-gpc.php                  13-Apr-2024 02:08                4013
function.get-magic-quotes-runtime.php              13-Apr-2024 02:08                3739
function.get-mangled-object-vars.php               13-Apr-2024 02:08                8117
function.get-meta-tags.php                         13-Apr-2024 02:08                8276
function.get-object-vars.php                       13-Apr-2024 02:08                6199
function.get-parent-class.php                      13-Apr-2024 02:08                7775
function.get-required-files.php                    13-Apr-2024 02:08                1827
function.get-resource-id.php                       13-Apr-2024 02:08                4975
function.get-resource-type.php                     13-Apr-2024 02:08                5327
function.get-resources.php                         13-Apr-2024 02:08                7931
function.getallheaders.php                         13-Apr-2024 02:08                4966
function.getcwd.php                                13-Apr-2024 02:08                5405
function.getdate.php                               13-Apr-2024 02:08                9860
function.getenv.php                                13-Apr-2024 02:08                8692
function.gethostbyaddr.php                         13-Apr-2024 02:08                4341
function.gethostbyname.php                         13-Apr-2024 02:08                4530
function.gethostbynamel.php                        13-Apr-2024 02:08                5100
function.gethostname.php                           13-Apr-2024 02:08                4036
function.getimagesize.php                          13-Apr-2024 02:08               17580
function.getimagesizefromstring.php                13-Apr-2024 02:08                5666
function.getlastmod.php                            13-Apr-2024 02:08                6313
function.getmxrr.php                               13-Apr-2024 02:08                6059
function.getmygid.php                              13-Apr-2024 02:08                3627
function.getmyinode.php                            13-Apr-2024 02:08                3670
function.getmypid.php                              13-Apr-2024 02:08                3913
function.getmyuid.php                              13-Apr-2024 02:08                3617
function.getopt.php                                13-Apr-2024 02:08               15722
function.getprotobyname.php                        13-Apr-2024 02:08                4728
function.getprotobynumber.php                      13-Apr-2024 02:08                3355
function.getrandmax.php                            13-Apr-2024 02:08                2986
function.getrusage.php                             13-Apr-2024 02:08               11334
function.getservbyname.php                         13-Apr-2024 02:08                6472
function.getservbyport.php                         13-Apr-2024 02:08                3867
function.gettext.php                               13-Apr-2024 02:08                5819
function.gettimeofday.php                          13-Apr-2024 02:08                5110
function.gettype.php                               13-Apr-2024 02:08                8956
function.glob.php                                  13-Apr-2024 02:08               10310
function.gmdate.php                                13-Apr-2024 02:08                7962
function.gmmktime.php                              13-Apr-2024 02:08               11663
function.gmp-abs.php                               13-Apr-2024 02:08                4376
function.gmp-add.php                               13-Apr-2024 02:08                4631
function.gmp-and.php                               13-Apr-2024 02:08                5082
function.gmp-binomial.php                          13-Apr-2024 02:08                3945
function.gmp-clrbit.php                            13-Apr-2024 02:08                5471
function.gmp-cmp.php                               13-Apr-2024 02:08                5494
function.gmp-com.php                               13-Apr-2024 02:08                3867
function.gmp-div-q.php                             13-Apr-2024 02:08                9922
function.gmp-div-qr.php                            13-Apr-2024 02:08                6630
function.gmp-div-r.php                             13-Apr-2024 02:08                6021
function.gmp-div.php                               13-Apr-2024 02:08                1659
function.gmp-divexact.php                          13-Apr-2024 02:08                5724
function.gmp-export.php                            13-Apr-2024 02:08                5683
function.gmp-fact.php                              13-Apr-2024 02:08                4739
function.gmp-gcd.php                               13-Apr-2024 02:08                5019
function.gmp-gcdext.php                            13-Apr-2024 02:08                9183
function.gmp-hamdist.php                           13-Apr-2024 02:08                6370
function.gmp-import.php                            13-Apr-2024 02:08                6002
function.gmp-init.php                              13-Apr-2024 02:08                5624
function.gmp-intval.php                            13-Apr-2024 02:08                5230
function.gmp-invert.php                            13-Apr-2024 02:08                5216
function.gmp-jacobi.php                            13-Apr-2024 02:08                5533
function.gmp-kronecker.php                         13-Apr-2024 02:08                3864
function.gmp-lcm.php                               13-Apr-2024 02:08                3635
function.gmp-legendre.php                          13-Apr-2024 02:08                5552
function.gmp-mod.php                               13-Apr-2024 02:08                4756
function.gmp-mul.php                               13-Apr-2024 02:08                4838
function.gmp-neg.php                               13-Apr-2024 02:08                4323
function.gmp-nextprime.php                         13-Apr-2024 02:08                4979
function.gmp-or.php                                13-Apr-2024 02:08                5297
function.gmp-perfect-power.php                     13-Apr-2024 02:08                3294
function.gmp-perfect-square.php                    13-Apr-2024 02:08                5535
function.gmp-popcount.php                          13-Apr-2024 02:08                4818
function.gmp-pow.php                               13-Apr-2024 02:08                5676
function.gmp-powm.php                              13-Apr-2024 02:08                5630
function.gmp-prob-prime.php                        13-Apr-2024 02:08                5633
function.gmp-random-bits.php                       13-Apr-2024 02:08                6016
function.gmp-random-range.php                      13-Apr-2024 02:08                7381
function.gmp-random-seed.php                       13-Apr-2024 02:08                7465
function.gmp-random.php                            13-Apr-2024 02:08                6307
function.gmp-root.php                              13-Apr-2024 02:08                3128
function.gmp-rootrem.php                           13-Apr-2024 02:08                3294
function.gmp-scan0.php                             13-Apr-2024 02:08                5483
function.gmp-scan1.php                             13-Apr-2024 02:08                5495
function.gmp-setbit.php                            13-Apr-2024 02:08               11591
function.gmp-sign.php                              13-Apr-2024 02:08                5138
function.gmp-sqrt.php                              13-Apr-2024 02:08                4895
function.gmp-sqrtrem.php                           13-Apr-2024 02:08                6275
function.gmp-strval.php                            13-Apr-2024 02:08                4656
function.gmp-sub.php                               13-Apr-2024 02:08                4910
function.gmp-testbit.php                           13-Apr-2024 02:08                5943
function.gmp-xor.php                               13-Apr-2024 02:08                5303
function.gmstrftime.php                            13-Apr-2024 02:08                9305
function.gnupg-adddecryptkey.php                   13-Apr-2024 02:08                5371
function.gnupg-addencryptkey.php                   13-Apr-2024 02:08                4915
function.gnupg-addsignkey.php                      13-Apr-2024 02:08                5388
function.gnupg-cleardecryptkeys.php                13-Apr-2024 02:08                4458
function.gnupg-clearencryptkeys.php                13-Apr-2024 02:08                4463
function.gnupg-clearsignkeys.php                   13-Apr-2024 02:08                4405
function.gnupg-decrypt.php                         13-Apr-2024 02:08                6117
function.gnupg-decryptverify.php                   13-Apr-2024 02:08                7269
function.gnupg-deletekey.php                       13-Apr-2024 02:08                5201
function.gnupg-encrypt.php                         13-Apr-2024 02:08                6020
function.gnupg-encryptsign.php                     13-Apr-2024 02:08                6920
function.gnupg-export.php                          13-Apr-2024 02:08                5219
function.gnupg-getengineinfo.php                   13-Apr-2024 02:08                5591
function.gnupg-geterror.php                        13-Apr-2024 02:08                4371
function.gnupg-geterrorinfo.php                    13-Apr-2024 02:08                5694
function.gnupg-getprotocol.php                     13-Apr-2024 02:08                4459
function.gnupg-gettrustlist.php                    13-Apr-2024 02:08                5281
function.gnupg-import.php                          13-Apr-2024 02:08                5478
function.gnupg-init.php                            13-Apr-2024 02:08                7247
function.gnupg-keyinfo.php                         13-Apr-2024 02:08                5405
function.gnupg-listsignatures.php                  13-Apr-2024 02:08                5505
function.gnupg-setarmor.php                        13-Apr-2024 02:08                5674
function.gnupg-seterrormode.php                    13-Apr-2024 02:08                5721
function.gnupg-setsignmode.php                     13-Apr-2024 02:08                5809
function.gnupg-sign.php                            13-Apr-2024 02:08                6262
function.gnupg-verify.php                          13-Apr-2024 02:08                8510
function.grapheme-extract.php                      13-Apr-2024 02:08                8867
function.grapheme-stripos.php                      13-Apr-2024 02:08                8365
function.grapheme-stristr.php                      13-Apr-2024 02:08                7786
function.grapheme-strlen.php                       13-Apr-2024 02:08                5664
function.grapheme-strpos.php                       13-Apr-2024 02:08                8059
function.grapheme-strripos.php                     13-Apr-2024 02:08                7710
function.grapheme-strrpos.php                      13-Apr-2024 02:08                7404
function.grapheme-strstr.php                       13-Apr-2024 02:08                7505
function.grapheme-substr.php                       13-Apr-2024 02:08                8607
function.gregoriantojd.php                         13-Apr-2024 02:08                7711
function.gzclose.php                               13-Apr-2024 02:08                4364
function.gzcompress.php                            13-Apr-2024 02:08                6361
function.gzdecode.php                              13-Apr-2024 02:08                3843
function.gzdeflate.php                             13-Apr-2024 02:08                5989
function.gzencode.php                              13-Apr-2024 02:08                7373
function.gzeof.php                                 13-Apr-2024 02:08                4224
function.gzfile.php                                13-Apr-2024 02:08                4948
function.gzgetc.php                                13-Apr-2024 02:08                4838
function.gzgets.php                                13-Apr-2024 02:08                6510
function.gzgetss.php                               13-Apr-2024 02:08                6255
function.gzinflate.php                             13-Apr-2024 02:08                5620
function.gzopen.php                                13-Apr-2024 02:08                6100
function.gzpassthru.php                            13-Apr-2024 02:08                4790
function.gzputs.php                                13-Apr-2024 02:08                1633
function.gzread.php                                13-Apr-2024 02:08                6305
function.gzrewind.php                              13-Apr-2024 02:08                3392
function.gzseek.php                                13-Apr-2024 02:08                6580
function.gztell.php                                13-Apr-2024 02:08                3583
function.gzuncompress.php                          13-Apr-2024 02:08                5585
function.gzwrite.php                               13-Apr-2024 02:08                6908
function.halt-compiler.php                         13-Apr-2024 02:08                4678
function.hash-algos.php                            13-Apr-2024 02:08                5944
function.hash-copy.php                             13-Apr-2024 02:08                5773
function.hash-equals.php                           13-Apr-2024 02:08                7054
function.hash-file.php                             13-Apr-2024 02:08                7969
function.hash-final.php                            13-Apr-2024 02:08                4321
function.hash-hkdf.php                             13-Apr-2024 02:08                9896
function.hash-hmac-algos.php                       13-Apr-2024 02:08                5413
function.hash-hmac-file.php                        13-Apr-2024 02:08                8961
function.hash-hmac.php                             13-Apr-2024 02:08                8338
function.hash-init.php                             13-Apr-2024 02:08               11008
function.hash-pbkdf2.php                           13-Apr-2024 02:08               11960
function.hash-update-file.php                      13-Apr-2024 02:08                6264
function.hash-update-stream.php                    13-Apr-2024 02:08                7705
function.hash-update.php                           13-Apr-2024 02:08                4691
function.hash.php                                  13-Apr-2024 02:08                7599
function.header-register-callback.php              13-Apr-2024 02:08                6994
function.header-remove.php                         13-Apr-2024 02:08                7100
function.header.php                                13-Apr-2024 02:08               18874
function.headers-list.php                          13-Apr-2024 02:08                6230
function.headers-sent.php                          13-Apr-2024 02:08                8516
function.hebrev.php                                13-Apr-2024 02:08                3423
function.hebrevc.php                               13-Apr-2024 02:08                3843
function.hex2bin.php                               13-Apr-2024 02:08                5054
function.hexdec.php                                13-Apr-2024 02:08                6440
function.highlight-file.php                        13-Apr-2024 02:08                5745
function.highlight-string.php                      13-Apr-2024 02:08                6087
function.hrtime.php                                13-Apr-2024 02:08                5700
function.html-entity-decode.php                    13-Apr-2024 02:08               12066
function.htmlentities.php                          13-Apr-2024 02:08               15382
function.htmlspecialchars-decode.php               13-Apr-2024 02:08                9970
function.htmlspecialchars.php                      13-Apr-2024 02:08               23579
function.http-build-query.php                      13-Apr-2024 02:08               19990
function.http-response-code.php                    13-Apr-2024 02:08                6909
function.hypot.php                                 13-Apr-2024 02:08                3042
function.ibase-add-user.php                        13-Apr-2024 02:08                5167
function.ibase-affected-rows.php                   13-Apr-2024 02:08                3430
function.ibase-backup.php                          13-Apr-2024 02:08               10483
function.ibase-blob-add.php                        13-Apr-2024 02:08                3970
function.ibase-blob-cancel.php                     13-Apr-2024 02:08                3690
function.ibase-blob-close.php                      13-Apr-2024 02:08                3952
function.ibase-blob-create.php                     13-Apr-2024 02:08                4039
function.ibase-blob-echo.php                       13-Apr-2024 02:08                4217
function.ibase-blob-get.php                        13-Apr-2024 02:08                6555
function.ibase-blob-import.php                     13-Apr-2024 02:08                7986
function.ibase-blob-info.php                       13-Apr-2024 02:08                3490
function.ibase-blob-open.php                       13-Apr-2024 02:08                4434
function.ibase-close.php                           13-Apr-2024 02:08                3792
function.ibase-commit-ret.php                      13-Apr-2024 02:08                3306
function.ibase-commit.php                          13-Apr-2024 02:08                3107
function.ibase-connect.php                         13-Apr-2024 02:08               10520
function.ibase-db-info.php                         13-Apr-2024 02:08                2694
function.ibase-delete-user.php                     13-Apr-2024 02:08                3583
function.ibase-drop-db.php                         13-Apr-2024 02:08                3690
function.ibase-errcode.php                         13-Apr-2024 02:08                2675
function.ibase-errmsg.php                          13-Apr-2024 02:08                2668
function.ibase-execute.php                         13-Apr-2024 02:08                6939
function.ibase-fetch-assoc.php                     13-Apr-2024 02:08                4705
function.ibase-fetch-object.php                    13-Apr-2024 02:08                6632
function.ibase-fetch-row.php                       13-Apr-2024 02:08                4522
function.ibase-field-info.php                      13-Apr-2024 02:08                6928
function.ibase-free-event-handler.php              13-Apr-2024 02:08                3528
function.ibase-free-query.php                      13-Apr-2024 02:08                2822
function.ibase-free-result.php                     13-Apr-2024 02:08                2914
function.ibase-gen-id.php                          13-Apr-2024 02:08                2812
function.ibase-maintain-db.php                     13-Apr-2024 02:08                3138
function.ibase-modify-user.php                     13-Apr-2024 02:08                5172
function.ibase-name-result.php                     13-Apr-2024 02:08                5781
function.ibase-num-fields.php                      13-Apr-2024 02:08                6389
function.ibase-num-params.php                      13-Apr-2024 02:08                3420
function.ibase-param-info.php                      13-Apr-2024 02:08                3672
function.ibase-pconnect.php                        13-Apr-2024 02:08                7899
function.ibase-prepare.php                         13-Apr-2024 02:08                4639
function.ibase-query.php                           13-Apr-2024 02:08                7210
function.ibase-restore.php                         13-Apr-2024 02:08               10750
function.ibase-rollback-ret.php                    13-Apr-2024 02:08                3347
function.ibase-rollback.php                        13-Apr-2024 02:08                3152
function.ibase-server-info.php                     13-Apr-2024 02:08                9815
function.ibase-service-attach.php                  13-Apr-2024 02:08               11027
function.ibase-service-detach.php                  13-Apr-2024 02:08                6132
function.ibase-set-event-handler.php               13-Apr-2024 02:08                7844
function.ibase-trans.php                           13-Apr-2024 02:08                5871
function.ibase-wait-event.php                      13-Apr-2024 02:08                4321
function.iconv-get-encoding.php                    13-Apr-2024 02:08                6049
function.iconv-mime-decode-headers.php             13-Apr-2024 02:08               10651
function.iconv-mime-decode.php                     13-Apr-2024 02:08                8701
function.iconv-mime-encode.php                     13-Apr-2024 02:08               11853
function.iconv-set-encoding.php                    13-Apr-2024 02:08                5048
function.iconv-strlen.php                          13-Apr-2024 02:08                5139
function.iconv-strpos.php                          13-Apr-2024 02:08                7370
function.iconv-strrpos.php                         13-Apr-2024 02:08                6659
function.iconv-substr.php                          13-Apr-2024 02:08                8105
function.iconv.php                                 13-Apr-2024 02:08                8899
function.idate.php                                 13-Apr-2024 02:08               11612
function.idn-to-ascii.php                          13-Apr-2024 02:08                8106
function.idn-to-utf8.php                           13-Apr-2024 02:08                8126
function.igbinary-serialize.php                    13-Apr-2024 02:08                9951
function.igbinary-unserialize.php                  13-Apr-2024 02:08                9936
function.ignore-user-abort.php                     13-Apr-2024 02:08                7402
function.image-type-to-extension.php               13-Apr-2024 02:08                5523
function.image-type-to-mime-type.php               13-Apr-2024 02:08                9388
function.image2wbmp.php                            13-Apr-2024 02:08                6753
function.imageaffine.php                           13-Apr-2024 02:08                5075
function.imageaffinematrixconcat.php               13-Apr-2024 02:08                6851
function.imageaffinematrixget.php                  13-Apr-2024 02:08                6893
function.imagealphablending.php                    13-Apr-2024 02:08                7789
function.imageantialias.php                        13-Apr-2024 02:08               11342
function.imagearc.php                              13-Apr-2024 02:08               13959
function.imageavif.php                             13-Apr-2024 02:08                6271
function.imagebmp.php                              13-Apr-2024 02:08                8368
function.imagechar.php                             13-Apr-2024 02:08               10325
function.imagecharup.php                           13-Apr-2024 02:08               10415
function.imagecolorallocate.php                    13-Apr-2024 02:08               10293
function.imagecolorallocatealpha.php               13-Apr-2024 02:08               18498
function.imagecolorat.php                          13-Apr-2024 02:08                9918
function.imagecolorclosest.php                     13-Apr-2024 02:08               12560
function.imagecolorclosestalpha.php                13-Apr-2024 02:08               12466
function.imagecolorclosesthwb.php                  13-Apr-2024 02:08                6856
function.imagecolordeallocate.php                  13-Apr-2024 02:08                6137
function.imagecolorexact.php                       13-Apr-2024 02:08                8727
function.imagecolorexactalpha.php                  13-Apr-2024 02:08                9590
function.imagecolormatch.php                       13-Apr-2024 02:08                8662
function.imagecolorresolve.php                     13-Apr-2024 02:08                8072
function.imagecolorresolvealpha.php                13-Apr-2024 02:08                8577
function.imagecolorset.php                         13-Apr-2024 02:08                9021
function.imagecolorsforindex.php                   13-Apr-2024 02:08                7722
function.imagecolorstotal.php                      13-Apr-2024 02:08                6071
function.imagecolortransparent.php                 13-Apr-2024 02:08                9284
function.imageconvolution.php                      13-Apr-2024 02:08               12075
function.imagecopy.php                             13-Apr-2024 02:08                9499
function.imagecopymerge.php                        13-Apr-2024 02:08                9755
function.imagecopymergegray.php                    13-Apr-2024 02:08               10145
function.imagecopyresampled.php                    13-Apr-2024 02:08               19642
function.imagecopyresized.php                      13-Apr-2024 02:08               14579
function.imagecreate.php                           13-Apr-2024 02:08                8595
function.imagecreatefromavif.php                   13-Apr-2024 02:08                2933
function.imagecreatefrombmp.php                    13-Apr-2024 02:08                5720
function.imagecreatefromgd.php                     13-Apr-2024 02:08                6440
function.imagecreatefromgd2.php                    13-Apr-2024 02:08                6641
function.imagecreatefromgd2part.php                13-Apr-2024 02:08                9151
function.imagecreatefromgif.php                    13-Apr-2024 02:08                9926
function.imagecreatefromjpeg.php                   13-Apr-2024 02:08                9571
function.imagecreatefrompng.php                    13-Apr-2024 02:08                9546
function.imagecreatefromstring.php                 13-Apr-2024 02:08                8284
function.imagecreatefromtga.php                    13-Apr-2024 02:08                3588
function.imagecreatefromwbmp.php                   13-Apr-2024 02:08                9612
function.imagecreatefromwebp.php                   13-Apr-2024 02:08                5893
function.imagecreatefromxbm.php                    13-Apr-2024 02:08                5697
function.imagecreatefromxpm.php                    13-Apr-2024 02:08                6362
function.imagecreatetruecolor.php                  13-Apr-2024 02:08                7431
function.imagecrop.php                             13-Apr-2024 02:08                8207
function.imagecropauto.php                         13-Apr-2024 02:08               11178
function.imagedashedline.php                       13-Apr-2024 02:08               13015
function.imagedestroy.php                          13-Apr-2024 02:08                5389
function.imageellipse.php                          13-Apr-2024 02:08               10395
function.imagefill.php                             13-Apr-2024 02:08                7875
function.imagefilledarc.php                        13-Apr-2024 02:08               19288
function.imagefilledellipse.php                    13-Apr-2024 02:08               10106
function.imagefilledpolygon.php                    13-Apr-2024 02:08               12605
function.imagefilledrectangle.php                  13-Apr-2024 02:08                8672
function.imagefilltoborder.php                     13-Apr-2024 02:08               11662
function.imagefilter.php                           13-Apr-2024 02:08               34888
function.imageflip.php                             13-Apr-2024 02:08               10157
function.imagefontheight.php                       13-Apr-2024 02:08                6866
function.imagefontwidth.php                        13-Apr-2024 02:08                6865
function.imageftbbox.php                           13-Apr-2024 02:08               14246
function.imagefttext.php                           13-Apr-2024 02:08               16141
function.imagegammacorrect.php                     13-Apr-2024 02:08                6234
function.imagegd.php                               13-Apr-2024 02:08               11293
function.imagegd2.php                              13-Apr-2024 02:08               12485
function.imagegetclip.php                          13-Apr-2024 02:08                6176
function.imagegetinterpolation.php                 13-Apr-2024 02:08                3911
function.imagegif.php                              13-Apr-2024 02:08               17099
function.imagegrabscreen.php                       13-Apr-2024 02:08                4908
function.imagegrabwindow.php                       13-Apr-2024 02:08               10158
function.imageinterlace.php                        13-Apr-2024 02:08                7238
function.imageistruecolor.php                      13-Apr-2024 02:08                7719
function.imagejpeg.php                             13-Apr-2024 02:08               15542
function.imagelayereffect.php                      13-Apr-2024 02:08               12329
function.imageline.php                             13-Apr-2024 02:08               15877
function.imageloadfont.php                         13-Apr-2024 02:08                9769
function.imageopenpolygon.php                      13-Apr-2024 02:08               10841
function.imagepalettecopy.php                      13-Apr-2024 02:08                7521
function.imagepalettetotruecolor.php               13-Apr-2024 02:08               10135
function.imagepng.php                              13-Apr-2024 02:08                9472
function.imagepolygon.php                          13-Apr-2024 02:08               10764
function.imagerectangle.php                        13-Apr-2024 02:08               10864
function.imageresolution.php                       13-Apr-2024 02:08                8343
function.imagerotate.php                           13-Apr-2024 02:08                9376
function.imagesavealpha.php                        13-Apr-2024 02:08                8086
function.imagescale.php                            13-Apr-2024 02:08                7235
function.imagesetbrush.php                         13-Apr-2024 02:08                9579
function.imagesetclip.php                          13-Apr-2024 02:08                5383
function.imagesetinterpolation.php                 13-Apr-2024 02:08               11874
function.imagesetpixel.php                         13-Apr-2024 02:08               11799
function.imagesetstyle.php                         13-Apr-2024 02:08               12501
function.imagesetthickness.php                     13-Apr-2024 02:08                8676
function.imagesettile.php                          13-Apr-2024 02:08                8766
function.imagestring.php                           13-Apr-2024 02:08               10546
function.imagestringup.php                         13-Apr-2024 02:08                9632
function.imagesx.php                               13-Apr-2024 02:08                5402
function.imagesy.php                               13-Apr-2024 02:08                5386
function.imagetruecolortopalette.php               13-Apr-2024 02:08                7127
function.imagettfbbox.php                          13-Apr-2024 02:08               19576
function.imagettftext.php                          13-Apr-2024 02:08               18430
function.imagetypes.php                            13-Apr-2024 02:08                5144
function.imagewbmp.php                             13-Apr-2024 02:08               15684
function.imagewebp.php                             13-Apr-2024 02:08                7813
function.imagexbm.php                              13-Apr-2024 02:08               11909
function.imap-8bit.php                             13-Apr-2024 02:08                3262
function.imap-alerts.php                           13-Apr-2024 02:08                3228
function.imap-append.php                           13-Apr-2024 02:08                9793
function.imap-base64.php                           13-Apr-2024 02:08                3607
function.imap-binary.php                           13-Apr-2024 02:08                3215
function.imap-body.php                             13-Apr-2024 02:08                5636
function.imap-bodystruct.php                       13-Apr-2024 02:08                4847
function.imap-check.php                            13-Apr-2024 02:08                6152
function.imap-clearflag-full.php                   13-Apr-2024 02:08                5906
function.imap-close.php                            13-Apr-2024 02:08                4536
function.imap-create.php                           13-Apr-2024 02:08                1744
function.imap-createmailbox.php                    13-Apr-2024 02:08               14154
function.imap-delete.php                           13-Apr-2024 02:08                9865
function.imap-deletemailbox.php                    13-Apr-2024 02:08                5058
function.imap-errors.php                           13-Apr-2024 02:08                3502
function.imap-expunge.php                          13-Apr-2024 02:08                3718
function.imap-fetch-overview.php                   13-Apr-2024 02:08               11445
function.imap-fetchbody.php                        13-Apr-2024 02:08                6524
function.imap-fetchheader.php                      13-Apr-2024 02:08                6041
function.imap-fetchmime.php                        13-Apr-2024 02:08                6590
function.imap-fetchstructure.php                   13-Apr-2024 02:08               10084
function.imap-fetchtext.php                        13-Apr-2024 02:08                1725
function.imap-gc.php                               13-Apr-2024 02:08                5340
function.imap-get-quota.php                        13-Apr-2024 02:08               12380
function.imap-get-quotaroot.php                    13-Apr-2024 02:08                9347
function.imap-getacl.php                           13-Apr-2024 02:08                6141
function.imap-getmailboxes.php                     13-Apr-2024 02:08               12289
function.imap-getsubscribed.php                    13-Apr-2024 02:08                7963
function.imap-header.php                           13-Apr-2024 02:08                1943
function.imap-headerinfo.php                       13-Apr-2024 02:08               14526
function.imap-headers.php                          13-Apr-2024 02:08                3655
function.imap-is-open.php                          13-Apr-2024 02:08                4184
function.imap-last-error.php                       13-Apr-2024 02:08                3078
function.imap-list.php                             13-Apr-2024 02:08                8704
function.imap-listmailbox.php                      13-Apr-2024 02:08                1727
function.imap-listscan.php                         13-Apr-2024 02:08                6917
function.imap-listsubscribed.php                   13-Apr-2024 02:08                1748
function.imap-lsub.php                             13-Apr-2024 02:08                6035
function.imap-mail-compose.php                     13-Apr-2024 02:08               16255
function.imap-mail-copy.php                        13-Apr-2024 02:08                6526
function.imap-mail-move.php                        13-Apr-2024 02:08                6790
function.imap-mail.php                             13-Apr-2024 02:08                7544
function.imap-mailboxmsginfo.php                   13-Apr-2024 02:08                9314
function.imap-mime-header-decode.php               13-Apr-2024 02:08                6524
function.imap-msgno.php                            13-Apr-2024 02:08                4255
function.imap-mutf7-to-utf8.php                    13-Apr-2024 02:08                3420
function.imap-num-msg.php                          13-Apr-2024 02:08                4132
function.imap-num-recent.php                       13-Apr-2024 02:08                3938
function.imap-open.php                             13-Apr-2024 02:08               23033
function.imap-ping.php                             13-Apr-2024 02:08                5091
function.imap-qprint.php                           13-Apr-2024 02:08                3331
function.imap-rename.php                           13-Apr-2024 02:08                1747
function.imap-renamemailbox.php                    13-Apr-2024 02:08                5167
function.imap-reopen.php                           13-Apr-2024 02:08                9042
function.imap-rfc822-parse-adrlist.php             13-Apr-2024 02:08                8005
function.imap-rfc822-parse-headers.php             13-Apr-2024 02:08                3778
function.imap-rfc822-write-address.php             13-Apr-2024 02:08                5566
function.imap-savebody.php                         13-Apr-2024 02:08                6905
function.imap-scan.php                             13-Apr-2024 02:08                1712
function.imap-scanmailbox.php                      13-Apr-2024 02:08                1737
function.imap-search.php                           13-Apr-2024 02:08               13933
function.imap-set-quota.php                        13-Apr-2024 02:08                6986
function.imap-setacl.php                           13-Apr-2024 02:08                5805
function.imap-setflag-full.php                     13-Apr-2024 02:08                8100
function.imap-sort.php                             13-Apr-2024 02:08                8884
function.imap-status.php                           13-Apr-2024 02:08               10984
function.imap-subscribe.php                        13-Apr-2024 02:08                4664
function.imap-thread.php                           13-Apr-2024 02:08                7971
function.imap-timeout.php                          13-Apr-2024 02:08                4805
function.imap-uid.php                              13-Apr-2024 02:08                4713
function.imap-undelete.php                         13-Apr-2024 02:08                5009
function.imap-unsubscribe.php                      13-Apr-2024 02:08                4727
function.imap-utf7-decode.php                      13-Apr-2024 02:08                3742
function.imap-utf7-encode.php                      13-Apr-2024 02:08                3436
function.imap-utf8-to-mutf7.php                    13-Apr-2024 02:08                3432
function.imap-utf8.php                             13-Apr-2024 02:08                4348
function.implode.php                               13-Apr-2024 02:08                8029
function.in-array.php                              13-Apr-2024 02:08               11849
function.include-once.php                          13-Apr-2024 02:08                2337
function.include.php                               13-Apr-2024 02:08               20556
function.inet-ntop.php                             13-Apr-2024 02:08                6369
function.inet-pton.php                             13-Apr-2024 02:08                4884
function.inflate-add.php                           13-Apr-2024 02:08                6275
function.inflate-get-read-len.php                  13-Apr-2024 02:08                3457
function.inflate-get-status.php                    13-Apr-2024 02:08                3238
function.inflate-init.php                          13-Apr-2024 02:08                7094
function.ini-alter.php                             13-Apr-2024 02:08                1683
function.ini-get-all.php                           13-Apr-2024 02:08               10672
function.ini-get.php                               13-Apr-2024 02:08               10949
function.ini-parse-quantity.php                    13-Apr-2024 02:08                7630
function.ini-restore.php                           13-Apr-2024 02:08                6523
function.ini-set.php                               13-Apr-2024 02:08                6971
function.inotify-add-watch.php                     13-Apr-2024 02:08                4464
function.inotify-init.php                          13-Apr-2024 02:08                8960
function.inotify-queue-len.php                     13-Apr-2024 02:08                3864
function.inotify-read.php                          13-Apr-2024 02:08                4462
function.inotify-rm-watch.php                      13-Apr-2024 02:08                3701
function.intdiv.php                                13-Apr-2024 02:08                7569
function.interface-exists.php                      13-Apr-2024 02:08                5487
function.intl-error-name.php                       13-Apr-2024 02:08                5085
function.intl-get-error-code.php                   13-Apr-2024 02:08                4685
function.intl-get-error-message.php                13-Apr-2024 02:08                4719
function.intl-is-failure.php                       13-Apr-2024 02:08                5880
function.intval.php                                13-Apr-2024 02:08               13755
function.ip2long.php                               13-Apr-2024 02:08                9337
function.iptcembed.php                             13-Apr-2024 02:08               12032
function.iptcparse.php                             13-Apr-2024 02:08                4748
function.is-a.php                                  13-Apr-2024 02:08                7168
function.is-array.php                              13-Apr-2024 02:08                5868
function.is-bool.php                               13-Apr-2024 02:08                5769
function.is-callable.php                           13-Apr-2024 02:08               11153
function.is-countable.php                          13-Apr-2024 02:08                6374
function.is-dir.php                                13-Apr-2024 02:08                6814
function.is-double.php                             13-Apr-2024 02:08                1679
function.is-executable.php                         13-Apr-2024 02:08                6881
function.is-file.php                               13-Apr-2024 02:08                6235
function.is-finite.php                             13-Apr-2024 02:08                6006
function.is-float.php                              13-Apr-2024 02:08                6777
function.is-infinite.php                           13-Apr-2024 02:08                5196
function.is-int.php                                13-Apr-2024 02:08                6671
function.is-integer.php                            13-Apr-2024 02:08                1672
function.is-iterable.php                           13-Apr-2024 02:08                5819
function.is-link.php                               13-Apr-2024 02:08                5788
function.is-long.php                               13-Apr-2024 02:08                1653
function.is-nan.php                                13-Apr-2024 02:08                5920
function.is-null.php                               13-Apr-2024 02:08                6221
function.is-numeric.php                            13-Apr-2024 02:08               12068
function.is-object.php                             13-Apr-2024 02:08                7350
function.is-readable.php                           13-Apr-2024 02:08                6472
function.is-real.php                               13-Apr-2024 02:08                1886
function.is-resource.php                           13-Apr-2024 02:08                5314
function.is-scalar.php                             13-Apr-2024 02:08                8589
function.is-soap-fault.php                         13-Apr-2024 02:08                8130
function.is-string.php                             13-Apr-2024 02:08                6886
function.is-subclass-of.php                        13-Apr-2024 02:08               12871
function.is-tainted.php                            13-Apr-2024 02:08                2357
function.is-uploaded-file.php                      13-Apr-2024 02:08                7019
function.is-writable.php                           13-Apr-2024 02:08                6188
function.is-writeable.php                          13-Apr-2024 02:08                6083
function.isset.php                                 13-Apr-2024 02:08               15915
function.iterator-apply.php                        13-Apr-2024 02:08                6798
function.iterator-count.php                        13-Apr-2024 02:08                8711
function.iterator-to-array.php                     13-Apr-2024 02:08                7975
function.jddayofweek.php                           13-Apr-2024 02:08                3871
function.jdmonthname.php                           13-Apr-2024 02:08                5068
function.jdtofrench.php                            13-Apr-2024 02:08                3178
function.jdtogregorian.php                         13-Apr-2024 02:08                3197
function.jdtojewish.php                            13-Apr-2024 02:08                7620
function.jdtojulian.php                            13-Apr-2024 02:08                3176
function.jdtounix.php                              13-Apr-2024 02:08                4469
function.jewishtojd.php                            13-Apr-2024 02:08                4253
function.join.php                                  13-Apr-2024 02:08                1626
function.jpeg2wbmp.php                             13-Apr-2024 02:08                6845
function.json-decode.php                           13-Apr-2024 02:08               20073
function.json-encode.php                           13-Apr-2024 02:08               28430
function.json-last-error-msg.php                   13-Apr-2024 02:08                2929
function.json-last-error.php                       13-Apr-2024 02:08               13650
function.json-validate.php                         13-Apr-2024 02:08                8718
function.juliantojd.php                            13-Apr-2024 02:08                4586
function.key-exists.php                            13-Apr-2024 02:08                1708
function.key.php                                   13-Apr-2024 02:08                7743
function.krsort.php                                13-Apr-2024 02:08                9455
function.ksort.php                                 13-Apr-2024 02:08               11168
function.lcfirst.php                               13-Apr-2024 02:08                6215
function.lcg-value.php                             13-Apr-2024 02:08                5130
function.lchgrp.php                                13-Apr-2024 02:08                6031
function.lchown.php                                13-Apr-2024 02:08                5888
function.ldap-8859-to-t61.php                      13-Apr-2024 02:08                3389
function.ldap-add-ext.php                          13-Apr-2024 02:08                5944
function.ldap-add.php                              13-Apr-2024 02:08               10736
function.ldap-bind-ext.php                         13-Apr-2024 02:08                6094
function.ldap-bind.php                             13-Apr-2024 02:08                9695
function.ldap-close.php                            13-Apr-2024 02:08                1681
function.ldap-compare.php                          13-Apr-2024 02:08               10589
function.ldap-connect-wallet.php                   13-Apr-2024 02:08                4308
function.ldap-connect.php                          13-Apr-2024 02:08                9798
function.ldap-control-paged-result-response.php    13-Apr-2024 02:08                5980
function.ldap-control-paged-result.php             13-Apr-2024 02:08               14580
function.ldap-count-entries.php                    13-Apr-2024 02:08                5988
function.ldap-count-references.php                 13-Apr-2024 02:08                5004
function.ldap-delete-ext.php                       13-Apr-2024 02:08                5439
function.ldap-delete.php                           13-Apr-2024 02:08                5610
function.ldap-dn2ufn.php                           13-Apr-2024 02:08                2763
function.ldap-err2str.php                          13-Apr-2024 02:08                4638
function.ldap-errno.php                            13-Apr-2024 02:08                7722
function.ldap-error.php                            13-Apr-2024 02:08                4712
function.ldap-escape.php                           13-Apr-2024 02:08                6343
function.ldap-exop-passwd.php                      13-Apr-2024 02:08               10617
function.ldap-exop-refresh.php                     13-Apr-2024 02:08                5358
function.ldap-exop-sync.php                        13-Apr-2024 02:08                5515
function.ldap-exop-whoami.php                      13-Apr-2024 02:08                4132
function.ldap-exop.php                             13-Apr-2024 02:08               12685
function.ldap-explode-dn.php                       13-Apr-2024 02:08                3669
function.ldap-first-attribute.php                  13-Apr-2024 02:08                5722
function.ldap-first-entry.php                      13-Apr-2024 02:08                6018
function.ldap-first-reference.php                  13-Apr-2024 02:08                2340
function.ldap-free-result.php                      13-Apr-2024 02:08                4193
function.ldap-get-attributes.php                   13-Apr-2024 02:08                8488
function.ldap-get-dn.php                           13-Apr-2024 02:08                4573
function.ldap-get-entries.php                      13-Apr-2024 02:08                6400
function.ldap-get-option.php                       13-Apr-2024 02:08               16918
function.ldap-get-values-len.php                   13-Apr-2024 02:08                5781
function.ldap-get-values.php                       13-Apr-2024 02:08                8892
function.ldap-list.php                             13-Apr-2024 02:08               15733
function.ldap-mod-add.php                          13-Apr-2024 02:08                7144
function.ldap-mod-del.php                          13-Apr-2024 02:08                6658
function.ldap-mod-replace.php                      13-Apr-2024 02:08                7089
function.ldap-mod_add-ext.php                      13-Apr-2024 02:08                5908
function.ldap-mod_del-ext.php                      13-Apr-2024 02:08                5924
function.ldap-mod_replace-ext.php                  13-Apr-2024 02:08                5986
function.ldap-modify-batch.php                     13-Apr-2024 02:08               19144
function.ldap-modify.php                           13-Apr-2024 02:08                2092
function.ldap-next-attribute.php                   13-Apr-2024 02:08                5501
function.ldap-next-entry.php                       13-Apr-2024 02:08                6027
function.ldap-next-reference.php                   13-Apr-2024 02:08                2267
function.ldap-parse-exop.php                       13-Apr-2024 02:08                6253
function.ldap-parse-reference.php                  13-Apr-2024 02:08                2409
function.ldap-parse-result.php                     13-Apr-2024 02:08               10187
function.ldap-read.php                             13-Apr-2024 02:08               13084
function.ldap-rename-ext.php                       13-Apr-2024 02:08                6258
function.ldap-rename.php                           13-Apr-2024 02:08                7511
function.ldap-sasl-bind.php                        13-Apr-2024 02:08                7172
function.ldap-search.php                           13-Apr-2024 02:08               15967
function.ldap-set-option.php                       13-Apr-2024 02:08               19398
function.ldap-set-rebind-proc.php                  13-Apr-2024 02:08                3308
function.ldap-sort.php                             13-Apr-2024 02:08                7236
function.ldap-start-tls.php                        13-Apr-2024 02:08                2023
function.ldap-t61-to-8859.php                      13-Apr-2024 02:08                2175
function.ldap-unbind.php                           13-Apr-2024 02:08                4059
function.levenshtein.php                           13-Apr-2024 02:08               12433
function.libxml-clear-errors.php                   13-Apr-2024 02:08                2836
function.libxml-disable-entity-loader.php          13-Apr-2024 02:08                5145
function.libxml-get-errors.php                     13-Apr-2024 02:08               10758
function.libxml-get-external-entity-loader.php     13-Apr-2024 02:08                3513
function.libxml-get-last-error.php                 13-Apr-2024 02:08                3264
function.libxml-set-external-entity-loader.php     13-Apr-2024 02:08               10424
function.libxml-set-streams-context.php            13-Apr-2024 02:08                5108
function.libxml-use-internal-errors.php            13-Apr-2024 02:08                6851
function.link.php                                  13-Apr-2024 02:08                5967
function.linkinfo.php                              13-Apr-2024 02:08                4626
function.list.php                                  13-Apr-2024 02:08               16885
function.localeconv.php                            13-Apr-2024 02:08                9556
function.localtime.php                             13-Apr-2024 02:08                9479
function.log.php                                   13-Apr-2024 02:08                4032
function.log10.php                                 13-Apr-2024 02:08                2688
function.log1p.php                                 13-Apr-2024 02:08                3456
function.long2ip.php                               13-Apr-2024 02:08                4573
function.lstat.php                                 13-Apr-2024 02:08                6634
function.ltrim.php                                 13-Apr-2024 02:08                9618
function.lzf-compress.php                          13-Apr-2024 02:08                3058
function.lzf-decompress.php                        13-Apr-2024 02:08                3126
function.lzf-optimized-for.php                     13-Apr-2024 02:08                2331
function.mail.php                                  13-Apr-2024 02:08               26568
function.mailparse-determine-best-xfer-encoding..> 13-Apr-2024 02:08                4286
function.mailparse-msg-create.php                  13-Apr-2024 02:08                3397
function.mailparse-msg-extract-part-file.php       13-Apr-2024 02:08                5354
function.mailparse-msg-extract-part.php            13-Apr-2024 02:08                4123
function.mailparse-msg-extract-whole-part-file.php 13-Apr-2024 02:08                4148
function.mailparse-msg-free.php                    13-Apr-2024 02:08                3657
function.mailparse-msg-get-part-data.php           13-Apr-2024 02:08                2580
function.mailparse-msg-get-part.php                13-Apr-2024 02:08                2863
function.mailparse-msg-get-structure.php           13-Apr-2024 02:08                2600
function.mailparse-msg-parse-file.php              13-Apr-2024 02:08                4265
function.mailparse-msg-parse.php                   13-Apr-2024 02:08                3572
function.mailparse-rfc822-parse-addresses.php      13-Apr-2024 02:08                5681
function.mailparse-stream-encode.php               13-Apr-2024 02:08                5937
function.mailparse-uudecode-all.php                13-Apr-2024 02:08                6923
function.max.php                                   13-Apr-2024 02:08               12316
function.mb-check-encoding.php                     13-Apr-2024 02:08                5738
function.mb-chr.php                                13-Apr-2024 02:08                7390
function.mb-convert-case.php                       13-Apr-2024 02:08               11997
function.mb-convert-encoding.php                   13-Apr-2024 02:08               11111
function.mb-convert-kana.php                       13-Apr-2024 02:08               10644
function.mb-convert-variables.php                  13-Apr-2024 02:08                6472
function.mb-decode-mimeheader.php                  13-Apr-2024 02:08                3113
function.mb-decode-numericentity.php               13-Apr-2024 02:08               34672
function.mb-detect-encoding.php                    13-Apr-2024 02:08               15634
function.mb-detect-order.php                       13-Apr-2024 02:08                9290
function.mb-encode-mimeheader.php                  13-Apr-2024 02:08                9895
function.mb-encode-numericentity.php               13-Apr-2024 02:08               13018
function.mb-encoding-aliases.php                   13-Apr-2024 02:08                6547
function.mb-ereg-match.php                         13-Apr-2024 02:08                5882
function.mb-ereg-replace-callback.php              13-Apr-2024 02:08               11699
function.mb-ereg-replace.php                       13-Apr-2024 02:08                7590
function.mb-ereg-search-getpos.php                 13-Apr-2024 02:08                4212
function.mb-ereg-search-getregs.php                13-Apr-2024 02:08                4502
function.mb-ereg-search-init.php                   13-Apr-2024 02:08                6544
function.mb-ereg-search-pos.php                    13-Apr-2024 02:08                6428
function.mb-ereg-search-regs.php                   13-Apr-2024 02:08                6083
function.mb-ereg-search-setpos.php                 13-Apr-2024 02:08                4898
function.mb-ereg-search.php                        13-Apr-2024 02:08                6022
function.mb-ereg.php                               13-Apr-2024 02:08                6914
function.mb-eregi-replace.php                      13-Apr-2024 02:08                7571
function.mb-eregi.php                              13-Apr-2024 02:08                6983
function.mb-get-info.php                           13-Apr-2024 02:08                6375
function.mb-http-input.php                         13-Apr-2024 02:08                5192
function.mb-http-output.php                        13-Apr-2024 02:08                4879
function.mb-internal-encoding.php                  13-Apr-2024 02:08                7160
function.mb-language.php                           13-Apr-2024 02:08                6611
function.mb-list-encodings.php                     13-Apr-2024 02:08                5185
function.mb-ord.php                                13-Apr-2024 02:08                7098
function.mb-output-handler.php                     13-Apr-2024 02:08                5468
function.mb-parse-str.php                          13-Apr-2024 02:08                4736
function.mb-preferred-mime-name.php                13-Apr-2024 02:08                4473
function.mb-regex-encoding.php                     13-Apr-2024 02:08                5093
function.mb-regex-set-options.php                  13-Apr-2024 02:08                9121
function.mb-scrub.php                              13-Apr-2024 02:08                4198
function.mb-send-mail.php                          13-Apr-2024 02:08               10130
function.mb-split.php                              13-Apr-2024 02:08                4739
function.mb-str-pad.php                            13-Apr-2024 02:08                8738
function.mb-str-split.php                          13-Apr-2024 02:08                5448
function.mb-strcut.php                             13-Apr-2024 02:08                7781
function.mb-strimwidth.php                         13-Apr-2024 02:08                8055
function.mb-stripos.php                            13-Apr-2024 02:08                6965
function.mb-stristr.php                            13-Apr-2024 02:08                7745
function.mb-strlen.php                             13-Apr-2024 02:08                5237
function.mb-strpos.php                             13-Apr-2024 02:08                6794
function.mb-strrchr.php                            13-Apr-2024 02:08                7568
function.mb-strrichr.php                           13-Apr-2024 02:08                7507
function.mb-strripos.php                           13-Apr-2024 02:08                6806
function.mb-strrpos.php                            13-Apr-2024 02:08                6928
function.mb-strstr.php                             13-Apr-2024 02:08                7385
function.mb-strtolower.php                         13-Apr-2024 02:08                7572
function.mb-strtoupper.php                         13-Apr-2024 02:08                7572
function.mb-strwidth.php                           13-Apr-2024 02:08                9326
function.mb-substitute-character.php               13-Apr-2024 02:08                7595
function.mb-substr-count.php                       13-Apr-2024 02:08                6179
function.mb-substr.php                             13-Apr-2024 02:08                6979
function.mcrypt-create-iv.php                      13-Apr-2024 02:08                7343
function.mcrypt-decrypt.php                        13-Apr-2024 02:08                6147
function.mcrypt-enc-get-algorithms-name.php        13-Apr-2024 02:08                5522
function.mcrypt-enc-get-block-size.php             13-Apr-2024 02:08                3209
function.mcrypt-enc-get-iv-size.php                13-Apr-2024 02:08                3383
function.mcrypt-enc-get-key-size.php               13-Apr-2024 02:08                3240
function.mcrypt-enc-get-modes-name.php             13-Apr-2024 02:08                5425
function.mcrypt-enc-get-supported-key-sizes.php    13-Apr-2024 02:08                5273
function.mcrypt-enc-is-block-algorithm-mode.php    13-Apr-2024 02:08                3791
function.mcrypt-enc-is-block-algorithm.php         13-Apr-2024 02:08                3497
function.mcrypt-enc-is-block-mode.php              13-Apr-2024 02:08                3649
function.mcrypt-enc-self-test.php                  13-Apr-2024 02:08                3268
function.mcrypt-encrypt.php                        13-Apr-2024 02:08               14116
function.mcrypt-generic-deinit.php                 13-Apr-2024 02:08                4349
function.mcrypt-generic-init.php                   13-Apr-2024 02:08                5566
function.mcrypt-generic.php                        13-Apr-2024 02:08                6202
function.mcrypt-get-block-size.php                 13-Apr-2024 02:08                6777
function.mcrypt-get-cipher-name.php                13-Apr-2024 02:08                5100
function.mcrypt-get-iv-size.php                    13-Apr-2024 02:08                6516
function.mcrypt-get-key-size.php                   13-Apr-2024 02:08                6916
function.mcrypt-list-algorithms.php                13-Apr-2024 02:08                4917
function.mcrypt-list-modes.php                     13-Apr-2024 02:08                4769
function.mcrypt-module-close.php                   13-Apr-2024 02:08                3710
function.mcrypt-module-get-algo-block-size.php     13-Apr-2024 02:08                3747
function.mcrypt-module-get-algo-key-size.php       13-Apr-2024 02:08                3851
function.mcrypt-module-get-supported-key-sizes.php 13-Apr-2024 02:08                4897
function.mcrypt-module-is-block-algorithm-mode.php 13-Apr-2024 02:08                4716
function.mcrypt-module-is-block-algorithm.php      13-Apr-2024 02:08                4186
function.mcrypt-module-is-block-mode.php           13-Apr-2024 02:08                4732
function.mcrypt-module-open.php                    13-Apr-2024 02:08               14144
function.mcrypt-module-self-test.php               13-Apr-2024 02:08                5217
function.md5-file.php                              13-Apr-2024 02:08                5040
function.md5.php                                   13-Apr-2024 02:08                6042
function.mdecrypt-generic.php                      13-Apr-2024 02:08               11166
function.memcache-debug.php                        13-Apr-2024 02:08                3747
function.memory-get-peak-usage.php                 13-Apr-2024 02:08                3854
function.memory-get-usage.php                      13-Apr-2024 02:08                5721
function.memory-reset-peak-usage.php               13-Apr-2024 02:08                5029
function.metaphone.php                             13-Apr-2024 02:08                8525
function.method-exists.php                         13-Apr-2024 02:08                6679
function.mhash-count.php                           13-Apr-2024 02:08                4816
function.mhash-get-block-size.php                  13-Apr-2024 02:08                4640
function.mhash-get-hash-name.php                   13-Apr-2024 02:08                4626
function.mhash-keygen-s2k.php                      13-Apr-2024 02:08                5895
function.mhash.php                                 13-Apr-2024 02:08                5078
function.microtime.php                             13-Apr-2024 02:08                7988
function.mime-content-type.php                     13-Apr-2024 02:08                5180
function.min.php                                   13-Apr-2024 02:08               12860
function.mkdir.php                                 13-Apr-2024 02:08                9726
function.mktime.php                                13-Apr-2024 02:08               19764
function.money-format.php                          13-Apr-2024 02:08               18388
function.mongodb.bson-fromjson.php                 13-Apr-2024 02:08                5883
function.mongodb.bson-fromphp.php                  13-Apr-2024 02:08                6220
function.mongodb.bson-tocanonicalextendedjson.php  13-Apr-2024 02:08               13919
function.mongodb.bson-tojson.php                   13-Apr-2024 02:08               14997
function.mongodb.bson-tophp.php                    13-Apr-2024 02:08                9107
function.mongodb.bson-torelaxedextendedjson.php    13-Apr-2024 02:08               13616
function.mongodb.driver.monitoring.addsubscribe..> 13-Apr-2024 02:08                5079
function.mongodb.driver.monitoring.removesubscr..> 13-Apr-2024 02:08                4934
function.move-uploaded-file.php                    13-Apr-2024 02:08                8619
function.mqseries-back.php                         13-Apr-2024 02:08                6474
function.mqseries-begin.php                        13-Apr-2024 02:08                7434
function.mqseries-close.php                        13-Apr-2024 02:08                6649
function.mqseries-cmit.php                         13-Apr-2024 02:08                6399
function.mqseries-conn.php                         13-Apr-2024 02:08                5974
function.mqseries-connx.php                        13-Apr-2024 02:08               12674
function.mqseries-disc.php                         13-Apr-2024 02:08                5676
function.mqseries-get.php                          13-Apr-2024 02:08               12294
function.mqseries-inq.php                          13-Apr-2024 02:08                9352
function.mqseries-open.php                         13-Apr-2024 02:08                7285
function.mqseries-put.php                          13-Apr-2024 02:08               12573
function.mqseries-put1.php                         13-Apr-2024 02:08                6319
function.mqseries-set.php                          13-Apr-2024 02:08                6245
function.mqseries-strerror.php                     13-Apr-2024 02:08                4258
function.msg-get-queue.php                         13-Apr-2024 02:08                5672
function.msg-queue-exists.php                      13-Apr-2024 02:08                3433
function.msg-receive.php                           13-Apr-2024 02:08               11467
function.msg-remove-queue.php                      13-Apr-2024 02:08                4632
function.msg-send.php                              13-Apr-2024 02:08                9596
function.msg-set-queue.php                         13-Apr-2024 02:08                5290
function.msg-stat-queue.php                        13-Apr-2024 02:08                6655
function.mt-getrandmax.php                         13-Apr-2024 02:08                3295
function.mt-rand.php                               13-Apr-2024 02:08               10363
function.mt-srand.php                              13-Apr-2024 02:08                8472
function.mysql-affected-rows.php                   13-Apr-2024 02:08               12382
function.mysql-client-encoding.php                 13-Apr-2024 02:08                6399
function.mysql-close.php                           13-Apr-2024 02:08                7541
function.mysql-connect.php                         13-Apr-2024 02:08               17643
function.mysql-create-db.php                       13-Apr-2024 02:08                8735
function.mysql-data-seek.php                       13-Apr-2024 02:08               11971
function.mysql-db-name.php                         13-Apr-2024 02:08                7248
function.mysql-db-query.php                        13-Apr-2024 02:08               10287
function.mysql-drop-db.php                         13-Apr-2024 02:08                7826
function.mysql-errno.php                           13-Apr-2024 02:08                8280
function.mysql-error.php                           13-Apr-2024 02:08                8246
function.mysql-escape-string.php                   13-Apr-2024 02:08                6556
function.mysql-fetch-array.php                     13-Apr-2024 02:08               15692
function.mysql-fetch-assoc.php                     13-Apr-2024 02:08               11464
function.mysql-fetch-field.php                     13-Apr-2024 02:08               13051
function.mysql-fetch-lengths.php                   13-Apr-2024 02:08                7698
function.mysql-fetch-object.php                    13-Apr-2024 02:08               11923
function.mysql-fetch-row.php                       13-Apr-2024 02:08                7770
function.mysql-field-flags.php                     13-Apr-2024 02:08                8601
function.mysql-field-len.php                       13-Apr-2024 02:08                7047
function.mysql-field-name.php                      13-Apr-2024 02:08                9119
function.mysql-field-seek.php                      13-Apr-2024 02:08                5155
function.mysql-field-table.php                     13-Apr-2024 02:08                7715
function.mysql-field-type.php                      13-Apr-2024 02:08               11664
function.mysql-free-result.php                     13-Apr-2024 02:08                8073
function.mysql-get-client-info.php                 13-Apr-2024 02:08                5270
function.mysql-get-host-info.php                   13-Apr-2024 02:08                7308
function.mysql-get-proto-info.php                  13-Apr-2024 02:08                6816
function.mysql-get-server-info.php                 13-Apr-2024 02:08                7380
function.mysql-info.php                            13-Apr-2024 02:08                6533
function.mysql-insert-id.php                       13-Apr-2024 02:08                8347
function.mysql-list-dbs.php                        13-Apr-2024 02:08                9057
function.mysql-list-fields.php                     13-Apr-2024 02:08                9132
function.mysql-list-processes.php                  13-Apr-2024 02:08                7874
function.mysql-list-tables.php                     13-Apr-2024 02:08                9958
function.mysql-num-fields.php                      13-Apr-2024 02:08                6709
function.mysql-num-rows.php                        13-Apr-2024 02:08                8194
function.mysql-pconnect.php                        13-Apr-2024 02:08                8430
function.mysql-ping.php                            13-Apr-2024 02:08                8173
function.mysql-query.php                           13-Apr-2024 02:08               13897
function.mysql-real-escape-string.php              13-Apr-2024 02:08               15374
function.mysql-result.php                          13-Apr-2024 02:08                9639
function.mysql-select-db.php                       13-Apr-2024 02:08                7908
function.mysql-set-charset.php                     13-Apr-2024 02:08                6012
function.mysql-stat.php                            13-Apr-2024 02:08                9591
function.mysql-tablename.php                       13-Apr-2024 02:08                8320
function.mysql-thread-id.php                       13-Apr-2024 02:08                6874
function.mysql-unbuffered-query.php                13-Apr-2024 02:08                7327
function.mysql-xdevapi-expression.php              13-Apr-2024 02:08                4823
function.mysql-xdevapi-getsession.php              13-Apr-2024 02:08               13079
function.mysqli-connect.php                        13-Apr-2024 02:08                2332
function.mysqli-escape-string.php                  13-Apr-2024 02:08                1924
function.mysqli-execute.php                        13-Apr-2024 02:08                2489
function.mysqli-get-client-stats.php               13-Apr-2024 02:08                8354
function.mysqli-get-links-stats.php                13-Apr-2024 02:08                3391
function.mysqli-report.php                         13-Apr-2024 02:08                1726
function.mysqli-set-opt.php                        13-Apr-2024 02:08                1827
function.natcasesort.php                           13-Apr-2024 02:08                7965
function.natsort.php                               13-Apr-2024 02:08               11108
function.net-get-interfaces.php                    13-Apr-2024 02:08                4765
function.next.php                                  13-Apr-2024 02:08                9749
function.ngettext.php                              13-Apr-2024 02:08                5771
function.nl-langinfo.php                           13-Apr-2024 02:08               16302
function.nl2br.php                                 13-Apr-2024 02:08                6998
function.number-format.php                         13-Apr-2024 02:08                8900
function.oauth-get-sbs.php                         13-Apr-2024 02:08                3147
function.oauth-urlencode.php                       13-Apr-2024 02:08                2586
function.ob-clean.php                              13-Apr-2024 02:08                3692
function.ob-end-clean.php                          13-Apr-2024 02:08                5464
function.ob-end-flush.php                          13-Apr-2024 02:08                6200
function.ob-flush.php                              13-Apr-2024 02:08                3932
function.ob-get-clean.php                          13-Apr-2024 02:08                5477
function.ob-get-contents.php                       13-Apr-2024 02:08                4863
function.ob-get-flush.php                          13-Apr-2024 02:08                5931
function.ob-get-length.php                         13-Apr-2024 02:08                4826
function.ob-get-level.php                          13-Apr-2024 02:08                2935
function.ob-get-status.php                         13-Apr-2024 02:08                7772
function.ob-gzhandler.php                          13-Apr-2024 02:08                5911
function.ob-iconv-handler.php                      13-Apr-2024 02:08                5313
function.ob-implicit-flush.php                     13-Apr-2024 02:08                4606
function.ob-list-handlers.php                      13-Apr-2024 02:08                6021
function.ob-start.php                              13-Apr-2024 02:08               17882
function.ob-tidyhandler.php                        13-Apr-2024 02:08                4528
function.oci-bind-array-by-name.php                13-Apr-2024 02:08               13920
function.oci-bind-by-name.php                      13-Apr-2024 02:08               79316
function.oci-cancel.php                            13-Apr-2024 02:08                2710
function.oci-client-version.php                    13-Apr-2024 02:08                4021
function.oci-close.php                             13-Apr-2024 02:08               18585
function.oci-commit.php                            13-Apr-2024 02:08               11034
function.oci-connect.php                           13-Apr-2024 02:08               35485
function.oci-define-by-name.php                    13-Apr-2024 02:08               23860
function.oci-error.php                             13-Apr-2024 02:08               11931
function.oci-execute.php                           13-Apr-2024 02:08               21441
function.oci-fetch-all.php                         13-Apr-2024 02:08               24774
function.oci-fetch-array.php                       13-Apr-2024 02:08               64601
function.oci-fetch-assoc.php                       13-Apr-2024 02:08                8892
function.oci-fetch-object.php                      13-Apr-2024 02:08               18294
function.oci-fetch-row.php                         13-Apr-2024 02:08                8833
function.oci-fetch.php                             13-Apr-2024 02:08               13529
function.oci-field-is-null.php                     13-Apr-2024 02:08                7889
function.oci-field-name.php                        13-Apr-2024 02:08                9831
function.oci-field-precision.php                   13-Apr-2024 02:08                8689
function.oci-field-scale.php                       13-Apr-2024 02:08                8667
function.oci-field-size.php                        13-Apr-2024 02:08               10283
function.oci-field-type-raw.php                    13-Apr-2024 02:08                7939
function.oci-field-type.php                        13-Apr-2024 02:08               10685
function.oci-free-descriptor.php                   13-Apr-2024 02:08                3550
function.oci-free-statement.php                    13-Apr-2024 02:08                2990
function.oci-get-implicit-resultset.php            13-Apr-2024 02:08               28198
function.oci-internal-debug.php                    13-Apr-2024 02:08                3084
function.oci-lob-copy.php                          13-Apr-2024 02:08                4612
function.oci-lob-is-equal.php                      13-Apr-2024 02:08                3288
function.oci-new-collection.php                    13-Apr-2024 02:08                5120
function.oci-new-connect.php                       13-Apr-2024 02:08               16743
function.oci-new-cursor.php                        13-Apr-2024 02:08                7762
function.oci-new-descriptor.php                    13-Apr-2024 02:08               18255
function.oci-num-fields.php                        13-Apr-2024 02:08                6926
function.oci-num-rows.php                          13-Apr-2024 02:08                7958
function.oci-parse.php                             13-Apr-2024 02:08               12642
function.oci-password-change.php                   13-Apr-2024 02:08               13595
function.oci-pconnect.php                          13-Apr-2024 02:08               15155
function.oci-register-taf-callback.php             13-Apr-2024 02:08                5805
function.oci-result.php                            13-Apr-2024 02:08                8671
function.oci-rollback.php                          13-Apr-2024 02:08               14357
function.oci-server-version.php                    13-Apr-2024 02:08                4776
function.oci-set-action.php                        13-Apr-2024 02:08                8454
function.oci-set-call-timout.php                   13-Apr-2024 02:08                5982
function.oci-set-client-identifier.php             13-Apr-2024 02:08                8159
function.oci-set-client-info.php                   13-Apr-2024 02:08                8376
function.oci-set-db-operation.php                  13-Apr-2024 02:08                7830
function.oci-set-edition.php                       13-Apr-2024 02:08                9761
function.oci-set-module-name.php                   13-Apr-2024 02:08                8558
function.oci-set-prefetch-lob.php                  13-Apr-2024 02:08                8870
function.oci-set-prefetch.php                      13-Apr-2024 02:08               20701
function.oci-statement-type.php                    13-Apr-2024 02:08                7051
function.oci-unregister-taf-callback.php           13-Apr-2024 02:08                3656
function.ocibindbyname.php                         13-Apr-2024 02:08                1964
function.ocicancel.php                             13-Apr-2024 02:08                1906
function.ocicloselob.php                           13-Apr-2024 02:08                1905
function.ocicollappend.php                         13-Apr-2024 02:08                1970
function.ocicollassign.php                         13-Apr-2024 02:08                1975
function.ocicollassignelem.php                     13-Apr-2024 02:08                2020
function.ocicollgetelem.php                        13-Apr-2024 02:08                1987
function.ocicollmax.php                            13-Apr-2024 02:08                1939
function.ocicollsize.php                           13-Apr-2024 02:08                1942
function.ocicolltrim.php                           13-Apr-2024 02:08                1952
function.ocicolumnisnull.php                       13-Apr-2024 02:08                1976
function.ocicolumnname.php                         13-Apr-2024 02:08                1968
function.ocicolumnprecision.php                    13-Apr-2024 02:08                2011
function.ocicolumnscale.php                        13-Apr-2024 02:08                1975
function.ocicolumnsize.php                         13-Apr-2024 02:08                1956
function.ocicolumntype.php                         13-Apr-2024 02:08                1960
function.ocicolumntyperaw.php                      13-Apr-2024 02:08                1983
function.ocicommit.php                             13-Apr-2024 02:08                1920
function.ocidefinebyname.php                       13-Apr-2024 02:08                1966
function.ocierror.php                              13-Apr-2024 02:08                1897
function.ociexecute.php                            13-Apr-2024 02:08                1901
function.ocifetch.php                              13-Apr-2024 02:08                1891
function.ocifetchinto.php                          13-Apr-2024 02:08                2632
function.ocifetchstatement.php                     13-Apr-2024 02:08                1984
function.ocifreecollection.php                     13-Apr-2024 02:08                2002
function.ocifreecursor.php                         13-Apr-2024 02:08                1974
function.ocifreedesc.php                           13-Apr-2024 02:08                1918
function.ocifreestatement.php                      13-Apr-2024 02:08                1993
function.ociinternaldebug.php                      13-Apr-2024 02:08                2007
function.ociloadlob.php                            13-Apr-2024 02:08                1903
function.ocilogoff.php                             13-Apr-2024 02:08                1890
function.ocilogon.php                              13-Apr-2024 02:08                1905
function.ocinewcollection.php                      13-Apr-2024 02:08                1991
function.ocinewcursor.php                          13-Apr-2024 02:08                1959
function.ocinewdescriptor.php                      13-Apr-2024 02:08                1981
function.ocinlogon.php                             13-Apr-2024 02:08                1930
function.ocinumcols.php                            13-Apr-2024 02:08                1915
function.ociparse.php                              13-Apr-2024 02:08                1885
function.ociplogon.php                             13-Apr-2024 02:08                1900
function.ociresult.php                             13-Apr-2024 02:08                1898
function.ocirollback.php                           13-Apr-2024 02:08                1920
function.ocirowcount.php                           13-Apr-2024 02:08                1922
function.ocisavelob.php                            13-Apr-2024 02:08                1903
function.ocisavelobfile.php                        13-Apr-2024 02:08                1941
function.ociserverversion.php                      13-Apr-2024 02:08                1995
function.ocisetprefetch.php                        13-Apr-2024 02:08                1981
function.ocistatementtype.php                      13-Apr-2024 02:08                2001
function.ociwritelobtofile.php                     13-Apr-2024 02:08                1982
function.ociwritetemporarylob.php                  13-Apr-2024 02:08                2005
function.octdec.php                                13-Apr-2024 02:08                5871
function.odbc-autocommit.php                       13-Apr-2024 02:08                4690
function.odbc-binmode.php                          13-Apr-2024 02:08                7928
function.odbc-close-all.php                        13-Apr-2024 02:08                2645
function.odbc-close.php                            13-Apr-2024 02:08                2947
function.odbc-columnprivileges.php                 13-Apr-2024 02:08                8653
function.odbc-columns.php                          13-Apr-2024 02:08               11375
function.odbc-commit.php                           13-Apr-2024 02:08                2775
function.odbc-connect.php                          13-Apr-2024 02:08                9220
function.odbc-connection-string-is-quoted.php      13-Apr-2024 02:08                3702
function.odbc-connection-string-quote.php          13-Apr-2024 02:08                5758
function.odbc-connection-string-should-quote.php   13-Apr-2024 02:08                3966
function.odbc-cursor.php                           13-Apr-2024 02:08                2737
function.odbc-data-source.php                      13-Apr-2024 02:08                5907
function.odbc-do.php                               13-Apr-2024 02:08                1671
function.odbc-error.php                            13-Apr-2024 02:08                4338
function.odbc-errormsg.php                         13-Apr-2024 02:08                4446
function.odbc-exec.php                             13-Apr-2024 02:08                4164
function.odbc-execute.php                          13-Apr-2024 02:08                7180
function.odbc-fetch-array.php                      13-Apr-2024 02:08                4407
function.odbc-fetch-into.php                       13-Apr-2024 02:08                5297
function.odbc-fetch-object.php                     13-Apr-2024 02:08                4544
function.odbc-fetch-row.php                        13-Apr-2024 02:08                4757
function.odbc-field-len.php                        13-Apr-2024 02:08                3601
function.odbc-field-name.php                       13-Apr-2024 02:08                3227
function.odbc-field-num.php                        13-Apr-2024 02:08                3229
function.odbc-field-precision.php                  13-Apr-2024 02:08                2179
function.odbc-field-scale.php                      13-Apr-2024 02:08                3241
function.odbc-field-type.php                       13-Apr-2024 02:08                3223
function.odbc-foreignkeys.php                      13-Apr-2024 02:08                8982
function.odbc-free-result.php                      13-Apr-2024 02:08                3519
function.odbc-gettypeinfo.php                      13-Apr-2024 02:08                4709
function.odbc-longreadlen.php                      13-Apr-2024 02:08                4114
function.odbc-next-result.php                      13-Apr-2024 02:08                9310
function.odbc-num-fields.php                       13-Apr-2024 02:08                2733
function.odbc-num-rows.php                         13-Apr-2024 02:08                3330
function.odbc-pconnect.php                         13-Apr-2024 02:08                4921
function.odbc-prepare.php                          13-Apr-2024 02:08                6612
function.odbc-primarykeys.php                      13-Apr-2024 02:08                7963
function.odbc-procedurecolumns.php                 13-Apr-2024 02:08               11902
function.odbc-procedures.php                       13-Apr-2024 02:08                9675
function.odbc-result-all.php                       13-Apr-2024 02:08                4196
function.odbc-result.php                           13-Apr-2024 02:08                5657
function.odbc-rollback.php                         13-Apr-2024 02:08                2816
function.odbc-setoption.php                        13-Apr-2024 02:08                7233
function.odbc-specialcolumns.php                   13-Apr-2024 02:08                7854
function.odbc-statistics.php                       13-Apr-2024 02:08               10080
function.odbc-tableprivileges.php                  13-Apr-2024 02:08                8239
function.odbc-tables.php                           13-Apr-2024 02:08               12772
function.opcache-compile-file.php                  13-Apr-2024 02:08                3886
function.opcache-get-configuration.php             13-Apr-2024 02:08                3304
function.opcache-get-status.php                    13-Apr-2024 02:08                3860
function.opcache-invalidate.php                    13-Apr-2024 02:08                4389
function.opcache-is-script-cached.php              13-Apr-2024 02:08                3443
function.opcache-reset.php                         13-Apr-2024 02:08                3388
function.openal-buffer-create.php                  13-Apr-2024 02:08                2885
function.openal-buffer-data.php                    13-Apr-2024 02:08                5015
function.openal-buffer-destroy.php                 13-Apr-2024 02:08                3209
function.openal-buffer-get.php                     13-Apr-2024 02:08                4010
function.openal-buffer-loadwav.php                 13-Apr-2024 02:08                3750
function.openal-context-create.php                 13-Apr-2024 02:08                3395
function.openal-context-current.php                13-Apr-2024 02:08                3264
function.openal-context-destroy.php                13-Apr-2024 02:08                3250
function.openal-context-process.php                13-Apr-2024 02:08                3638
function.openal-context-suspend.php                13-Apr-2024 02:08                3632
function.openal-device-close.php                   13-Apr-2024 02:08                3216
function.openal-device-open.php                    13-Apr-2024 02:08                3388
function.openal-listener-get.php                   13-Apr-2024 02:08                3446
function.openal-listener-set.php                   13-Apr-2024 02:08                3846
function.openal-source-create.php                  13-Apr-2024 02:08                3076
function.openal-source-destroy.php                 13-Apr-2024 02:08                3217
function.openal-source-get.php                     13-Apr-2024 02:08                5636
function.openal-source-pause.php                   13-Apr-2024 02:08                3518
function.openal-source-play.php                    13-Apr-2024 02:08                3517
function.openal-source-rewind.php                  13-Apr-2024 02:08                3527
function.openal-source-set.php                     13-Apr-2024 02:08                6376
function.openal-source-stop.php                    13-Apr-2024 02:08                3499
function.openal-stream.php                         13-Apr-2024 02:08                4444
function.opendir.php                               13-Apr-2024 02:08                8561
function.openlog.php                               13-Apr-2024 02:08               10188
function.openssl-cipher-iv-length.php              13-Apr-2024 02:08                4524
function.openssl-cipher-key-length.php             13-Apr-2024 02:08                4453
function.openssl-cms-decrypt.php                   13-Apr-2024 02:08                5538
function.openssl-cms-encrypt.php                   13-Apr-2024 02:08                6718
function.openssl-cms-read.php                      13-Apr-2024 02:08                3294
function.openssl-cms-sign.php                      13-Apr-2024 02:08                8168
function.openssl-cms-verify.php                    13-Apr-2024 02:08                7315
function.openssl-csr-export-to-file.php            13-Apr-2024 02:08                8598
function.openssl-csr-export.php                    13-Apr-2024 02:08                8555
function.openssl-csr-get-public-key.php            13-Apr-2024 02:08                9010
function.openssl-csr-get-subject.php               13-Apr-2024 02:08                9724
function.openssl-csr-new.php                       13-Apr-2024 02:08               21952
function.openssl-csr-sign.php                      13-Apr-2024 02:08               12994
function.openssl-decrypt.php                       13-Apr-2024 02:08                8530
function.openssl-dh-compute-key.php                13-Apr-2024 02:08               16761
function.openssl-digest.php                        13-Apr-2024 02:08                4790
function.openssl-encrypt.php                       13-Apr-2024 02:08               18688
function.openssl-error-string.php                  13-Apr-2024 02:08                3778
function.openssl-free-key.php                      13-Apr-2024 02:08                3724
function.openssl-get-cert-locations.php            13-Apr-2024 02:08                4075
function.openssl-get-cipher-methods.php            13-Apr-2024 02:08               13985
function.openssl-get-curve-names.php               13-Apr-2024 02:08                7206
function.openssl-get-md-methods.php                13-Apr-2024 02:08                6985
function.openssl-get-privatekey.php                13-Apr-2024 02:08                1898
function.openssl-get-publickey.php                 13-Apr-2024 02:08                1869
function.openssl-open.php                          13-Apr-2024 02:08               10320
function.openssl-pbkdf2.php                        13-Apr-2024 02:08                7625
function.openssl-pkcs12-export-to-file.php         13-Apr-2024 02:08                7450
function.openssl-pkcs12-export.php                 13-Apr-2024 02:08                7498
function.openssl-pkcs12-read.php                   13-Apr-2024 02:08                5673
function.openssl-pkcs7-decrypt.php                 13-Apr-2024 02:08                7656
function.openssl-pkcs7-encrypt.php                 13-Apr-2024 02:08               10788
function.openssl-pkcs7-read.php                    13-Apr-2024 02:08                6993
function.openssl-pkcs7-sign.php                    13-Apr-2024 02:08               11843
function.openssl-pkcs7-verify.php                  13-Apr-2024 02:08                8327
function.openssl-pkey-derive.php                   13-Apr-2024 02:08                8141
function.openssl-pkey-export-to-file.php           13-Apr-2024 02:08                6471
function.openssl-pkey-export.php                   13-Apr-2024 02:08                6422
function.openssl-pkey-free.php                     13-Apr-2024 02:08                4214
function.openssl-pkey-get-details.php              13-Apr-2024 02:08                9776
function.openssl-pkey-get-private.php              13-Apr-2024 02:08                6108
function.openssl-pkey-get-public.php               13-Apr-2024 02:08                5354
function.openssl-pkey-new.php                      13-Apr-2024 02:08                6816
function.openssl-private-decrypt.php               13-Apr-2024 02:08                6894
function.openssl-private-encrypt.php               13-Apr-2024 02:08                6685
function.openssl-public-decrypt.php                13-Apr-2024 02:08                6666
function.openssl-public-encrypt.php                13-Apr-2024 02:08                7032
function.openssl-random-pseudo-bytes.php           13-Apr-2024 02:08                9313
function.openssl-seal.php                          13-Apr-2024 02:08               11935
function.openssl-sign.php                          13-Apr-2024 02:08               12697
function.openssl-spki-export-challenge.php         13-Apr-2024 02:08                7702
function.openssl-spki-export.php                   13-Apr-2024 02:08                8511
function.openssl-spki-new.php                      13-Apr-2024 02:08                9317
function.openssl-spki-verify.php                   13-Apr-2024 02:08                7890
function.openssl-verify.php                        13-Apr-2024 02:08               13149
function.openssl-x509-check-private-key.php        13-Apr-2024 02:08                5826
function.openssl-x509-checkpurpose.php             13-Apr-2024 02:08                7662
function.openssl-x509-export-to-file.php           13-Apr-2024 02:08                5164
function.openssl-x509-export.php                   13-Apr-2024 02:08                5140
function.openssl-x509-fingerprint.php              13-Apr-2024 02:08                5466
function.openssl-x509-free.php                     13-Apr-2024 02:08                4220
function.openssl-x509-parse.php                    13-Apr-2024 02:08                4597
function.openssl-x509-read.php                     13-Apr-2024 02:08                4487
function.openssl-x509-verify.php                   13-Apr-2024 02:08               12565
function.ord.php                                   13-Apr-2024 02:08                7040
function.output-add-rewrite-var.php                13-Apr-2024 02:08                8569
function.output-reset-rewrite-vars.php             13-Apr-2024 02:08                6776
function.pack.php                                  13-Apr-2024 02:08               13967
function.parse-ini-file.php                        13-Apr-2024 02:08               21063
function.parse-ini-string.php                      13-Apr-2024 02:08                7618
function.parse-str.php                             13-Apr-2024 02:08                9955
function.parse-url.php                             13-Apr-2024 02:08               16614
function.passthru.php                              13-Apr-2024 02:08                7717
function.password-algos.php                        13-Apr-2024 02:08                3292
function.password-get-info.php                     13-Apr-2024 02:08                3493
function.password-hash.php                         13-Apr-2024 02:08               23311
function.password-needs-rehash.php                 13-Apr-2024 02:08                8052
function.password-verify.php                       13-Apr-2024 02:08                6849
function.pathinfo.php                              13-Apr-2024 02:08               14607
function.pclose.php                                13-Apr-2024 02:08                4914
function.pcntl-alarm.php                           13-Apr-2024 02:08                3026
function.pcntl-async-signals.php                   13-Apr-2024 02:08                4376
function.pcntl-errno.php                           13-Apr-2024 02:08                1782
function.pcntl-exec.php                            13-Apr-2024 02:08                3809
function.pcntl-fork.php                            13-Apr-2024 02:08                4901
function.pcntl-get-last-error.php                  13-Apr-2024 02:08                2831
function.pcntl-getpriority.php                     13-Apr-2024 02:08                6026
function.pcntl-rfork.php                           13-Apr-2024 02:08                7791
function.pcntl-setpriority.php                     13-Apr-2024 02:08                5805
function.pcntl-signal-dispatch.php                 13-Apr-2024 02:08                5707
function.pcntl-signal-get-handler.php              13-Apr-2024 02:08                6870
function.pcntl-signal.php                          13-Apr-2024 02:08               11291
function.pcntl-sigprocmask.php                     13-Apr-2024 02:08                6094
function.pcntl-sigtimedwait.php                    13-Apr-2024 02:08                4964
function.pcntl-sigwaitinfo.php                     13-Apr-2024 02:08                7557
function.pcntl-strerror.php                        13-Apr-2024 02:08                3063
function.pcntl-unshare.php                         13-Apr-2024 02:08                4682
function.pcntl-wait.php                            13-Apr-2024 02:08                8214
function.pcntl-waitpid.php                         13-Apr-2024 02:08                9458
function.pcntl-wexitstatus.php                     13-Apr-2024 02:08                3956
function.pcntl-wifexited.php                       13-Apr-2024 02:08                3696
function.pcntl-wifsignaled.php                     13-Apr-2024 02:08                3644
function.pcntl-wifstopped.php                      13-Apr-2024 02:08                3642
function.pcntl-wstopsig.php                        13-Apr-2024 02:08                3913
function.pcntl-wtermsig.php                        13-Apr-2024 02:08                4111
function.pfsockopen.php                            13-Apr-2024 02:08                5795
function.pg-affected-rows.php                      13-Apr-2024 02:08                6776
function.pg-cancel-query.php                       13-Apr-2024 02:08                7391
function.pg-client-encoding.php                    13-Apr-2024 02:08                6865
function.pg-close.php                              13-Apr-2024 02:08                6951
function.pg-connect-poll.php                       13-Apr-2024 02:08                4039
function.pg-connect.php                            13-Apr-2024 02:08               11083
function.pg-connection-busy.php                    13-Apr-2024 02:08                5667
function.pg-connection-reset.php                   13-Apr-2024 02:08                5677
function.pg-connection-status.php                  13-Apr-2024 02:08                5481
function.pg-consume-input.php                      13-Apr-2024 02:08                3579
function.pg-convert.php                            13-Apr-2024 02:08                9800
function.pg-copy-from.php                          13-Apr-2024 02:08                8051
function.pg-copy-to.php                            13-Apr-2024 02:08                7405
function.pg-dbname.php                             13-Apr-2024 02:08                5379
function.pg-delete.php                             13-Apr-2024 02:08                9776
function.pg-end-copy.php                           13-Apr-2024 02:08                7404
function.pg-escape-bytea.php                       13-Apr-2024 02:08                7851
function.pg-escape-identifier.php                  13-Apr-2024 02:08                7845
function.pg-escape-literal.php                     13-Apr-2024 02:08                8210
function.pg-escape-string.php                      13-Apr-2024 02:08                7725
function.pg-execute.php                            13-Apr-2024 02:08               10338
function.pg-fetch-all-columns.php                  13-Apr-2024 02:08                7061
function.pg-fetch-all.php                          13-Apr-2024 02:08                9146
function.pg-fetch-array.php                        13-Apr-2024 02:08               12709
function.pg-fetch-assoc.php                        13-Apr-2024 02:08                9457
function.pg-fetch-object.php                       13-Apr-2024 02:08               11857
function.pg-fetch-result.php                       13-Apr-2024 02:08                9374
function.pg-fetch-row.php                          13-Apr-2024 02:08                9821
function.pg-field-is-null.php                      13-Apr-2024 02:08                8497
function.pg-field-name.php                         13-Apr-2024 02:08                8945
function.pg-field-num.php                          13-Apr-2024 02:08                6535
function.pg-field-prtlen.php                       13-Apr-2024 02:08               10872
function.pg-field-size.php                         13-Apr-2024 02:08                9175
function.pg-field-table.php                        13-Apr-2024 02:08                8695
function.pg-field-type-oid.php                     13-Apr-2024 02:08                7449
function.pg-field-type.php                         13-Apr-2024 02:08                7246
function.pg-flush.php                              13-Apr-2024 02:08                3601
function.pg-free-result.php                        13-Apr-2024 02:08                7336
function.pg-get-notify.php                         13-Apr-2024 02:08                7380
function.pg-get-pid.php                            13-Apr-2024 02:08                5039
function.pg-get-result.php                         13-Apr-2024 02:08                8542
function.pg-host.php                               13-Apr-2024 02:08                6397
function.pg-insert.php                             13-Apr-2024 02:08               11632
function.pg-last-error.php                         13-Apr-2024 02:08                7459
function.pg-last-notice.php                        13-Apr-2024 02:08                8343
function.pg-last-oid.php                           13-Apr-2024 02:08                7569
function.pg-lo-close.php                           13-Apr-2024 02:08                7153
function.pg-lo-create.php                          13-Apr-2024 02:08                8684
function.pg-lo-export.php                          13-Apr-2024 02:08                8245
function.pg-lo-import.php                          13-Apr-2024 02:08                7493
function.pg-lo-open.php                            13-Apr-2024 02:08                9063
function.pg-lo-read-all.php                        13-Apr-2024 02:08                6367
function.pg-lo-read.php                            13-Apr-2024 02:08                7140
function.pg-lo-seek.php                            13-Apr-2024 02:08                7956
function.pg-lo-tell.php                            13-Apr-2024 02:08                6907
function.pg-lo-truncate.php                        13-Apr-2024 02:08                6641
function.pg-lo-unlink.php                          13-Apr-2024 02:08                7246
function.pg-lo-write.php                           13-Apr-2024 02:08                8237
function.pg-meta-data.php                          13-Apr-2024 02:08                7496
function.pg-num-fields.php                         13-Apr-2024 02:08                5963
function.pg-num-rows.php                           13-Apr-2024 02:08                5936
function.pg-options.php                            13-Apr-2024 02:08                5726
function.pg-parameter-status.php                   13-Apr-2024 02:08                8508
function.pg-pconnect.php                           13-Apr-2024 02:08                9788
function.pg-ping.php                               13-Apr-2024 02:08                6144
function.pg-port.php                               13-Apr-2024 02:08                5894
function.pg-prepare.php                            13-Apr-2024 02:08               10301
function.pg-put-line.php                           13-Apr-2024 02:08                8760
function.pg-query-params.php                       13-Apr-2024 02:08               10786
function.pg-query.php                              13-Apr-2024 02:08               12261
function.pg-result-error-field.php                 13-Apr-2024 02:08                9696
function.pg-result-error.php                       13-Apr-2024 02:08                8096
function.pg-result-seek.php                        13-Apr-2024 02:08                7296
function.pg-result-status.php                      13-Apr-2024 02:08                8673
function.pg-select.php                             13-Apr-2024 02:08               12180
function.pg-send-execute.php                       13-Apr-2024 02:08               10343
function.pg-send-prepare.php                       13-Apr-2024 02:08               10791
function.pg-send-query-params.php                  13-Apr-2024 02:08                8020
function.pg-send-query.php                         13-Apr-2024 02:08                9734
function.pg-set-client-encoding.php                13-Apr-2024 02:08                8849
function.pg-set-error-context-visibility.php       13-Apr-2024 02:08                6966
function.pg-set-error-verbosity.php                13-Apr-2024 02:08                8994
function.pg-socket.php                             13-Apr-2024 02:08                3743
function.pg-trace.php                              13-Apr-2024 02:08                9270
function.pg-transaction-status.php                 13-Apr-2024 02:08                6558
function.pg-tty.php                                13-Apr-2024 02:08                6186
function.pg-unescape-bytea.php                     13-Apr-2024 02:08                6314
function.pg-untrace.php                            13-Apr-2024 02:08                6815
function.pg-update.php                             13-Apr-2024 02:08               10742
function.pg-version.php                            13-Apr-2024 02:08                6582
function.php-ini-loaded-file.php                   13-Apr-2024 02:08                4704
function.php-ini-scanned-files.php                 13-Apr-2024 02:08                6462
function.php-sapi-name.php                         13-Apr-2024 02:08                5970
function.php-strip-whitespace.php                  13-Apr-2024 02:08                4836
function.php-uname.php                             13-Apr-2024 02:08                9312
function.phpcredits.php                            13-Apr-2024 02:08                8971
function.phpdbg-break-file.php                     13-Apr-2024 02:08                3738
function.phpdbg-break-function.php                 13-Apr-2024 02:08                3472
function.phpdbg-break-method.php                   13-Apr-2024 02:08                3806
function.phpdbg-break-next.php                     13-Apr-2024 02:08                3120
function.phpdbg-clear.php                          13-Apr-2024 02:08                3386
function.phpdbg-color.php                          13-Apr-2024 02:08                3672
function.phpdbg-end-oplog.php                      13-Apr-2024 02:08                2619
function.phpdbg-exec.php                           13-Apr-2024 02:08                3109
function.phpdbg-get-executable.php                 13-Apr-2024 02:08                2562
function.phpdbg-prompt.php                         13-Apr-2024 02:08                2815
function.phpdbg-start-oplog.php                    13-Apr-2024 02:08                2273
function.phpinfo.php                               13-Apr-2024 02:08                9726
function.phpversion.php                            13-Apr-2024 02:08               10879
function.pi.php                                    13-Apr-2024 02:08                3032
function.png2wbmp.php                              13-Apr-2024 02:08                6823
function.popen.php                                 13-Apr-2024 02:08                8616
function.pos.php                                   13-Apr-2024 02:08                1599
function.posix-access.php                          13-Apr-2024 02:08                6828
function.posix-ctermid.php                         13-Apr-2024 02:08                4348
function.posix-eaccess.php                         13-Apr-2024 02:08                7588
function.posix-errno.php                           13-Apr-2024 02:08                1768
function.posix-fpathconf.php                       13-Apr-2024 02:08                6369
function.posix-get-last-error.php                  13-Apr-2024 02:08                4121
function.posix-getcwd.php                          13-Apr-2024 02:08                4240
function.posix-getegid.php                         13-Apr-2024 02:08                5285
function.posix-geteuid.php                         13-Apr-2024 02:08                5310
function.posix-getgid.php                          13-Apr-2024 02:08                4686
function.posix-getgrgid.php                        13-Apr-2024 02:08                6265
function.posix-getgrnam.php                        13-Apr-2024 02:08                6048
function.posix-getgroups.php                       13-Apr-2024 02:08                4232
function.posix-getlogin.php                        13-Apr-2024 02:08                3670
function.posix-getpgid.php                         13-Apr-2024 02:08                4552
function.posix-getpgrp.php                         13-Apr-2024 02:08                2520
function.posix-getpid.php                          13-Apr-2024 02:08                3305
function.posix-getppid.php                         13-Apr-2024 02:08                2909
function.posix-getpwnam.php                        13-Apr-2024 02:08                6726
function.posix-getpwuid.php                        13-Apr-2024 02:08                6756
function.posix-getrlimit.php                       13-Apr-2024 02:08                7179
function.posix-getsid.php                          13-Apr-2024 02:08                4814
function.posix-getuid.php                          13-Apr-2024 02:08                3386
function.posix-initgroups.php                      13-Apr-2024 02:08                3327
function.posix-isatty.php                          13-Apr-2024 02:08                3883
function.posix-kill.php                            13-Apr-2024 02:08                3426
function.posix-mkfifo.php                          13-Apr-2024 02:08                3415
function.posix-mknod.php                           13-Apr-2024 02:08                7505
function.posix-pathconf.php                        13-Apr-2024 02:08                5742
function.posix-setegid.php                         13-Apr-2024 02:08                5145
function.posix-seteuid.php                         13-Apr-2024 02:08                3595
function.posix-setgid.php                          13-Apr-2024 02:08                5373
function.posix-setpgid.php                         13-Apr-2024 02:08                3500
function.posix-setrlimit.php                       13-Apr-2024 02:08                4634
function.posix-setsid.php                          13-Apr-2024 02:08                2581
function.posix-setuid.php                          13-Apr-2024 02:08                5617
function.posix-strerror.php                        13-Apr-2024 02:08                4829
function.posix-sysconf.php                         13-Apr-2024 02:08                3740
function.posix-times.php                           13-Apr-2024 02:08                4984
function.posix-ttyname.php                         13-Apr-2024 02:08                3404
function.posix-uname.php                           13-Apr-2024 02:08                5161
function.pow.php                                   13-Apr-2024 02:08                6780
function.preg-filter.php                           13-Apr-2024 02:08               10092
function.preg-grep.php                             13-Apr-2024 02:08                6099
function.preg-last-error-msg.php                   13-Apr-2024 02:08                4093
function.preg-last-error.php                       13-Apr-2024 02:08                5279
function.preg-match-all.php                        13-Apr-2024 02:08               25886
function.preg-match.php                            13-Apr-2024 02:08               23543
function.preg-quote.php                            13-Apr-2024 02:08                9121
function.preg-replace-callback-array.php           13-Apr-2024 02:08               10748
function.preg-replace-callback.php                 13-Apr-2024 02:08               17717
function.preg-replace.php                          13-Apr-2024 02:08               25180
function.preg-split.php                            13-Apr-2024 02:08               12856
function.prev.php                                  13-Apr-2024 02:08                9058
function.print-r.php                               13-Apr-2024 02:08                9685
function.print.php                                 13-Apr-2024 02:08               17655
function.printf.php                                13-Apr-2024 02:08               28503
function.proc-close.php                            13-Apr-2024 02:08                3415
function.proc-get-status.php                       13-Apr-2024 02:08                6714
function.proc-nice.php                             13-Apr-2024 02:08                7809
function.proc-open.php                             13-Apr-2024 02:08               22829
function.proc-terminate.php                        13-Apr-2024 02:08                4782
function.property-exists.php                       13-Apr-2024 02:08                8717
function.ps-add-bookmark.php                       13-Apr-2024 02:08                5110
function.ps-add-launchlink.php                     13-Apr-2024 02:08                5828
function.ps-add-locallink.php                      13-Apr-2024 02:08                6612
function.ps-add-note.php                           13-Apr-2024 02:08                7338
function.ps-add-pdflink.php                        13-Apr-2024 02:08                6985
function.ps-add-weblink.php                        13-Apr-2024 02:08                5914
function.ps-arc.php                                13-Apr-2024 02:08                5332
function.ps-arcn.php                               13-Apr-2024 02:08                5338
function.ps-begin-page.php                         13-Apr-2024 02:08                6998
function.ps-begin-pattern.php                      13-Apr-2024 02:08               13427
function.ps-begin-template.php                     13-Apr-2024 02:08               11410
function.ps-circle.php                             13-Apr-2024 02:08                4851
function.ps-clip.php                               13-Apr-2024 02:08                3130
function.ps-close-image.php                        13-Apr-2024 02:08                4026
function.ps-close.php                              13-Apr-2024 02:08                3768
function.ps-closepath-stroke.php                   13-Apr-2024 02:08                3203
function.ps-closepath.php                          13-Apr-2024 02:08                3364
function.ps-continue-text.php                      13-Apr-2024 02:08                4176
function.ps-curveto.php                            13-Apr-2024 02:08                5207
function.ps-delete.php                             13-Apr-2024 02:08                3647
function.ps-end-page.php                           13-Apr-2024 02:08                3373
function.ps-end-pattern.php                        13-Apr-2024 02:08                3304
function.ps-end-template.php                       13-Apr-2024 02:08                3311
function.ps-fill-stroke.php                        13-Apr-2024 02:08                3409
function.ps-fill.php                               13-Apr-2024 02:08                3342
function.ps-findfont.php                           13-Apr-2024 02:08                7212
function.ps-get-buffer.php                         13-Apr-2024 02:08                3255
function.ps-get-parameter.php                      13-Apr-2024 02:08                7994
function.ps-get-value.php                          13-Apr-2024 02:08                9495
function.ps-hyphenate.php                          13-Apr-2024 02:08                7295
function.ps-include-file.php                       13-Apr-2024 02:08                3209
function.ps-lineto.php                             13-Apr-2024 02:08                8326
function.ps-makespotcolor.php                      13-Apr-2024 02:08               10229
function.ps-moveto.php                             13-Apr-2024 02:08                3941
function.ps-new.php                                13-Apr-2024 02:08                3074
function.ps-open-file.php                          13-Apr-2024 02:08                3782
function.ps-open-image-file.php                    13-Apr-2024 02:08                4987
function.ps-open-image.php                         13-Apr-2024 02:08                7074
function.ps-open-memory-image.php                  13-Apr-2024 02:08                2878
function.ps-place-image.php                        13-Apr-2024 02:08                5342
function.ps-rect.php                               13-Apr-2024 02:08                5062
function.ps-restore.php                            13-Apr-2024 02:08                3486
function.ps-rotate.php                             13-Apr-2024 02:08               12197
function.ps-save.php                               13-Apr-2024 02:08                3233
function.ps-scale.php                              13-Apr-2024 02:08                3850
function.ps-set-border-color.php                   13-Apr-2024 02:08                4968
function.ps-set-border-dash.php                    13-Apr-2024 02:08                4556
function.ps-set-border-style.php                   13-Apr-2024 02:08                4620
function.ps-set-info.php                           13-Apr-2024 02:08                6097
function.ps-set-parameter.php                      13-Apr-2024 02:08                4030
function.ps-set-text-pos.php                       13-Apr-2024 02:08                9403
function.ps-set-value.php                          13-Apr-2024 02:08                4842
function.ps-setcolor.php                           13-Apr-2024 02:08                6038
function.ps-setdash.php                            13-Apr-2024 02:08                3737
function.ps-setflat.php                            13-Apr-2024 02:08                3196
function.ps-setfont.php                            13-Apr-2024 02:08                4155
function.ps-setgray.php                            13-Apr-2024 02:08                3410
function.ps-setlinecap.php                         13-Apr-2024 02:08                3936
function.ps-setlinejoin.php                        13-Apr-2024 02:08                3954
function.ps-setlinewidth.php                       13-Apr-2024 02:08                3818
function.ps-setmiterlimit.php                      13-Apr-2024 02:08                4238
function.ps-setoverprintmode.php                   13-Apr-2024 02:08                3233
function.ps-setpolydash.php                        13-Apr-2024 02:08                7822
function.ps-shading-pattern.php                    13-Apr-2024 02:08                4345
function.ps-shading.php                            13-Apr-2024 02:08                7280
function.ps-shfill.php                             13-Apr-2024 02:08                4059
function.ps-show-boxed.php                         13-Apr-2024 02:08               12815
function.ps-show-xy.php                            13-Apr-2024 02:08                4338
function.ps-show-xy2.php                           13-Apr-2024 02:08                3191
function.ps-show.php                               13-Apr-2024 02:08                5843
function.ps-show2.php                              13-Apr-2024 02:08                3398
function.ps-string-geometry.php                    13-Apr-2024 02:08                4934
function.ps-stringwidth.php                        13-Apr-2024 02:08                4411
function.ps-stroke.php                             13-Apr-2024 02:08                3539
function.ps-symbol-name.php                        13-Apr-2024 02:08                3939
function.ps-symbol-width.php                       13-Apr-2024 02:08                4483
function.ps-symbol.php                             13-Apr-2024 02:08                3805
function.ps-translate.php                          13-Apr-2024 02:08               14216
function.pspell-add-to-personal.php                13-Apr-2024 02:08                6460
function.pspell-add-to-session.php                 13-Apr-2024 02:08                4107
function.pspell-check.php                          13-Apr-2024 02:08                5016
function.pspell-clear-session.php                  13-Apr-2024 02:08                5864
function.pspell-config-create.php                  13-Apr-2024 02:08                8028
function.pspell-config-data-dir.php                13-Apr-2024 02:08                3406
function.pspell-config-dict-dir.php                13-Apr-2024 02:08                3405
function.pspell-config-ignore.php                  13-Apr-2024 02:08                5748
function.pspell-config-mode.php                    13-Apr-2024 02:08                6592
function.pspell-config-personal.php                13-Apr-2024 02:08                6541
function.pspell-config-repl.php                    13-Apr-2024 02:08                6844
function.pspell-config-runtogether.php             13-Apr-2024 02:08                6401
function.pspell-config-save-repl.php               13-Apr-2024 02:08                5346
function.pspell-new-config.php                     13-Apr-2024 02:08                6387
function.pspell-new-personal.php                   13-Apr-2024 02:08               10981
function.pspell-new.php                            13-Apr-2024 02:08                9514
function.pspell-save-wordlist.php                  13-Apr-2024 02:08                6063
function.pspell-store-replacement.php              13-Apr-2024 02:08                7738
function.pspell-suggest.php                        13-Apr-2024 02:08                5552
function.putenv.php                                13-Apr-2024 02:08                4132
function.quoted-printable-decode.php               13-Apr-2024 02:08                5282
function.quoted-printable-encode.php               13-Apr-2024 02:08                5249
function.quotemeta.php                             13-Apr-2024 02:08                6027
function.rad2deg.php                               13-Apr-2024 02:08                3576
function.radius-acct-open.php                      13-Apr-2024 02:08                3231
function.radius-add-server.php                     13-Apr-2024 02:08                7795
function.radius-auth-open.php                      13-Apr-2024 02:08                3239
function.radius-close.php                          13-Apr-2024 02:08                2677
function.radius-config.php                         13-Apr-2024 02:08                4099
function.radius-create-request.php                 13-Apr-2024 02:08                5351
function.radius-cvt-addr.php                       13-Apr-2024 02:08                6203
function.radius-cvt-int.php                        13-Apr-2024 02:08                5603
function.radius-cvt-string.php                     13-Apr-2024 02:08                5657
function.radius-demangle-mppe-key.php              13-Apr-2024 02:08                3232
function.radius-demangle.php                       13-Apr-2024 02:08                2963
function.radius-get-attr.php                       13-Apr-2024 02:08                6457
function.radius-get-tagged-attr-data.php           13-Apr-2024 02:08                6564
function.radius-get-tagged-attr-tag.php            13-Apr-2024 02:08                6617
function.radius-get-vendor-attr.php                13-Apr-2024 02:08                8198
function.radius-put-addr.php                       13-Apr-2024 02:08                5636
function.radius-put-attr.php                       13-Apr-2024 02:08                8876
function.radius-put-int.php                        13-Apr-2024 02:08                7613
function.radius-put-string.php                     13-Apr-2024 02:08                7993
function.radius-put-vendor-addr.php                13-Apr-2024 02:08                5585
function.radius-put-vendor-attr.php                13-Apr-2024 02:08                7855
function.radius-put-vendor-int.php                 13-Apr-2024 02:08                6368
function.radius-put-vendor-string.php              13-Apr-2024 02:08                6761
function.radius-request-authenticator.php          13-Apr-2024 02:08                3165
function.radius-salt-encrypt-attr.php              13-Apr-2024 02:08                4272
function.radius-send-request.php                   13-Apr-2024 02:08                4005
function.radius-server-secret.php                  13-Apr-2024 02:08                2691
function.radius-strerror.php                       13-Apr-2024 02:08                2594
function.rand.php                                  13-Apr-2024 02:08               10254
function.random-bytes.php                          13-Apr-2024 02:08                9616
function.random-int.php                            13-Apr-2024 02:08                9487
function.range.php                                 13-Apr-2024 02:08                7957
function.rar-wrapper-cache-stats.php               13-Apr-2024 02:08                2350
function.rawurldecode.php                          13-Apr-2024 02:08                4784
function.rawurlencode.php                          13-Apr-2024 02:08                6443
function.read-exif-data.php                        13-Apr-2024 02:08                2502
function.readdir.php                               13-Apr-2024 02:08               10266
function.readfile.php                              13-Apr-2024 02:08               10148
function.readgzfile.php                            13-Apr-2024 02:08                4658
function.readline-add-history.php                  13-Apr-2024 02:08                2792
function.readline-callback-handler-install.php     13-Apr-2024 02:08                9475
function.readline-callback-handler-remove.php      13-Apr-2024 02:08                3897
function.readline-callback-read-char.php           13-Apr-2024 02:08                3814
function.readline-clear-history.php                13-Apr-2024 02:08                2522
function.readline-completion-function.php          13-Apr-2024 02:08                3057
function.readline-info.php                         13-Apr-2024 02:08                4912
function.readline-list-history.php                 13-Apr-2024 02:08                2335
function.readline-on-new-line.php                  13-Apr-2024 02:08                2671
function.readline-read-history.php                 13-Apr-2024 02:08                3496
function.readline-redisplay.php                    13-Apr-2024 02:08                2242
function.readline-write-history.php                13-Apr-2024 02:08                3452
function.readline.php                              13-Apr-2024 02:08                5142
function.readlink.php                              13-Apr-2024 02:08                4513
function.realpath-cache-get.php                    13-Apr-2024 02:08                4379
function.realpath-cache-size.php                   13-Apr-2024 02:08                3766
function.realpath.php                              13-Apr-2024 02:08                8718
function.recode-file.php                           13-Apr-2024 02:08                5642
function.recode-string.php                         13-Apr-2024 02:08                4979
function.recode.php                                13-Apr-2024 02:08                1713
function.register-shutdown-function.php            13-Apr-2024 02:08                7732
function.register-tick-function.php                13-Apr-2024 02:08                5513
function.rename.php                                13-Apr-2024 02:08                6175
function.require-once.php                          13-Apr-2024 02:08                1739
function.require.php                               13-Apr-2024 02:08                2074
function.reset.php                                 13-Apr-2024 02:08                9756
function.restore-error-handler.php                 13-Apr-2024 02:08                5819
function.restore-exception-handler.php             13-Apr-2024 02:08                6484
function.restore-include-path.php                  13-Apr-2024 02:08                5294
function.return.php                                13-Apr-2024 02:08                4918
function.rewind.php                                13-Apr-2024 02:08                6407
function.rewinddir.php                             13-Apr-2024 02:08                3587
function.rmdir.php                                 13-Apr-2024 02:08                5146
function.rnp-backend-string.php                    13-Apr-2024 02:08                2241
function.rnp-backend-version.php                   13-Apr-2024 02:08                2172
function.rnp-decrypt.php                           13-Apr-2024 02:08                3232
function.rnp-dump-packets-to-json.php              13-Apr-2024 02:08                3135
function.rnp-dump-packets.php                      13-Apr-2024 02:08                3089
function.rnp-ffi-create.php                        13-Apr-2024 02:08                3184
function.rnp-ffi-destroy.php                       13-Apr-2024 02:08                2422
function.rnp-ffi-set-pass-provider.php             13-Apr-2024 02:08                6737
function.rnp-import-keys.php                       13-Apr-2024 02:08                3484
function.rnp-import-signatures.php                 13-Apr-2024 02:08                3474
function.rnp-key-export-autocrypt.php              13-Apr-2024 02:08                4535
function.rnp-key-export-revocation.php             13-Apr-2024 02:08                5184
function.rnp-key-export.php                        13-Apr-2024 02:08                3454
function.rnp-key-get-info.php                      13-Apr-2024 02:08                7971
function.rnp-key-remove.php                        13-Apr-2024 02:08                3594
function.rnp-key-revoke.php                        13-Apr-2024 02:08                4830
function.rnp-list-keys.php                         13-Apr-2024 02:08                3137
function.rnp-load-keys-from-path.php               13-Apr-2024 02:08                3858
function.rnp-load-keys.php                         13-Apr-2024 02:08                3814
function.rnp-locate-key.php                        13-Apr-2024 02:08                3557
function.rnp-op-encrypt.php                        13-Apr-2024 02:08                7923
function.rnp-op-generate-key.php                   13-Apr-2024 02:08                7542
function.rnp-op-sign-cleartext.php                 13-Apr-2024 02:08                5192
function.rnp-op-sign-detached.php                  13-Apr-2024 02:08                5071
function.rnp-op-sign.php                           13-Apr-2024 02:08                6152
function.rnp-op-verify-detached.php                13-Apr-2024 02:08                7080
function.rnp-op-verify.php                         13-Apr-2024 02:08                6819
function.rnp-save-keys-to-path.php                 13-Apr-2024 02:08                3872
function.rnp-save-keys.php                         13-Apr-2024 02:08                3845
function.rnp-supported-features.php                13-Apr-2024 02:08                2903
function.rnp-version-string-full.php               13-Apr-2024 02:08                2257
function.rnp-version-string.php                    13-Apr-2024 02:08                2154
function.round.php                                 13-Apr-2024 02:08               23942
function.rpmaddtag.php                             13-Apr-2024 02:08                3317
function.rpmdbinfo.php                             13-Apr-2024 02:08                5199
function.rpmdbsearch.php                           13-Apr-2024 02:08                6099
function.rpmgetsymlink.php                         13-Apr-2024 02:08                2938
function.rpminfo.php                               13-Apr-2024 02:08                5381
function.rpmvercmp.php                             13-Apr-2024 02:08                4870
function.rrd-create.php                            13-Apr-2024 02:08                2933
function.rrd-error.php                             13-Apr-2024 02:08                2084
function.rrd-fetch.php                             13-Apr-2024 02:08                2916
function.rrd-first.php                             13-Apr-2024 02:08                2907
function.rrd-graph.php                             13-Apr-2024 02:08                3159
function.rrd-info.php                              13-Apr-2024 02:08                2492
function.rrd-last.php                              13-Apr-2024 02:08                2429
function.rrd-lastupdate.php                        13-Apr-2024 02:08                2622
function.rrd-restore.php                           13-Apr-2024 02:08                3317
function.rrd-tune.php                              13-Apr-2024 02:08                2999
function.rrd-update.php                            13-Apr-2024 02:08                3072
function.rrd-version.php                           13-Apr-2024 02:08                2178
function.rrd-xport.php                             13-Apr-2024 02:08                2666
function.rrdc-disconnect.php                       13-Apr-2024 02:08                2530
function.rsort.php                                 13-Apr-2024 02:08                9179
function.rtrim.php                                 13-Apr-2024 02:08                9599
function.runkit7-constant-add.php                  13-Apr-2024 02:08                4416
function.runkit7-constant-redefine.php             13-Apr-2024 02:08                4303
function.runkit7-constant-remove.php               13-Apr-2024 02:08                3621
function.runkit7-function-add.php                  13-Apr-2024 02:08                9726
function.runkit7-function-copy.php                 13-Apr-2024 02:08                5486
function.runkit7-function-redefine.php             13-Apr-2024 02:08               10186
function.runkit7-function-remove.php               13-Apr-2024 02:08                4135
function.runkit7-function-rename.php               13-Apr-2024 02:08                4412
function.runkit7-import.php                        13-Apr-2024 02:08                3809
function.runkit7-method-add.php                    13-Apr-2024 02:08               11745
function.runkit7-method-copy.php                   13-Apr-2024 02:08                7038
function.runkit7-method-redefine.php               13-Apr-2024 02:08               12181
function.runkit7-method-remove.php                 13-Apr-2024 02:08                6405
function.runkit7-method-rename.php                 13-Apr-2024 02:08                6567
function.runkit7-object-id.php                     13-Apr-2024 02:08                3734
function.runkit7-superglobals.php                  13-Apr-2024 02:08                2618
function.runkit7-zval-inspect.php                  13-Apr-2024 02:08                5085
function.sapi-windows-cp-conv.php                  13-Apr-2024 02:08                4868
function.sapi-windows-cp-get.php                   13-Apr-2024 02:08                3570
function.sapi-windows-cp-is-utf8.php               13-Apr-2024 02:08                2999
function.sapi-windows-cp-set.php                   13-Apr-2024 02:08                3140
function.sapi-windows-generate-ctrl-event.php      13-Apr-2024 02:08                7819
function.sapi-windows-set-ctrl-handler.php         13-Apr-2024 02:08                7691
function.sapi-windows-vt100-support.php            13-Apr-2024 02:08               11050
function.scandir.php                               13-Apr-2024 02:08                9054
function.scoutapm-get-calls.php                    13-Apr-2024 02:08                4441
function.scoutapm-list-instrumented-functions.php  13-Apr-2024 02:08                3776
function.seaslog-get-author.php                    13-Apr-2024 02:08                3098
function.seaslog-get-version.php                   13-Apr-2024 02:08                3094
function.sem-acquire.php                           13-Apr-2024 02:08                5276
function.sem-get.php                               13-Apr-2024 02:08                7115
function.sem-release.php                           13-Apr-2024 02:08                4290
function.sem-remove.php                            13-Apr-2024 02:08                4256
function.serialize.php                             13-Apr-2024 02:08               10740
function.session-abort.php                         13-Apr-2024 02:08                4238
function.session-cache-expire.php                  13-Apr-2024 02:08                8008
function.session-cache-limiter.php                 13-Apr-2024 02:08                9352
function.session-commit.php                        13-Apr-2024 02:08                1805
function.session-create-id.php                     13-Apr-2024 02:08               10157
function.session-decode.php                        13-Apr-2024 02:08                3832
function.session-destroy.php                       13-Apr-2024 02:08                9069
function.session-encode.php                        13-Apr-2024 02:08                3966
function.session-gc.php                            13-Apr-2024 02:08                7899
function.session-get-cookie-params.php             13-Apr-2024 02:08                5734
function.session-id.php                            13-Apr-2024 02:08                6435
function.session-module-name.php                   13-Apr-2024 02:08                4514
function.session-name.php                          13-Apr-2024 02:08                8146
function.session-regenerate-id.php                 13-Apr-2024 02:08               16142
function.session-register-shutdown.php             13-Apr-2024 02:08                2783
function.session-reset.php                         13-Apr-2024 02:08                4326
function.session-save-path.php                     13-Apr-2024 02:08                5033
function.session-set-cookie-params.php             13-Apr-2024 02:08               10796
function.session-set-save-handler.php              13-Apr-2024 02:08               24646
function.session-start.php                         13-Apr-2024 02:08               14780
function.session-status.php                        13-Apr-2024 02:08                3317
function.session-unset.php                         13-Apr-2024 02:08                4933
function.session-write-close.php                   13-Apr-2024 02:08                4254
function.set-error-handler.php                     13-Apr-2024 02:08               27532
function.set-exception-handler.php                 13-Apr-2024 02:08                7947
function.set-file-buffer.php                       13-Apr-2024 02:08                1780
function.set-include-path.php                      13-Apr-2024 02:08                6333
function.set-time-limit.php                        13-Apr-2024 02:08                4826
function.setcookie.php                             13-Apr-2024 02:08               27149
function.setlocale.php                             13-Apr-2024 02:08               15540
function.setrawcookie.php                          13-Apr-2024 02:08                6410
function.settype.php                               13-Apr-2024 02:08                6118
function.sha1-file.php                             13-Apr-2024 02:08                5697
function.sha1.php                                  13-Apr-2024 02:08                5919
function.shell-exec.php                            13-Apr-2024 02:08                5720
function.shm-attach.php                            13-Apr-2024 02:08                6006
function.shm-detach.php                            13-Apr-2024 02:08                4517
function.shm-get-var.php                           13-Apr-2024 02:08                4338
function.shm-has-var.php                           13-Apr-2024 02:08                4361
function.shm-put-var.php                           13-Apr-2024 02:08                5422
function.shm-remove-var.php                        13-Apr-2024 02:08                4260
function.shm-remove.php                            13-Apr-2024 02:08                3987
function.shmop-close.php                           13-Apr-2024 02:08                4847
function.shmop-delete.php                          13-Apr-2024 02:08                4235
function.shmop-open.php                            13-Apr-2024 02:08                9517
function.shmop-read.php                            13-Apr-2024 02:08                6712
function.shmop-size.php                            13-Apr-2024 02:08                4242
function.shmop-write.php                           13-Apr-2024 02:08                6173
function.show-source.php                           13-Apr-2024 02:08                1741
function.shuffle.php                               13-Apr-2024 02:08                6911
function.simdjson-decode.php                       13-Apr-2024 02:08               17005
function.simdjson-is-valid.php                     13-Apr-2024 02:08               10475
function.simdjson-key-count.php                    13-Apr-2024 02:08                4779
function.simdjson-key-exists.php                   13-Apr-2024 02:08                4574
function.simdjson-key-value.php                    13-Apr-2024 02:08                7329
function.similar-text.php                          13-Apr-2024 02:08                7226
function.simplexml-import-dom.php                  13-Apr-2024 02:08                6660
function.simplexml-load-file.php                   13-Apr-2024 02:08               10133
function.simplexml-load-string.php                 13-Apr-2024 02:08                9134
function.sin.php                                   13-Apr-2024 02:08                4512
function.sinh.php                                  13-Apr-2024 02:08                3156
function.sizeof.php                                13-Apr-2024 02:08                1618
function.sleep.php                                 13-Apr-2024 02:08                7421
function.snmp-get-quick-print.php                  13-Apr-2024 02:08                3681
function.snmp-get-valueretrieval.php               13-Apr-2024 02:08                4430
function.snmp-read-mib.php                         13-Apr-2024 02:08                4859
function.snmp-set-enum-print.php                   13-Apr-2024 02:08                5335
function.snmp-set-oid-numeric-print.php            13-Apr-2024 02:08                2303
function.snmp-set-oid-output-format.php            13-Apr-2024 02:08                7765
function.snmp-set-quick-print.php                  13-Apr-2024 02:08                7199
function.snmp-set-valueretrieval.php               13-Apr-2024 02:08                9484
function.snmp2-get.php                             13-Apr-2024 02:08                5773
function.snmp2-getnext.php                         13-Apr-2024 02:08                6141
function.snmp2-real-walk.php                       13-Apr-2024 02:08                6580
function.snmp2-set.php                             13-Apr-2024 02:08               10953
function.snmp2-walk.php                            13-Apr-2024 02:08                7065
function.snmp3-get.php                             13-Apr-2024 02:08                8876
function.snmp3-getnext.php                         13-Apr-2024 02:08                9204
function.snmp3-real-walk.php                       13-Apr-2024 02:08                9889
function.snmp3-set.php                             13-Apr-2024 02:08               13723
function.snmp3-walk.php                            13-Apr-2024 02:08               10349
function.snmpget.php                               13-Apr-2024 02:08                5767
function.snmpgetnext.php                           13-Apr-2024 02:08                6016
function.snmprealwalk.php                          13-Apr-2024 02:08                6450
function.snmpset.php                               13-Apr-2024 02:08               10984
function.snmpwalk.php                              13-Apr-2024 02:08                7086
function.snmpwalkoid.php                           13-Apr-2024 02:08                7746
function.socket-accept.php                         13-Apr-2024 02:08                6875
function.socket-addrinfo-bind.php                  13-Apr-2024 02:08                5426
function.socket-addrinfo-connect.php               13-Apr-2024 02:08                5218
function.socket-addrinfo-explain.php               13-Apr-2024 02:08                4458
function.socket-addrinfo-lookup.php                13-Apr-2024 02:08                6055
function.socket-atmark.php                         13-Apr-2024 02:08                4982
function.socket-bind.php                           13-Apr-2024 02:08               11567
function.socket-clear-error.php                    13-Apr-2024 02:08                4806
function.socket-close.php                          13-Apr-2024 02:08                4431
function.socket-cmsg-space.php                     13-Apr-2024 02:08                3745
function.socket-connect.php                        13-Apr-2024 02:08                7496
function.socket-create-listen.php                  13-Apr-2024 02:08                7157
function.socket-create-pair.php                    13-Apr-2024 02:08               20018
function.socket-create.php                         13-Apr-2024 02:08               12373
function.socket-export-stream.php                  13-Apr-2024 02:08                3516
function.socket-get-option.php                     13-Apr-2024 02:08               32719
function.socket-get-status.php                     13-Apr-2024 02:08                1790
function.socket-getopt.php                         13-Apr-2024 02:08                1777
function.socket-getpeername.php                    13-Apr-2024 02:08                8155
function.socket-getsockname.php                    13-Apr-2024 02:08                7608
function.socket-import-stream.php                  13-Apr-2024 02:08                5147
function.socket-last-error.php                     13-Apr-2024 02:08                7426
function.socket-listen.php                         13-Apr-2024 02:08                7240
function.socket-read.php                           13-Apr-2024 02:08                7830
function.socket-recv.php                           13-Apr-2024 02:08               16306
function.socket-recvfrom.php                       13-Apr-2024 02:08               13320
function.socket-recvmsg.php                        13-Apr-2024 02:08                4413
function.socket-select.php                         13-Apr-2024 02:08               16161
function.socket-send.php                           13-Apr-2024 02:08                6730
function.socket-sendmsg.php                        13-Apr-2024 02:08                4555
function.socket-sendto.php                         13-Apr-2024 02:08                9802
function.socket-set-block.php                      13-Apr-2024 02:08                6175
function.socket-set-blocking.php                   13-Apr-2024 02:08                1808
function.socket-set-nonblock.php                   13-Apr-2024 02:08                6660
function.socket-set-option.php                     13-Apr-2024 02:08               12053
function.socket-set-timeout.php                    13-Apr-2024 02:08                1777
function.socket-setopt.php                         13-Apr-2024 02:08                1771
function.socket-shutdown.php                       13-Apr-2024 02:08                4855
function.socket-strerror.php                       13-Apr-2024 02:08                7215
function.socket-write.php                          13-Apr-2024 02:08                7422
function.socket-wsaprotocol-info-export.php        13-Apr-2024 02:08                5069
function.socket-wsaprotocol-info-import.php        13-Apr-2024 02:08                4459
function.socket-wsaprotocol-info-release.php       13-Apr-2024 02:08                3635
function.sodium-add.php                            13-Apr-2024 02:08                3163
function.sodium-base642bin.php                     13-Apr-2024 02:08                4443
function.sodium-bin2base64.php                     13-Apr-2024 02:08                3973
function.sodium-bin2hex.php                        13-Apr-2024 02:08                2670
function.sodium-compare.php                        13-Apr-2024 02:08                3197
function.sodium-crypto-aead-aes256gcm-decrypt.php  13-Apr-2024 02:08                4682
function.sodium-crypto-aead-aes256gcm-encrypt.php  13-Apr-2024 02:08                4377
function.sodium-crypto-aead-aes256gcm-is-availa..> 13-Apr-2024 02:08                2820
function.sodium-crypto-aead-aes256gcm-keygen.php   13-Apr-2024 02:08                2810
function.sodium-crypto-aead-chacha20poly1305-de..> 13-Apr-2024 02:08                4547
function.sodium-crypto-aead-chacha20poly1305-en..> 13-Apr-2024 02:08                4266
function.sodium-crypto-aead-chacha20poly1305-ie..> 13-Apr-2024 02:08                4777
function.sodium-crypto-aead-chacha20poly1305-ie..> 13-Apr-2024 02:08                4432
function.sodium-crypto-aead-chacha20poly1305-ie..> 13-Apr-2024 02:08                3004
function.sodium-crypto-aead-chacha20poly1305-ke..> 13-Apr-2024 02:08                2939
function.sodium-crypto-aead-xchacha20poly1305-i..> 13-Apr-2024 02:08                4955
function.sodium-crypto-aead-xchacha20poly1305-i..> 13-Apr-2024 02:08                4650
function.sodium-crypto-aead-xchacha20poly1305-i..> 13-Apr-2024 02:08                2980
function.sodium-crypto-auth-keygen.php             13-Apr-2024 02:08                2631
function.sodium-crypto-auth-verify.php             13-Apr-2024 02:08                3867
function.sodium-crypto-auth.php                    13-Apr-2024 02:08                3326
function.sodium-crypto-box-keypair-from-secretk..> 13-Apr-2024 02:08                3405
function.sodium-crypto-box-keypair.php             13-Apr-2024 02:08                2912
function.sodium-crypto-box-open.php                13-Apr-2024 02:08                3982
function.sodium-crypto-box-publickey-from-secre..> 13-Apr-2024 02:08                3236
function.sodium-crypto-box-publickey.php           13-Apr-2024 02:08                2949
function.sodium-crypto-box-seal-open.php           13-Apr-2024 02:08                6032
function.sodium-crypto-box-seal.php                13-Apr-2024 02:08                7150
function.sodium-crypto-box-secretkey.php           13-Apr-2024 02:08                2916
function.sodium-crypto-box-seed-keypair.php        13-Apr-2024 02:08                2975
function.sodium-crypto-box.php                     13-Apr-2024 02:08                4195
function.sodium-crypto-core-ristretto255-add.php   13-Apr-2024 02:08                6117
function.sodium-crypto-core-ristretto255-from-h..> 13-Apr-2024 02:08                5477
function.sodium-crypto-core-ristretto255-is-val..> 13-Apr-2024 02:08                5642
function.sodium-crypto-core-ristretto255-random..> 13-Apr-2024 02:08                5633
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:08                6384
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:08                3621
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:08                5476
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:08                3880
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:08                5460
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:08                5792
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:08                3565
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:08                6375
function.sodium-crypto-core-ristretto255-sub.php   13-Apr-2024 02:08                6154
function.sodium-crypto-generichash-final.php       13-Apr-2024 02:08                6863
function.sodium-crypto-generichash-init.php        13-Apr-2024 02:08                6813
function.sodium-crypto-generichash-keygen.php      13-Apr-2024 02:08                2441
function.sodium-crypto-generichash-update.php      13-Apr-2024 02:08                6546
function.sodium-crypto-generichash.php             13-Apr-2024 02:08                3731
function.sodium-crypto-kdf-derive-from-key.php     13-Apr-2024 02:08                3942
function.sodium-crypto-kdf-keygen.php              13-Apr-2024 02:08                2543
function.sodium-crypto-kx-client-session-keys.php  13-Apr-2024 02:08                3358
function.sodium-crypto-kx-keypair.php              13-Apr-2024 02:08                4993
function.sodium-crypto-kx-publickey.php            13-Apr-2024 02:08                2768
function.sodium-crypto-kx-secretkey.php            13-Apr-2024 02:08                2779
function.sodium-crypto-kx-seed-keypair.php         13-Apr-2024 02:08                2716
function.sodium-crypto-kx-server-session-keys.php  13-Apr-2024 02:08                3424
function.sodium-crypto-pwhash-scryptsalsa208sha..> 13-Apr-2024 02:08                3321
function.sodium-crypto-pwhash-scryptsalsa208sha..> 13-Apr-2024 02:08                3524
function.sodium-crypto-pwhash-scryptsalsa208sha..> 13-Apr-2024 02:08                6424
function.sodium-crypto-pwhash-str-needs-rehash.php 13-Apr-2024 02:08                3998
function.sodium-crypto-pwhash-str-verify.php       13-Apr-2024 02:08                4728
function.sodium-crypto-pwhash-str.php              13-Apr-2024 02:08                8605
function.sodium-crypto-pwhash.php                  13-Apr-2024 02:08               10418
function.sodium-crypto-scalarmult-base.php         13-Apr-2024 02:08                2025
function.sodium-crypto-scalarmult-ristretto255-..> 13-Apr-2024 02:08                3534
function.sodium-crypto-scalarmult-ristretto255.php 13-Apr-2024 02:08                3883
function.sodium-crypto-scalarmult.php              13-Apr-2024 02:08                3047
function.sodium-crypto-secretbox-keygen.php        13-Apr-2024 02:08                6270
function.sodium-crypto-secretbox-open.php          13-Apr-2024 02:08                8787
function.sodium-crypto-secretbox.php               13-Apr-2024 02:08                8683
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:08               10870
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:08               10204
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:08                2707
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:08                5805
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:08                5816
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:08                2956
function.sodium-crypto-shorthash-keygen.php        13-Apr-2024 02:08                2690
function.sodium-crypto-shorthash.php               13-Apr-2024 02:08                3159
function.sodium-crypto-sign-detached.php           13-Apr-2024 02:08                3152
function.sodium-crypto-sign-ed25519-pk-to-curve..> 13-Apr-2024 02:08                2936
function.sodium-crypto-sign-ed25519-sk-to-curve..> 13-Apr-2024 02:08                2992
function.sodium-crypto-sign-keypair-from-secret..> 13-Apr-2024 02:08                3231
function.sodium-crypto-sign-keypair.php            13-Apr-2024 02:08                2429
function.sodium-crypto-sign-open.php               13-Apr-2024 02:08                3348
function.sodium-crypto-sign-publickey-from-secr..> 13-Apr-2024 02:08                2794
function.sodium-crypto-sign-publickey.php          13-Apr-2024 02:08                2804
function.sodium-crypto-sign-secretkey.php          13-Apr-2024 02:08                2780
function.sodium-crypto-sign-seed-keypair.php       13-Apr-2024 02:08                3013
function.sodium-crypto-sign-verify-detached.php    13-Apr-2024 02:08                3644
function.sodium-crypto-sign.php                    13-Apr-2024 02:08                3230
function.sodium-crypto-stream-keygen.php           13-Apr-2024 02:08                2612
function.sodium-crypto-stream-xchacha20-keygen.php 13-Apr-2024 02:08                2770
function.sodium-crypto-stream-xchacha20-xor-ic.php 13-Apr-2024 02:08                9629
function.sodium-crypto-stream-xchacha20-xor.php    13-Apr-2024 02:08                4680
function.sodium-crypto-stream-xchacha20.php        13-Apr-2024 02:08                3686
function.sodium-crypto-stream-xor.php              13-Apr-2024 02:08                3472
function.sodium-crypto-stream.php                  13-Apr-2024 02:08                3405
function.sodium-hex2bin.php                        13-Apr-2024 02:08                3278
function.sodium-increment.php                      13-Apr-2024 02:08                2496
function.sodium-memcmp.php                         13-Apr-2024 02:08                3501
function.sodium-memzero.php                        13-Apr-2024 02:08                2491
function.sodium-pad.php                            13-Apr-2024 02:08                2727
function.sodium-unpad.php                          13-Apr-2024 02:08                2682
function.solr-get-version.php                      13-Apr-2024 02:08                3948
function.sort.php                                  13-Apr-2024 02:08               12533
function.soundex.php                               13-Apr-2024 02:08                7278
function.spl-autoload-call.php                     13-Apr-2024 02:08                2625
function.spl-autoload-extensions.php               13-Apr-2024 02:08                4974
function.spl-autoload-functions.php                13-Apr-2024 02:08                3244
function.spl-autoload-register.php                 13-Apr-2024 02:08               13500
function.spl-autoload-unregister.php               13-Apr-2024 02:08                3086
function.spl-autoload.php                          13-Apr-2024 02:08                4682
function.spl-classes.php                           13-Apr-2024 02:08                3790
function.spl-object-hash.php                       13-Apr-2024 02:08                5027
function.spl-object-id.php                         13-Apr-2024 02:08                4117
function.sprintf.php                               13-Apr-2024 02:08               29295
function.sqlsrv-begin-transaction.php              13-Apr-2024 02:08               11262
function.sqlsrv-cancel.php                         13-Apr-2024 02:08               10332
function.sqlsrv-client-info.php                    13-Apr-2024 02:08                6743
function.sqlsrv-close.php                          13-Apr-2024 02:08                5601
function.sqlsrv-commit.php                         13-Apr-2024 02:08               11116
function.sqlsrv-configure.php                      13-Apr-2024 02:08                4735
function.sqlsrv-connect.php                        13-Apr-2024 02:08               12188
function.sqlsrv-errors.php                         13-Apr-2024 02:08               10032
function.sqlsrv-execute.php                        13-Apr-2024 02:08               10155
function.sqlsrv-fetch-array.php                    13-Apr-2024 02:08               15610
function.sqlsrv-fetch-object.php                   13-Apr-2024 02:08               12369
function.sqlsrv-fetch.php                          13-Apr-2024 02:08               10816
function.sqlsrv-field-metadata.php                 13-Apr-2024 02:08                8854
function.sqlsrv-free-stmt.php                      13-Apr-2024 02:08                7733
function.sqlsrv-get-config.php                     13-Apr-2024 02:08                3330
function.sqlsrv-get-field.php                      13-Apr-2024 02:08               10188
function.sqlsrv-has-rows.php                       13-Apr-2024 02:08                6347
function.sqlsrv-next-result.php                    13-Apr-2024 02:08                9261
function.sqlsrv-num-fields.php                     13-Apr-2024 02:08                8181
function.sqlsrv-num-rows.php                       13-Apr-2024 02:08                7908
function.sqlsrv-prepare.php                        13-Apr-2024 02:08               14526
function.sqlsrv-query.php                          13-Apr-2024 02:08               11879
function.sqlsrv-rollback.php                       13-Apr-2024 02:08               10586
function.sqlsrv-rows-affected.php                  13-Apr-2024 02:08                7958
function.sqlsrv-send-stream-data.php               13-Apr-2024 02:08                8527
function.sqlsrv-server-info.php                    13-Apr-2024 02:08                6152
function.sqrt.php                                  13-Apr-2024 02:08                4517
function.srand.php                                 13-Apr-2024 02:08                7163
function.sscanf.php                                13-Apr-2024 02:08               11929
function.ssdeep-fuzzy-compare.php                  13-Apr-2024 02:08                3266
function.ssdeep-fuzzy-hash-filename.php            13-Apr-2024 02:08                2986
function.ssdeep-fuzzy-hash.php                     13-Apr-2024 02:08                2828
function.ssh2-auth-agent.php                       13-Apr-2024 02:08                4763
function.ssh2-auth-hostbased-file.php              13-Apr-2024 02:08                7827
function.ssh2-auth-none.php                        13-Apr-2024 02:08                4931
function.ssh2-auth-password.php                    13-Apr-2024 02:08                5062
function.ssh2-auth-pubkey-file.php                 13-Apr-2024 02:08                7464
function.ssh2-connect.php                          13-Apr-2024 02:08               16065
function.ssh2-disconnect.php                       13-Apr-2024 02:08                3111
function.ssh2-exec.php                             13-Apr-2024 02:08                7608
function.ssh2-fetch-stream.php                     13-Apr-2024 02:08                5514
function.ssh2-fingerprint.php                      13-Apr-2024 02:08                5411
function.ssh2-forward-accept.php                   13-Apr-2024 02:08                3075
function.ssh2-forward-listen.php                   13-Apr-2024 02:08                4525
function.ssh2-methods-negotiated.php               13-Apr-2024 02:08                8059
function.ssh2-poll.php                             13-Apr-2024 02:08                3546
function.ssh2-publickey-add.php                    13-Apr-2024 02:08                8700
function.ssh2-publickey-init.php                   13-Apr-2024 02:08                4735
function.ssh2-publickey-list.php                   13-Apr-2024 02:08                9120
function.ssh2-publickey-remove.php                 13-Apr-2024 02:08                4937
function.ssh2-scp-recv.php                         13-Apr-2024 02:08                5498
function.ssh2-scp-send.php                         13-Apr-2024 02:08                6028
function.ssh2-send-eof.php                         13-Apr-2024 02:08                3477
function.ssh2-sftp-chmod.php                       13-Apr-2024 02:08                5998
function.ssh2-sftp-lstat.php                       13-Apr-2024 02:08                7465
function.ssh2-sftp-mkdir.php                       13-Apr-2024 02:08                6817
function.ssh2-sftp-readlink.php                    13-Apr-2024 02:08                5385
function.ssh2-sftp-realpath.php                    13-Apr-2024 02:08                5655
function.ssh2-sftp-rename.php                      13-Apr-2024 02:08                5543
function.ssh2-sftp-rmdir.php                       13-Apr-2024 02:08                5633
function.ssh2-sftp-stat.php                        13-Apr-2024 02:08                7433
function.ssh2-sftp-symlink.php                     13-Apr-2024 02:08                5872
function.ssh2-sftp-unlink.php                      13-Apr-2024 02:08                5104
function.ssh2-sftp.php                             13-Apr-2024 02:08                5508
function.ssh2-shell.php                            13-Apr-2024 02:08                7961
function.ssh2-tunnel.php                           13-Apr-2024 02:08                5325
function.stat.php                                  13-Apr-2024 02:08               16428
function.stats-absolute-deviation.php              13-Apr-2024 02:08                2824
function.stats-cdf-beta.php                        13-Apr-2024 02:08                5186
function.stats-cdf-binomial.php                    13-Apr-2024 02:08                5171
function.stats-cdf-cauchy.php                      13-Apr-2024 02:08                5206
function.stats-cdf-chisquare.php                   13-Apr-2024 02:08                4525
function.stats-cdf-exponential.php                 13-Apr-2024 02:08                4556
function.stats-cdf-f.php                           13-Apr-2024 02:08                5111
function.stats-cdf-gamma.php                       13-Apr-2024 02:08                5170
function.stats-cdf-laplace.php                     13-Apr-2024 02:08                5191
function.stats-cdf-logistic.php                    13-Apr-2024 02:08                5226
function.stats-cdf-negative-binomial.php           13-Apr-2024 02:08                5314
function.stats-cdf-noncentral-chisquare.php        13-Apr-2024 02:08                5416
function.stats-cdf-noncentral-f.php                13-Apr-2024 02:08                5990
function.stats-cdf-noncentral-t.php                13-Apr-2024 02:08                5276
function.stats-cdf-normal.php                      13-Apr-2024 02:08                5208
function.stats-cdf-poisson.php                     13-Apr-2024 02:08                4490
function.stats-cdf-t.php                           13-Apr-2024 02:08                4418
function.stats-cdf-uniform.php                     13-Apr-2024 02:08                5171
function.stats-cdf-weibull.php                     13-Apr-2024 02:08                5208
function.stats-covariance.php                      13-Apr-2024 02:08                3019
function.stats-dens-beta.php                       13-Apr-2024 02:08                3505
function.stats-dens-cauchy.php                     13-Apr-2024 02:08                3563
function.stats-dens-chisquare.php                  13-Apr-2024 02:08                3233
function.stats-dens-exponential.php                13-Apr-2024 02:08                3223
function.stats-dens-f.php                          13-Apr-2024 02:08                3503
function.stats-dens-gamma.php                      13-Apr-2024 02:08                3556
function.stats-dens-laplace.php                    13-Apr-2024 02:08                3590
function.stats-dens-logistic.php                   13-Apr-2024 02:08                3602
function.stats-dens-normal.php                     13-Apr-2024 02:08                3573
function.stats-dens-pmf-binomial.php               13-Apr-2024 02:08                3627
function.stats-dens-pmf-hypergeometric.php         13-Apr-2024 02:08                4279
function.stats-dens-pmf-negative-binomial.php      13-Apr-2024 02:08                3756
function.stats-dens-pmf-poisson.php                13-Apr-2024 02:08                3224
function.stats-dens-t.php                          13-Apr-2024 02:08                3137
function.stats-dens-uniform.php                    13-Apr-2024 02:08                3538
function.stats-dens-weibull.php                    13-Apr-2024 02:08                3570
function.stats-harmonic-mean.php                   13-Apr-2024 02:08                2718
function.stats-kurtosis.php                        13-Apr-2024 02:08                2726
function.stats-rand-gen-beta.php                   13-Apr-2024 02:08                3032
function.stats-rand-gen-chisquare.php              13-Apr-2024 02:08                2705
function.stats-rand-gen-exponential.php            13-Apr-2024 02:08                2703
function.stats-rand-gen-f.php                      13-Apr-2024 02:08                3086
function.stats-rand-gen-funiform.php               13-Apr-2024 02:08                3013
function.stats-rand-gen-gamma.php                  13-Apr-2024 02:08                3099
function.stats-rand-gen-ibinomial-negative.php     13-Apr-2024 02:08                3179
function.stats-rand-gen-ibinomial.php              13-Apr-2024 02:08                3103
function.stats-rand-gen-int.php                    13-Apr-2024 02:08                2282
function.stats-rand-gen-ipoisson.php               13-Apr-2024 02:08                2678
function.stats-rand-gen-iuniform.php               13-Apr-2024 02:08                3080
function.stats-rand-gen-noncentral-chisquare.php   13-Apr-2024 02:08                3221
function.stats-rand-gen-noncentral-f.php           13-Apr-2024 02:08                3574
function.stats-rand-gen-noncentral-t.php           13-Apr-2024 02:08                3134
function.stats-rand-gen-normal.php                 13-Apr-2024 02:08                3047
function.stats-rand-gen-t.php                      13-Apr-2024 02:08                2597
function.stats-rand-get-seeds.php                  13-Apr-2024 02:08                2325
function.stats-rand-phrase-to-seeds.php            13-Apr-2024 02:08                2686
function.stats-rand-ranf.php                       13-Apr-2024 02:08                2326
function.stats-rand-setall.php                     13-Apr-2024 02:08                2955
function.stats-skew.php                            13-Apr-2024 02:08                2692
function.stats-standard-deviation.php              13-Apr-2024 02:08                3864
function.stats-stat-binomial-coef.php              13-Apr-2024 02:08                2992
function.stats-stat-correlation.php                13-Apr-2024 02:08                3199
function.stats-stat-factorial.php                  13-Apr-2024 02:08                2565
function.stats-stat-independent-t.php              13-Apr-2024 02:08                3316
function.stats-stat-innerproduct.php               13-Apr-2024 02:08                3141
function.stats-stat-paired-t.php                   13-Apr-2024 02:08                3078
function.stats-stat-percentile.php                 13-Apr-2024 02:08                2944
function.stats-stat-powersum.php                   13-Apr-2024 02:08                2936
function.stats-variance.php                        13-Apr-2024 02:08                3363
function.stomp-connect-error.php                   13-Apr-2024 02:08                3702
function.stomp-version.php                         13-Apr-2024 02:08                3128
function.str-contains.php                          13-Apr-2024 02:08                8276
function.str-decrement.php                         13-Apr-2024 02:08                6515
function.str-ends-with.php                         13-Apr-2024 02:08                8346
function.str-getcsv.php                            13-Apr-2024 02:08                9170
function.str-increment.php                         13-Apr-2024 02:08                6202
function.str-ireplace.php                          13-Apr-2024 02:08                9622
function.str-pad.php                               13-Apr-2024 02:08                8302
function.str-repeat.php                            13-Apr-2024 02:08                4693
function.str-replace.php                           13-Apr-2024 02:08               17094
function.str-rot13.php                             13-Apr-2024 02:08                3707
function.str-shuffle.php                           13-Apr-2024 02:08                6138
function.str-split.php                             13-Apr-2024 02:08                8998
function.str-starts-with.php                       13-Apr-2024 02:08                8396
function.str-word-count.php                        13-Apr-2024 02:08                9361
function.strcasecmp.php                            13-Apr-2024 02:08                6572
function.strchr.php                                13-Apr-2024 02:08                1641
function.strcmp.php                                13-Apr-2024 02:08                6302
function.strcoll.php                               13-Apr-2024 02:08                5500
function.strcspn.php                               13-Apr-2024 02:08               11547
function.stream-bucket-append.php                  13-Apr-2024 02:08                2261
function.stream-bucket-make-writeable.php          13-Apr-2024 02:08                4400
function.stream-bucket-new.php                     13-Apr-2024 02:08                2294
function.stream-bucket-prepend.php                 13-Apr-2024 02:08                6259
function.stream-context-create.php                 13-Apr-2024 02:08                8122
function.stream-context-get-default.php            13-Apr-2024 02:08                8982
function.stream-context-get-options.php            13-Apr-2024 02:08                4529
function.stream-context-get-params.php             13-Apr-2024 02:08                5737
function.stream-context-set-default.php            13-Apr-2024 02:08                6324
function.stream-context-set-option.php             13-Apr-2024 02:08                5633
function.stream-context-set-options.php            13-Apr-2024 02:08                6467
function.stream-context-set-params.php             13-Apr-2024 02:08                5024
function.stream-copy-to-stream.php                 13-Apr-2024 02:08                7918
function.stream-filter-append.php                  13-Apr-2024 02:08               11117
function.stream-filter-prepend.php                 13-Apr-2024 02:08                8547
function.stream-filter-register.php                13-Apr-2024 02:08               18523
function.stream-filter-remove.php                  13-Apr-2024 02:08                6747
function.stream-get-contents.php                   13-Apr-2024 02:08                9131
function.stream-get-filters.php                    13-Apr-2024 02:08                4213
function.stream-get-line.php                       13-Apr-2024 02:08                5011
function.stream-get-meta-data.php                  13-Apr-2024 02:08               15973
function.stream-get-transports.php                 13-Apr-2024 02:08                4210
function.stream-get-wrappers.php                   13-Apr-2024 02:08                4959
function.stream-is-local.php                       13-Apr-2024 02:08                4410
function.stream-isatty.php                         13-Apr-2024 02:08                4051
function.stream-notification-callback.php          13-Apr-2024 02:08               22443
function.stream-register-wrapper.php               13-Apr-2024 02:08                1911
function.stream-resolve-include-path.php           13-Apr-2024 02:08                4195
function.stream-select.php                         13-Apr-2024 02:08               16121
function.stream-set-blocking.php                   13-Apr-2024 02:08                4773
function.stream-set-chunk-size.php                 13-Apr-2024 02:08                4329
function.stream-set-read-buffer.php                13-Apr-2024 02:08                3799
function.stream-set-timeout.php                    13-Apr-2024 02:08                8260
function.stream-set-write-buffer.php               13-Apr-2024 02:08                5947
function.stream-socket-accept.php                  13-Apr-2024 02:08                7824
function.stream-socket-client.php                  13-Apr-2024 02:08               18144
function.stream-socket-enable-crypto.php           13-Apr-2024 02:08               12448
function.stream-socket-get-name.php                13-Apr-2024 02:08                3899
function.stream-socket-pair.php                    13-Apr-2024 02:08                9855
function.stream-socket-recvfrom.php                13-Apr-2024 02:08               10741
function.stream-socket-sendto.php                  13-Apr-2024 02:08                7529
function.stream-socket-server.php                  13-Apr-2024 02:08               16041
function.stream-socket-shutdown.php                13-Apr-2024 02:08                6624
function.stream-supports-lock.php                  13-Apr-2024 02:08                3288
function.stream-wrapper-register.php               13-Apr-2024 02:08                9401
function.stream-wrapper-restore.php                13-Apr-2024 02:08                3016
function.stream-wrapper-unregister.php             13-Apr-2024 02:08                3221
function.strftime.php                              13-Apr-2024 02:08               55651
function.strip-tags.php                            13-Apr-2024 02:08                9648
function.stripcslashes.php                         13-Apr-2024 02:08                4020
function.stripos.php                               13-Apr-2024 02:08               12405
function.stripslashes.php                          13-Apr-2024 02:08                7649
function.stristr.php                               13-Apr-2024 02:08               10464
function.strlen.php                                13-Apr-2024 02:08                5453
function.strnatcasecmp.php                         13-Apr-2024 02:08                7854
function.strnatcmp.php                             13-Apr-2024 02:08                9270
function.strncasecmp.php                           13-Apr-2024 02:08                7115
function.strncmp.php                               13-Apr-2024 02:08                7041
function.strpbrk.php                               13-Apr-2024 02:08                5376
function.strpos.php                                13-Apr-2024 02:08               14129
function.strptime.php                              13-Apr-2024 02:08               11886
function.strrchr.php                               13-Apr-2024 02:08                8179
function.strrev.php                                13-Apr-2024 02:08                3169
function.strripos.php                              13-Apr-2024 02:08               10941
function.strrpos.php                               13-Apr-2024 02:08               13415
function.strspn.php                                13-Apr-2024 02:08               10224
function.strstr.php                                13-Apr-2024 02:08                8744
function.strtok.php                                13-Apr-2024 02:08               12662
function.strtolower.php                            13-Apr-2024 02:08                6187
function.strtotime.php                             13-Apr-2024 02:08               12869
function.strtoupper.php                            13-Apr-2024 02:08                6148
function.strtr.php                                 13-Apr-2024 02:08               11233
function.strval.php                                13-Apr-2024 02:08                6480
function.substr-compare.php                        13-Apr-2024 02:08               11178
function.substr-count.php                          13-Apr-2024 02:08                9779
function.substr-replace.php                        13-Apr-2024 02:08               16219
function.substr.php                                13-Apr-2024 02:08               23212
function.svn-add.php                               13-Apr-2024 02:08                6484
function.svn-auth-get-parameter.php                13-Apr-2024 02:08                3986
function.svn-auth-set-parameter.php                13-Apr-2024 02:08                5426
function.svn-blame.php                             13-Apr-2024 02:08                4991
function.svn-cat.php                               13-Apr-2024 02:08                4849
function.svn-checkout.php                          13-Apr-2024 02:08                7483
function.svn-cleanup.php                           13-Apr-2024 02:08                5253
function.svn-client-version.php                    13-Apr-2024 02:08                3509
function.svn-commit.php                            13-Apr-2024 02:08                8172
function.svn-delete.php                            13-Apr-2024 02:08                4814
function.svn-diff.php                              13-Apr-2024 02:08               13463
function.svn-export.php                            13-Apr-2024 02:08                5373
function.svn-fs-abort-txn.php                      13-Apr-2024 02:08                3230
function.svn-fs-apply-text.php                     13-Apr-2024 02:08                2786
function.svn-fs-begin-txn2.php                     13-Apr-2024 02:08                2729
function.svn-fs-change-node-prop.php               13-Apr-2024 02:08                3257
function.svn-fs-check-path.php                     13-Apr-2024 02:08                2831
function.svn-fs-contents-changed.php               13-Apr-2024 02:08                3262
function.svn-fs-copy.php                           13-Apr-2024 02:08                4223
function.svn-fs-delete.php                         13-Apr-2024 02:08                3508
function.svn-fs-dir-entries.php                    13-Apr-2024 02:08                2844
function.svn-fs-file-contents.php                  13-Apr-2024 02:08                2867
function.svn-fs-file-length.php                    13-Apr-2024 02:08                2790
function.svn-fs-is-dir.php                         13-Apr-2024 02:08                3547
function.svn-fs-is-file.php                        13-Apr-2024 02:08                3535
function.svn-fs-make-dir.php                       13-Apr-2024 02:08                3532
function.svn-fs-make-file.php                      13-Apr-2024 02:08                3549
function.svn-fs-node-created-rev.php               13-Apr-2024 02:08                2833
function.svn-fs-node-prop.php                      13-Apr-2024 02:08                2931
function.svn-fs-props-changed.php                  13-Apr-2024 02:08                3249
function.svn-fs-revision-prop.php                  13-Apr-2024 02:08                2944
function.svn-fs-revision-root.php                  13-Apr-2024 02:08                2812
function.svn-fs-txn-root.php                       13-Apr-2024 02:08                2577
function.svn-fs-youngest-rev.php                   13-Apr-2024 02:08                2619
function.svn-import.php                            13-Apr-2024 02:08                6143
function.svn-log.php                               13-Apr-2024 02:08                9119
function.svn-ls.php                                13-Apr-2024 02:08                7373
function.svn-mkdir.php                             13-Apr-2024 02:08                3288
function.svn-repos-create.php                      13-Apr-2024 02:08                2997
function.svn-repos-fs-begin-txn-for-commit.php     13-Apr-2024 02:08                3317
function.svn-repos-fs-commit-txn.php               13-Apr-2024 02:08                2674
function.svn-repos-fs.php                          13-Apr-2024 02:08                2574
function.svn-repos-hotcopy.php                     13-Apr-2024 02:08                2943
function.svn-repos-open.php                        13-Apr-2024 02:08                2546
function.svn-repos-recover.php                     13-Apr-2024 02:08                2590
function.svn-revert.php                            13-Apr-2024 02:08                3625
function.svn-status.php                            13-Apr-2024 02:08               14807
function.svn-update.php                            13-Apr-2024 02:08                6282
function.swoole-async-dns-lookup.php               13-Apr-2024 02:08                3866
function.swoole-async-read.php                     13-Apr-2024 02:08                4464
function.swoole-async-readfile.php                 13-Apr-2024 02:08                3886
function.swoole-async-set.php                      13-Apr-2024 02:08                2413
function.swoole-async-write.php                    13-Apr-2024 02:08                3766
function.swoole-async-writefile.php                13-Apr-2024 02:08                3794
function.swoole-clear-error.php                    13-Apr-2024 02:08                2282
function.swoole-client-select.php                  13-Apr-2024 02:08                3496
function.swoole-cpu-num.php                        13-Apr-2024 02:08                2134
function.swoole-errno.php                          13-Apr-2024 02:08                2111
function.swoole-error-log.php                      13-Apr-2024 02:08                3564
function.swoole-event-add.php                      13-Apr-2024 02:08                3503
function.swoole-event-defer.php                    13-Apr-2024 02:08                2649
function.swoole-event-del.php                      13-Apr-2024 02:08                2615
function.swoole-event-exit.php                     13-Apr-2024 02:08                2177
function.swoole-event-set.php                      13-Apr-2024 02:08                3491
function.swoole-event-wait.php                     13-Apr-2024 02:08                2148
function.swoole-event-write.php                    13-Apr-2024 02:08                2887
function.swoole-get-local-ip.php                   13-Apr-2024 02:08                2205
function.swoole-last-error.php                     13-Apr-2024 02:08                2160
function.swoole-load-module.php                    13-Apr-2024 02:08                2318
function.swoole-select.php                         13-Apr-2024 02:08                3463
function.swoole-set-process-name.php               13-Apr-2024 02:08                2636
function.swoole-strerror.php                       13-Apr-2024 02:08                2590
function.swoole-timer-after.php                    13-Apr-2024 02:08                3014
function.swoole-timer-exists.php                   13-Apr-2024 02:08                2427
function.swoole-timer-tick.php                     13-Apr-2024 02:08                2891
function.swoole-version.php                        13-Apr-2024 02:08                2139
function.symlink.php                               13-Apr-2024 02:08                5702
function.sys-get-temp-dir.php                      13-Apr-2024 02:08                4173
function.sys-getloadavg.php                        13-Apr-2024 02:08                4100
function.syslog.php                                13-Apr-2024 02:08                9607
function.system.php                                13-Apr-2024 02:08                7717
function.taint.php                                 13-Apr-2024 02:08                2671
function.tan.php                                   13-Apr-2024 02:08                4242
function.tanh.php                                  13-Apr-2024 02:08                3166
function.tcpwrap-check.php                         13-Apr-2024 02:08                5952
function.tempnam.php                               13-Apr-2024 02:08                7209
function.textdomain.php                            13-Apr-2024 02:08                3307
function.tidy-access-count.php                     13-Apr-2024 02:08                6450
function.tidy-config-count.php                     13-Apr-2024 02:08                4252
function.tidy-error-count.php                      13-Apr-2024 02:08                5309
function.tidy-get-output.php                       13-Apr-2024 02:08                4322
function.tidy-warning-count.php                    13-Apr-2024 02:08                4861
function.time-nanosleep.php                        13-Apr-2024 02:08                8651
function.time-sleep-until.php                      13-Apr-2024 02:08                5814
function.time.php                                  13-Apr-2024 02:08                4685
function.timezone-abbreviations-list.php           13-Apr-2024 02:08                1916
function.timezone-identifiers-list.php             13-Apr-2024 02:08                1932
function.timezone-location-get.php                 13-Apr-2024 02:08                1888
function.timezone-name-from-abbr.php               13-Apr-2024 02:08                6552
function.timezone-name-get.php                     13-Apr-2024 02:08                1833
function.timezone-offset-get.php                   13-Apr-2024 02:08                1830
function.timezone-open.php                         13-Apr-2024 02:08                1802
function.timezone-transitions-get.php              13-Apr-2024 02:08                1894
function.timezone-version-get.php                  13-Apr-2024 02:08                4310
function.tmpfile.php                               13-Apr-2024 02:08                5543
function.token-get-all.php                         13-Apr-2024 02:08               11908
function.token-name.php                            13-Apr-2024 02:08                4289
function.touch.php                                 13-Apr-2024 02:08                8003
function.trader-acos.php                           13-Apr-2024 02:08                2472
function.trader-ad.php                             13-Apr-2024 02:08                3384
function.trader-add.php                            13-Apr-2024 02:08                2801
function.trader-adosc.php                          13-Apr-2024 02:08                4244
function.trader-adx.php                            13-Apr-2024 02:08                3470
function.trader-adxr.php                           13-Apr-2024 02:08                3481
function.trader-apo.php                            13-Apr-2024 02:08                3670
function.trader-aroon.php                          13-Apr-2024 02:08                3038
function.trader-aroonosc.php                       13-Apr-2024 02:08                3075
function.trader-asin.php                           13-Apr-2024 02:08                2485
function.trader-atan.php                           13-Apr-2024 02:08                2478
function.trader-atr.php                            13-Apr-2024 02:08                3460
function.trader-avgprice.php                       13-Apr-2024 02:08                3441
function.trader-bbands.php                         13-Apr-2024 02:08                4429
function.trader-beta.php                           13-Apr-2024 02:08                3006
function.trader-bop.php                            13-Apr-2024 02:08                3390
function.trader-cci.php                            13-Apr-2024 02:08                3465
function.trader-cdl2crows.php                      13-Apr-2024 02:08                3463
function.trader-cdl3blackcrows.php                 13-Apr-2024 02:08                3525
function.trader-cdl3inside.php                     13-Apr-2024 02:08                3506
function.trader-cdl3linestrike.php                 13-Apr-2024 02:08                3529
function.trader-cdl3outside.php                    13-Apr-2024 02:08                3521
function.trader-cdl3starsinsouth.php               13-Apr-2024 02:08                3570
function.trader-cdl3whitesoldiers.php              13-Apr-2024 02:08                3594
function.trader-cdlabandonedbaby.php               13-Apr-2024 02:08                3982
function.trader-cdladvanceblock.php                13-Apr-2024 02:08                3547
function.trader-cdlbelthold.php                    13-Apr-2024 02:08                3503
function.trader-cdlbreakaway.php                   13-Apr-2024 02:08                3517
function.trader-cdlclosingmarubozu.php             13-Apr-2024 02:08                3588
function.trader-cdlconcealbabyswall.php            13-Apr-2024 02:08                3611
function.trader-cdlcounterattack.php               13-Apr-2024 02:08                3575
function.trader-cdldarkcloudcover.php              13-Apr-2024 02:08                3976
function.trader-cdldoji.php                        13-Apr-2024 02:08                3460
function.trader-cdldojistar.php                    13-Apr-2024 02:08                3495
function.trader-cdldragonflydoji.php               13-Apr-2024 02:08                3550
function.trader-cdlengulfing.php                   13-Apr-2024 02:08                3535
function.trader-cdleveningdojistar.php             13-Apr-2024 02:08                3993
function.trader-cdleveningstar.php                 13-Apr-2024 02:08                3970
function.trader-cdlgapsidesidewhite.php            13-Apr-2024 02:08                3618
function.trader-cdlgravestonedoji.php              13-Apr-2024 02:08                3571
function.trader-cdlhammer.php                      13-Apr-2024 02:08                3486
function.trader-cdlhangingman.php                  13-Apr-2024 02:08                3507
function.trader-cdlharami.php                      13-Apr-2024 02:08                3488
function.trader-cdlharamicross.php                 13-Apr-2024 02:08                3530
function.trader-cdlhighwave.php                    13-Apr-2024 02:08                3504
function.trader-cdlhikkake.php                     13-Apr-2024 02:08                3493
function.trader-cdlhikkakemod.php                  13-Apr-2024 02:08                3534
function.trader-cdlhomingpigeon.php                13-Apr-2024 02:08                3555
function.trader-cdlidentical3crows.php             13-Apr-2024 02:08                3579
function.trader-cdlinneck.php                      13-Apr-2024 02:08                3505
function.trader-cdlinvertedhammer.php              13-Apr-2024 02:08                3553
function.trader-cdlkicking.php                     13-Apr-2024 02:08                3507
function.trader-cdlkickingbylength.php             13-Apr-2024 02:08                3613
function.trader-cdlladderbottom.php                13-Apr-2024 02:08                3563
function.trader-cdllongleggeddoji.php              13-Apr-2024 02:08                3568
function.trader-cdllongline.php                    13-Apr-2024 02:08                3512
function.trader-cdlmarubozu.php                    13-Apr-2024 02:08                3498
function.trader-cdlmatchinglow.php                 13-Apr-2024 02:08                3524
function.trader-cdlmathold.php                     13-Apr-2024 02:08                3916
function.trader-cdlmorningdojistar.php             13-Apr-2024 02:08                3989
function.trader-cdlmorningstar.php                 13-Apr-2024 02:08                3950
function.trader-cdlonneck.php                      13-Apr-2024 02:08                3485
function.trader-cdlpiercing.php                    13-Apr-2024 02:08                3502
function.trader-cdlrickshawman.php                 13-Apr-2024 02:08                3542
function.trader-cdlrisefall3methods.php            13-Apr-2024 02:08                3612
function.trader-cdlseparatinglines.php             13-Apr-2024 02:08                3594
function.trader-cdlshootingstar.php                13-Apr-2024 02:08                3553
function.trader-cdlshortline.php                   13-Apr-2024 02:08                3525
function.trader-cdlspinningtop.php                 13-Apr-2024 02:08                3540
function.trader-cdlstalledpattern.php              13-Apr-2024 02:08                3575
function.trader-cdlsticksandwich.php               13-Apr-2024 02:08                3556
function.trader-cdltakuri.php                      13-Apr-2024 02:08                3527
function.trader-cdltasukigap.php                   13-Apr-2024 02:08                3502
function.trader-cdlthrusting.php                   13-Apr-2024 02:08                3511
function.trader-cdltristar.php                     13-Apr-2024 02:08                3499
function.trader-cdlunique3river.php                13-Apr-2024 02:08                3550
function.trader-cdlupsidegap2crows.php             13-Apr-2024 02:08                3598
function.trader-cdlxsidegap3methods.php            13-Apr-2024 02:08                3597
function.trader-ceil.php                           13-Apr-2024 02:08                2502
function.trader-cmo.php                            13-Apr-2024 02:08                2719
function.trader-correl.php                         13-Apr-2024 02:08                3058
function.trader-cos.php                            13-Apr-2024 02:08                2468
function.trader-cosh.php                           13-Apr-2024 02:08                2484
function.trader-dema.php                           13-Apr-2024 02:08                2730
function.trader-div.php                            13-Apr-2024 02:08                2817
function.trader-dx.php                             13-Apr-2024 02:08                3446
function.trader-ema.php                            13-Apr-2024 02:08                2713
function.trader-errno.php                          13-Apr-2024 02:08                2204
function.trader-exp.php                            13-Apr-2024 02:08                2512
function.trader-floor.php                          13-Apr-2024 02:08                2494
function.trader-get-compat.php                     13-Apr-2024 02:08                2394
function.trader-get-unstable-period.php            13-Apr-2024 02:08                2716
function.trader-ht-dcperiod.php                    13-Apr-2024 02:08                2482
function.trader-ht-dcphase.php                     13-Apr-2024 02:08                2453
function.trader-ht-phasor.php                      13-Apr-2024 02:08                2434
function.trader-ht-sine.php                        13-Apr-2024 02:08                2413
function.trader-ht-trendline.php                   13-Apr-2024 02:08                2474
function.trader-ht-trendmode.php                   13-Apr-2024 02:08                2464
function.trader-kama.php                           13-Apr-2024 02:08                2768
function.trader-linearreg-angle.php                13-Apr-2024 02:08                2862
function.trader-linearreg-intercept.php            13-Apr-2024 02:08                2920
function.trader-linearreg-slope.php                13-Apr-2024 02:08                2872
function.trader-linearreg.php                      13-Apr-2024 02:08                2784
function.trader-ln.php                             13-Apr-2024 02:08                2470
function.trader-log10.php                          13-Apr-2024 02:08                2474
function.trader-ma.php                             13-Apr-2024 02:08                3134
function.trader-macd.php                           13-Apr-2024 02:08                3655
function.trader-macdext.php                        13-Apr-2024 02:08                5148
function.trader-macdfix.php                        13-Apr-2024 02:08                2814
function.trader-mama.php                           13-Apr-2024 02:08                3155
function.trader-mavp.php                           13-Apr-2024 02:08                4062
function.trader-max.php                            13-Apr-2024 02:08                2734
function.trader-maxindex.php                       13-Apr-2024 02:08                2791
function.trader-medprice.php                       13-Apr-2024 02:08                2705
function.trader-mfi.php                            13-Apr-2024 02:08                3809
function.trader-midpoint.php                       13-Apr-2024 02:08                2765
function.trader-midprice.php                       13-Apr-2024 02:08                3089
function.trader-min.php                            13-Apr-2024 02:08                2741
function.trader-minindex.php                       13-Apr-2024 02:08                2786
function.trader-minmax.php                         13-Apr-2024 02:08                2790
function.trader-minmaxindex.php                    13-Apr-2024 02:08                2841
function.trader-minus-di.php                       13-Apr-2024 02:08                3533
function.trader-minus-dm.php                       13-Apr-2024 02:08                3089
function.trader-mom.php                            13-Apr-2024 02:08                2705
function.trader-mult.php                           13-Apr-2024 02:08                2817
function.trader-natr.php                           13-Apr-2024 02:08                3471
function.trader-obv.php                            13-Apr-2024 02:08                2658
function.trader-plus-di.php                        13-Apr-2024 02:08                3504
function.trader-plus-dm.php                        13-Apr-2024 02:08                3076
function.trader-ppo.php                            13-Apr-2024 02:08                3674
function.trader-roc.php                            13-Apr-2024 02:08                2729
function.trader-rocp.php                           13-Apr-2024 02:08                2757
function.trader-rocr.php                           13-Apr-2024 02:08                2742
function.trader-rocr100.php                        13-Apr-2024 02:08                2782
function.trader-rsi.php                            13-Apr-2024 02:08                2710
function.trader-sar.php                            13-Apr-2024 02:08                3720
function.trader-sarext.php                         13-Apr-2024 02:08                7132
function.trader-set-compat.php                     13-Apr-2024 02:08                2622
function.trader-set-unstable-period.php            13-Apr-2024 02:08                3210
function.trader-sin.php                            13-Apr-2024 02:08                2492
function.trader-sinh.php                           13-Apr-2024 02:08                2480
function.trader-sma.php                            13-Apr-2024 02:08                2710
function.trader-sqrt.php                           13-Apr-2024 02:08                2473
function.trader-stddev.php                         13-Apr-2024 02:08                3054
function.trader-stoch.php                          13-Apr-2024 02:08                5338
function.trader-stochf.php                         13-Apr-2024 02:08                4445
function.trader-stochrsi.php                       13-Apr-2024 02:08                4187
function.trader-sub.php                            13-Apr-2024 02:08                2822
function.trader-sum.php                            13-Apr-2024 02:08                2692
function.trader-t3.php                             13-Apr-2024 02:08                3071
function.trader-tan.php                            13-Apr-2024 02:08                2461
function.trader-tanh.php                           13-Apr-2024 02:08                2485
function.trader-tema.php                           13-Apr-2024 02:08                2736
function.trader-trange.php                         13-Apr-2024 02:08                2993
function.trader-trima.php                          13-Apr-2024 02:08                2738
function.trader-trix.php                           13-Apr-2024 02:08                2748
function.trader-tsf.php                            13-Apr-2024 02:08                2717
function.trader-typprice.php                       13-Apr-2024 02:08                3016
function.trader-ultosc.php                         13-Apr-2024 02:08                4328
function.trader-var.php                            13-Apr-2024 02:08                3024
function.trader-wclprice.php                       13-Apr-2024 02:08                3021
function.trader-willr.php                          13-Apr-2024 02:08                3477
function.trader-wma.php                            13-Apr-2024 02:08                2746
function.trait-exists.php                          13-Apr-2024 02:08                3251
function.trigger-error.php                         13-Apr-2024 02:08                6649
function.trim.php                                  13-Apr-2024 02:08               12968
function.uasort.php                                13-Apr-2024 02:08               10235
function.ucfirst.php                               13-Apr-2024 02:08                6247
function.ucwords.php                               13-Apr-2024 02:08                9987
function.ui-draw-text-font-fontfamilies.php        13-Apr-2024 02:08                2409
function.ui-quit.php                               13-Apr-2024 02:08                2044
function.ui-run.php                                13-Apr-2024 02:08                2416
function.uksort.php                                13-Apr-2024 02:08                9968
function.umask.php                                 13-Apr-2024 02:08                5868
function.uniqid.php                                13-Apr-2024 02:08                8605
function.unixtojd.php                              13-Apr-2024 02:08                4160
function.unlink.php                                13-Apr-2024 02:08                6151
function.unpack.php                                13-Apr-2024 02:08               10859
function.unregister-tick-function.php              13-Apr-2024 02:08                3273
function.unserialize.php                           13-Apr-2024 02:08               17273
function.unset.php                                 13-Apr-2024 02:08               15135
function.untaint.php                               13-Apr-2024 02:08                2527
function.uopz-add-function.php                     13-Apr-2024 02:08                7155
function.uopz-allow-exit.php                       13-Apr-2024 02:08                4622
function.uopz-backup.php                           13-Apr-2024 02:08                4585
function.uopz-compose.php                          13-Apr-2024 02:08                6857
function.uopz-copy.php                             13-Apr-2024 02:08                5172
function.uopz-del-function.php                     13-Apr-2024 02:08                6590
function.uopz-delete.php                           13-Apr-2024 02:08                5996
function.uopz-extend.php                           13-Apr-2024 02:08                5037
function.uopz-flags.php                            13-Apr-2024 02:08               10957
function.uopz-function.php                         13-Apr-2024 02:08                7326
function.uopz-get-exit-status.php                  13-Apr-2024 02:08                4185
function.uopz-get-hook.php                         13-Apr-2024 02:08                5339
function.uopz-get-mock.php                         13-Apr-2024 02:08                4956
function.uopz-get-property.php                     13-Apr-2024 02:08                6202
function.uopz-get-return.php                       13-Apr-2024 02:08                4438
function.uopz-get-static.php                       13-Apr-2024 02:08                5156
function.uopz-implement.php                        13-Apr-2024 02:08                5062
function.uopz-overload.php                         13-Apr-2024 02:08                3938
function.uopz-redefine.php                         13-Apr-2024 02:08                5144
function.uopz-rename.php                           13-Apr-2024 02:08                6784
function.uopz-restore.php                          13-Apr-2024 02:08                4953
function.uopz-set-hook.php                         13-Apr-2024 02:08                5671
function.uopz-set-mock.php                         13-Apr-2024 02:08               10814
function.uopz-set-property.php                     13-Apr-2024 02:08                7501
function.uopz-set-return.php                       13-Apr-2024 02:08                9639
function.uopz-set-static.php                       13-Apr-2024 02:08                5754
function.uopz-undefine.php                         13-Apr-2024 02:08                4702
function.uopz-unset-hook.php                       13-Apr-2024 02:08                5562
function.uopz-unset-mock.php                       13-Apr-2024 02:08                5316
function.uopz-unset-return.php                     13-Apr-2024 02:08                4914
function.urldecode.php                             13-Apr-2024 02:08                6499
function.urlencode.php                             13-Apr-2024 02:08               10127
function.use-soap-error-handler.php                13-Apr-2024 02:08                3926
function.user-error.php                            13-Apr-2024 02:08                1706
function.usleep.php                                13-Apr-2024 02:08                7027
function.usort.php                                 13-Apr-2024 02:08               27202
function.utf8-decode.php                           13-Apr-2024 02:08               18692
function.utf8-encode.php                           13-Apr-2024 02:08               15362
function.var-dump.php                              13-Apr-2024 02:08                7011
function.var-export.php                            13-Apr-2024 02:08               17179
function.var-representation.php                    13-Apr-2024 02:08               13383
function.variant-abs.php                           13-Apr-2024 02:08                4251
function.variant-add.php                           13-Apr-2024 02:08                5481
function.variant-and.php                           13-Apr-2024 02:08                7603
function.variant-cast.php                          13-Apr-2024 02:08                3566
function.variant-cat.php                           13-Apr-2024 02:08                4769
function.variant-cmp.php                           13-Apr-2024 02:08                8146
function.variant-date-from-timestamp.php           13-Apr-2024 02:08                3756
function.variant-date-to-timestamp.php             13-Apr-2024 02:08                3835
function.variant-div.php                           13-Apr-2024 02:08                6519
function.variant-eqv.php                           13-Apr-2024 02:08                4488
function.variant-fix.php                           13-Apr-2024 02:08                5469
function.variant-get-type.php                      13-Apr-2024 02:08                3545
function.variant-idiv.php                          13-Apr-2024 02:08                5797
function.variant-imp.php                           13-Apr-2024 02:08                7130
function.variant-int.php                           13-Apr-2024 02:08                5020
function.variant-mod.php                           13-Apr-2024 02:08                4885
function.variant-mul.php                           13-Apr-2024 02:08                5889
function.variant-neg.php                           13-Apr-2024 02:08                3906
function.variant-not.php                           13-Apr-2024 02:08                4167
function.variant-or.php                            13-Apr-2024 02:08                7766
function.variant-pow.php                           13-Apr-2024 02:08                4638
function.variant-round.php                         13-Apr-2024 02:08                4549
function.variant-set-type.php                      13-Apr-2024 02:08                3687
function.variant-set.php                           13-Apr-2024 02:08                2882
function.variant-sub.php                           13-Apr-2024 02:08                5443
function.variant-xor.php                           13-Apr-2024 02:08                6524
function.version-compare.php                       13-Apr-2024 02:08               11749
function.vfprintf.php                              13-Apr-2024 02:08               21019
function.virtual.php                               13-Apr-2024 02:08                5482
function.vprintf.php                               13-Apr-2024 02:08               20198
function.vsprintf.php                              13-Apr-2024 02:08               20263
function.wddx-add-vars.php                         13-Apr-2024 02:08                3870
function.wddx-deserialize.php                      13-Apr-2024 02:08                3679
function.wddx-packet-end.php                       13-Apr-2024 02:08                2895
function.wddx-packet-start.php                     13-Apr-2024 02:08                3095
function.wddx-serialize-value.php                  13-Apr-2024 02:08                3321
function.wddx-serialize-vars.php                   13-Apr-2024 02:08                6058
function.win32-continue-service.php                13-Apr-2024 02:08                6717
function.win32-create-service.php                  13-Apr-2024 02:08               29111
function.win32-delete-service.php                  13-Apr-2024 02:08                7159
function.win32-get-last-control-message.php        13-Apr-2024 02:08                8695
function.win32-pause-service.php                   13-Apr-2024 02:08                6713
function.win32-query-service-status.php            13-Apr-2024 02:08                8681
function.win32-send-custom-control.php             13-Apr-2024 02:08                7377
function.win32-set-service-exit-code.php           13-Apr-2024 02:08                5856
function.win32-set-service-exit-mode.php           13-Apr-2024 02:08                6004
function.win32-set-service-status.php              13-Apr-2024 02:08                9603
function.win32-start-service-ctrl-dispatcher.php   13-Apr-2024 02:08               11247
function.win32-start-service.php                   13-Apr-2024 02:08                6887
function.win32-stop-service.php                    13-Apr-2024 02:08                7139
function.wincache-fcache-fileinfo.php              13-Apr-2024 02:08                9292
function.wincache-fcache-meminfo.php               13-Apr-2024 02:08                7121
function.wincache-lock.php                         13-Apr-2024 02:08                8543
function.wincache-ocache-fileinfo.php              13-Apr-2024 02:08                9964
function.wincache-ocache-meminfo.php               13-Apr-2024 02:08                7320
function.wincache-refresh-if-changed.php           13-Apr-2024 02:08                7846
function.wincache-rplist-fileinfo.php              13-Apr-2024 02:08                7657
function.wincache-rplist-meminfo.php               13-Apr-2024 02:08                7236
function.wincache-scache-info.php                  13-Apr-2024 02:08                9575
function.wincache-scache-meminfo.php               13-Apr-2024 02:08                6723
function.wincache-ucache-add.php                   13-Apr-2024 02:08               13589
function.wincache-ucache-cas.php                   13-Apr-2024 02:08                6509
function.wincache-ucache-clear.php                 13-Apr-2024 02:08                7614
function.wincache-ucache-dec.php                   13-Apr-2024 02:08                6440
function.wincache-ucache-delete.php                13-Apr-2024 02:08               11422
function.wincache-ucache-exists.php                13-Apr-2024 02:08                6217
function.wincache-ucache-get.php                   13-Apr-2024 02:08               10592
function.wincache-ucache-inc.php                   13-Apr-2024 02:08                6432
function.wincache-ucache-info.php                  13-Apr-2024 02:08               11396
function.wincache-ucache-meminfo.php               13-Apr-2024 02:08                6912
function.wincache-ucache-set.php                   13-Apr-2024 02:08               13655
function.wincache-unlock.php                       13-Apr-2024 02:08                7805
function.wordwrap.php                              13-Apr-2024 02:08                9371
function.xattr-get.php                             13-Apr-2024 02:08                6206
function.xattr-list.php                            13-Apr-2024 02:08                6644
function.xattr-remove.php                          13-Apr-2024 02:08                6495
function.xattr-set.php                             13-Apr-2024 02:08                8218
function.xattr-supported.php                       13-Apr-2024 02:08                5510
function.xdiff-file-bdiff-size.php                 13-Apr-2024 02:08                4910
function.xdiff-file-bdiff.php                      13-Apr-2024 02:08                6183
function.xdiff-file-bpatch.php                     13-Apr-2024 02:08                6708
function.xdiff-file-diff-binary.php                13-Apr-2024 02:08                6631
function.xdiff-file-diff.php                       13-Apr-2024 02:08                7735
function.xdiff-file-merge3.php                     13-Apr-2024 02:08                6936
function.xdiff-file-patch-binary.php               13-Apr-2024 02:08                6894
function.xdiff-file-patch.php                      13-Apr-2024 02:08                9165
function.xdiff-file-rabdiff.php                    13-Apr-2024 02:08                6612
function.xdiff-string-bdiff-size.php               13-Apr-2024 02:08                5250
function.xdiff-string-bdiff.php                    13-Apr-2024 02:08                3922
function.xdiff-string-bpatch.php                   13-Apr-2024 02:08                4048
function.xdiff-string-diff-binary.php              13-Apr-2024 02:08                4522
function.xdiff-string-diff.php                     13-Apr-2024 02:08                6789
function.xdiff-string-merge3.php                   13-Apr-2024 02:08                5032
function.xdiff-string-patch-binary.php             13-Apr-2024 02:08                4611
function.xdiff-string-patch.php                    13-Apr-2024 02:08                8428
function.xdiff-string-rabdiff.php                  13-Apr-2024 02:08                4497
function.xhprof-disable.php                        13-Apr-2024 02:08                3992
function.xhprof-enable.php                         13-Apr-2024 02:08                7175
function.xhprof-sample-disable.php                 13-Apr-2024 02:08                4672
function.xhprof-sample-enable.php                  13-Apr-2024 02:08                3541
function.xml-error-string.php                      13-Apr-2024 02:08                3460
function.xml-get-current-byte-index.php            13-Apr-2024 02:08                4945
function.xml-get-current-column-number.php         13-Apr-2024 02:08                4844
function.xml-get-current-line-number.php           13-Apr-2024 02:08                4631
function.xml-get-error-code.php                    13-Apr-2024 02:08                4124
function.xml-parse-into-struct.php                 13-Apr-2024 02:08               19316
function.xml-parse.php                             13-Apr-2024 02:08                8534
function.xml-parser-create-ns.php                  13-Apr-2024 02:08                5532
function.xml-parser-create.php                     13-Apr-2024 02:08                5365
function.xml-parser-free.php                       13-Apr-2024 02:08                4213
function.xml-parser-get-option.php                 13-Apr-2024 02:08                6143
function.xml-parser-set-option.php                 13-Apr-2024 02:08                8132
function.xml-set-character-data-handler.php        13-Apr-2024 02:08                5905
function.xml-set-default-handler.php               13-Apr-2024 02:08                5817
function.xml-set-element-handler.php               13-Apr-2024 02:08                8460
function.xml-set-end-namespace-decl-handler.php    13-Apr-2024 02:08                6617
function.xml-set-external-entity-ref-handler.php   13-Apr-2024 02:08                8680
function.xml-set-notation-decl-handler.php         13-Apr-2024 02:08                8209
function.xml-set-object.php                        13-Apr-2024 02:08                9649
function.xml-set-processing-instruction-handler..> 13-Apr-2024 02:08                6832
function.xml-set-start-namespace-decl-handler.php  13-Apr-2024 02:08                6886
function.xml-set-unparsed-entity-decl-handler.php  13-Apr-2024 02:08                9403
function.xmlrpc-decode-request.php                 13-Apr-2024 02:08                2795
function.xmlrpc-decode.php                         13-Apr-2024 02:08                4261
function.xmlrpc-encode-request.php                 13-Apr-2024 02:08                9288
function.xmlrpc-encode.php                         13-Apr-2024 02:08                2363
function.xmlrpc-get-type.php                       13-Apr-2024 02:08                6393
function.xmlrpc-is-fault.php                       13-Apr-2024 02:08                4008
function.xmlrpc-parse-method-descriptions.php      13-Apr-2024 02:08                2573
function.xmlrpc-server-add-introspection-data.php  13-Apr-2024 02:08                2767
function.xmlrpc-server-call-method.php             13-Apr-2024 02:08                3196
function.xmlrpc-server-create.php                  13-Apr-2024 02:08                2281
function.xmlrpc-server-destroy.php                 13-Apr-2024 02:08                2508
function.xmlrpc-server-register-introspection-c..> 13-Apr-2024 02:08                2827
function.xmlrpc-server-register-method.php         13-Apr-2024 02:08                2915
function.xmlrpc-set-type.php                       13-Apr-2024 02:08                5692
function.xmlwriter-writeattribute.php              13-Apr-2024 02:08                9304
function.yaml-emit-file.php                        13-Apr-2024 02:08                6742
function.yaml-emit.php                             13-Apr-2024 02:08               12330
function.yaml-parse-file.php                       13-Apr-2024 02:08                6074
function.yaml-parse-url.php                        13-Apr-2024 02:08                6402
function.yaml-parse.php                            13-Apr-2024 02:08                9934
function.yaz-addinfo.php                           13-Apr-2024 02:08                3435
function.yaz-ccl-conf.php                          13-Apr-2024 02:08                5808
function.yaz-ccl-parse.php                         13-Apr-2024 02:08                7033
function.yaz-close.php                             13-Apr-2024 02:08                3604
function.yaz-connect.php                           13-Apr-2024 02:08                9564
function.yaz-database.php                          13-Apr-2024 02:08                3527
function.yaz-element.php                           13-Apr-2024 02:08                3942
function.yaz-errno.php                             13-Apr-2024 02:08                3761
function.yaz-error.php                             13-Apr-2024 02:08                3415
function.yaz-es-result.php                         13-Apr-2024 02:08                3330
function.yaz-es.php                                13-Apr-2024 02:08                7369
function.yaz-get-option.php                        13-Apr-2024 02:08                3437
function.yaz-hits.php                              13-Apr-2024 02:08                5722
function.yaz-itemorder.php                         13-Apr-2024 02:08                7534
function.yaz-present.php                           13-Apr-2024 02:08                3054
function.yaz-range.php                             13-Apr-2024 02:08                3659
function.yaz-record.php                            13-Apr-2024 02:08               14449
function.yaz-scan-result.php                       13-Apr-2024 02:08                4052
function.yaz-scan.php                              13-Apr-2024 02:08                9545
function.yaz-schema.php                            13-Apr-2024 02:08                3443
function.yaz-search.php                            13-Apr-2024 02:08                9506
function.yaz-set-option.php                        13-Apr-2024 02:08                7506
function.yaz-sort.php                              13-Apr-2024 02:08                5824
function.yaz-syntax.php                            13-Apr-2024 02:08                3463
function.yaz-wait.php                              13-Apr-2024 02:08                4310
function.zend-thread-id.php                        13-Apr-2024 02:08                3761
function.zend-version.php                          13-Apr-2024 02:08                3999
function.zip-close.php                             13-Apr-2024 02:08                3974
function.zip-entry-close.php                       13-Apr-2024 02:08                4209
function.zip-entry-compressedsize.php              13-Apr-2024 02:08                4548
function.zip-entry-compressionmethod.php           13-Apr-2024 02:08                4623
function.zip-entry-filesize.php                    13-Apr-2024 02:08                4434
function.zip-entry-name.php                        13-Apr-2024 02:08                4345
function.zip-entry-open.php                        13-Apr-2024 02:08                5911
function.zip-entry-read.php                        13-Apr-2024 02:08                5134
function.zip-open.php                              13-Apr-2024 02:08                4579
function.zip-read.php                              13-Apr-2024 02:08                4743
function.zlib-decode.php                           13-Apr-2024 02:08                3457
function.zlib-encode.php                           13-Apr-2024 02:08                5372
function.zlib-get-coding-type.php                  13-Apr-2024 02:08                2956
function.zookeeper-dispatch.php                    13-Apr-2024 02:08                8316
functional.parallel.php                            13-Apr-2024 02:08                2547
functions.anonymous.php                            13-Apr-2024 02:08               23821
functions.arguments.php                            13-Apr-2024 02:08               44658
functions.arrow.php                                13-Apr-2024 02:08               10367
functions.first_class_callable_syntax.php          13-Apr-2024 02:08               11515
functions.internal.php                             13-Apr-2024 02:08                8310
functions.returning-values.php                     13-Apr-2024 02:08                5926
functions.user-defined.php                         13-Apr-2024 02:08                9382
functions.variable-functions.php                   13-Apr-2024 02:08               11559
gearman.configuration.php                          13-Apr-2024 02:08                1264
gearman.constants.php                              13-Apr-2024 02:08               23834
gearman.examples-reverse-bg.php                    13-Apr-2024 02:08               10664
gearman.examples-reverse-task.php                  13-Apr-2024 02:08               17313
gearman.examples-reverse.php                       13-Apr-2024 02:08               12744
gearman.examples.php                               13-Apr-2024 02:08                1562
gearman.installation.php                           13-Apr-2024 02:08                1542
gearman.requirements.php                           13-Apr-2024 02:08                1468
gearman.resources.php                              13-Apr-2024 02:08                1245
gearman.setup.php                                  13-Apr-2024 02:08                1579
gearmanclient.addoptions.php                       13-Apr-2024 02:08                3326
gearmanclient.addserver.php                        13-Apr-2024 02:08                5458
gearmanclient.addservers.php                       13-Apr-2024 02:08                4910
gearmanclient.addtask.php                          13-Apr-2024 02:08               15145
gearmanclient.addtaskbackground.php                13-Apr-2024 02:08               20905
gearmanclient.addtaskhigh.php                      13-Apr-2024 02:08               11653
gearmanclient.addtaskhighbackground.php            13-Apr-2024 02:08                6566
gearmanclient.addtasklow.php                       13-Apr-2024 02:08               11635
gearmanclient.addtasklowbackground.php             13-Apr-2024 02:08                6559
gearmanclient.addtaskstatus.php                    13-Apr-2024 02:08                9808
gearmanclient.clearcallbacks.php                   13-Apr-2024 02:08                4352
gearmanclient.clone.php                            13-Apr-2024 02:08                2644
gearmanclient.construct.php                        13-Apr-2024 02:08                2826
gearmanclient.context.php                          13-Apr-2024 02:08                2894
gearmanclient.data.php                             13-Apr-2024 02:08                3164
gearmanclient.do.php                               13-Apr-2024 02:08               22164
gearmanclient.dobackground.php                     13-Apr-2024 02:08                9654
gearmanclient.dohigh.php                           13-Apr-2024 02:08                5110
gearmanclient.dohighbackground.php                 13-Apr-2024 02:08                4937
gearmanclient.dojobhandle.php                      13-Apr-2024 02:08                2951
gearmanclient.dolow.php                            13-Apr-2024 02:08                5096
gearmanclient.dolowbackground.php                  13-Apr-2024 02:08                4919
gearmanclient.donormal.php                         13-Apr-2024 02:08               22732
gearmanclient.dostatus.php                         13-Apr-2024 02:08                8130
gearmanclient.echo.php                             13-Apr-2024 02:08                2981
gearmanclient.error.php                            13-Apr-2024 02:08                2886
gearmanclient.geterrno.php                         13-Apr-2024 02:08                2661
gearmanclient.jobstatus.php                        13-Apr-2024 02:08                8319
gearmanclient.ping.php                             13-Apr-2024 02:08                2954
gearmanclient.removeoptions.php                    13-Apr-2024 02:08                2674
gearmanclient.returncode.php                       13-Apr-2024 02:08                2300
gearmanclient.runtasks.php                         13-Apr-2024 02:08                3720
gearmanclient.setclientcallback.php                13-Apr-2024 02:08                5366
gearmanclient.setcompletecallback.php              13-Apr-2024 02:08                5247
gearmanclient.setcontext.php                       13-Apr-2024 02:08                3223
gearmanclient.setcreatedcallback.php               13-Apr-2024 02:08                4786
gearmanclient.setdata.php                          13-Apr-2024 02:08                3426
gearmanclient.setdatacallback.php                  13-Apr-2024 02:08                4771
gearmanclient.setexceptioncallback.php             13-Apr-2024 02:08                4691
gearmanclient.setfailcallback.php                  13-Apr-2024 02:08                4777
gearmanclient.setoptions.php                       13-Apr-2024 02:08                2660
gearmanclient.setstatuscallback.php                13-Apr-2024 02:08                4777
gearmanclient.settimeout.php                       13-Apr-2024 02:08                2704
gearmanclient.setwarningcallback.php               13-Apr-2024 02:08                4780
gearmanclient.setworkloadcallback.php              13-Apr-2024 02:08                4934
gearmanclient.timeout.php                          13-Apr-2024 02:08                2756
gearmanclient.wait.php                             13-Apr-2024 02:08                2803
gearmanjob.complete.php                            13-Apr-2024 02:08                3589
gearmanjob.construct.php                           13-Apr-2024 02:08                2334
gearmanjob.data.php                                13-Apr-2024 02:08                3549
gearmanjob.exception.php                           13-Apr-2024 02:08                3756
gearmanjob.fail.php                                13-Apr-2024 02:08                3686
gearmanjob.functionname.php                        13-Apr-2024 02:08                2932
gearmanjob.handle.php                              13-Apr-2024 02:08                2819
gearmanjob.returncode.php                          13-Apr-2024 02:08                2616
gearmanjob.sendcomplete.php                        13-Apr-2024 02:08                3305
gearmanjob.senddata.php                            13-Apr-2024 02:08                3272
gearmanjob.sendexception.php                       13-Apr-2024 02:08                3485
gearmanjob.sendfail.php                            13-Apr-2024 02:08                3400
gearmanjob.sendstatus.php                          13-Apr-2024 02:08                4000
gearmanjob.sendwarning.php                         13-Apr-2024 02:08                3481
gearmanjob.setreturn.php                           13-Apr-2024 02:08                2546
gearmanjob.status.php                              13-Apr-2024 02:08                4286
gearmanjob.unique.php                              13-Apr-2024 02:08                3056
gearmanjob.warning.php                             13-Apr-2024 02:08                3767
gearmanjob.workload.php                            13-Apr-2024 02:08                2814
gearmanjob.workloadsize.php                        13-Apr-2024 02:08                2632
gearmantask.construct.php                          13-Apr-2024 02:08                2359
gearmantask.create.php                             13-Apr-2024 02:08                2808
gearmantask.data.php                               13-Apr-2024 02:08                2793
gearmantask.datasize.php                           13-Apr-2024 02:08                2816
gearmantask.function.php                           13-Apr-2024 02:08                2649
gearmantask.functionname.php                       13-Apr-2024 02:08                2581
gearmantask.isknown.php                            13-Apr-2024 02:08                2457
gearmantask.isrunning.php                          13-Apr-2024 02:08                2457
gearmantask.jobhandle.php                          13-Apr-2024 02:08                2965
gearmantask.recvdata.php                           13-Apr-2024 02:08                3498
gearmantask.returncode.php                         13-Apr-2024 02:08                2643
gearmantask.senddata.php                           13-Apr-2024 02:08                3311
gearmantask.sendworkload.php                       13-Apr-2024 02:08                3460
gearmantask.taskdenominator.php                    13-Apr-2024 02:08                3009
gearmantask.tasknumerator.php                      13-Apr-2024 02:08                2981
gearmantask.unique.php                             13-Apr-2024 02:08                3226
gearmantask.uuid.php                               13-Apr-2024 02:08                3404
gearmanworker.addfunction.php                      13-Apr-2024 02:08                7896
gearmanworker.addoptions.php                       13-Apr-2024 02:08                3384
gearmanworker.addserver.php                        13-Apr-2024 02:08                5185
gearmanworker.addservers.php                       13-Apr-2024 02:08                4632
gearmanworker.clone.php                            13-Apr-2024 02:08                2315
gearmanworker.construct.php                        13-Apr-2024 02:08                2799
gearmanworker.echo.php                             13-Apr-2024 02:08                3017
gearmanworker.error.php                            13-Apr-2024 02:08                2853
gearmanworker.geterrno.php                         13-Apr-2024 02:08                2628
gearmanworker.options.php                          13-Apr-2024 02:08                2635
gearmanworker.register.php                         13-Apr-2024 02:08                3774
gearmanworker.removeoptions.php                    13-Apr-2024 02:08                3406
gearmanworker.returncode.php                       13-Apr-2024 02:08                2823
gearmanworker.setid.php                            13-Apr-2024 02:08                4082
gearmanworker.setoptions.php                       13-Apr-2024 02:08                3539
gearmanworker.settimeout.php                       13-Apr-2024 02:08                7785
gearmanworker.timeout.php                          13-Apr-2024 02:08                2735
gearmanworker.unregister.php                       13-Apr-2024 02:08                3338
gearmanworker.unregisterall.php                    13-Apr-2024 02:08                2999
gearmanworker.wait.php                             13-Apr-2024 02:08                7878
gearmanworker.work.php                             13-Apr-2024 02:08                5580
gender-gender.connect.php                          13-Apr-2024 02:08                2544
gender-gender.construct.php                        13-Apr-2024 02:08                2396
gender-gender.country.php                          13-Apr-2024 02:08                3806
gender-gender.get.php                              13-Apr-2024 02:08                2860
gender-gender.isnick.php                           13-Apr-2024 02:08                3472
gender-gender.similarnames.php                     13-Apr-2024 02:08                2973
gender.example.admin.php                           13-Apr-2024 02:08                8049
gender.examples.php                                13-Apr-2024 02:08                1329
gender.installation.php                            13-Apr-2024 02:08                1901
gender.setup.php                                   13-Apr-2024 02:08                1326
generator.current.php                              13-Apr-2024 02:08                2112
generator.getreturn.php                            13-Apr-2024 02:08                3832
generator.key.php                                  13-Apr-2024 02:08                3924
generator.next.php                                 13-Apr-2024 02:08                2471
generator.rewind.php                               13-Apr-2024 02:08                2179
generator.send.php                                 13-Apr-2024 02:08                5601
generator.throw.php                                13-Apr-2024 02:08                5025
generator.valid.php                                13-Apr-2024 02:08                2286
generator.wakeup.php                               13-Apr-2024 02:08                2186
geoip.configuration.php                            13-Apr-2024 02:08                2557
geoip.constants.php                                13-Apr-2024 02:08                6281
geoip.installation.php                             13-Apr-2024 02:08                1659
geoip.requirements.php                             13-Apr-2024 02:08                1671
geoip.resources.php                                13-Apr-2024 02:08                1201
geoip.setup.php                                    13-Apr-2024 02:08                1540
gettext.configuration.php                          13-Apr-2024 02:08                1264
gettext.constants.php                              13-Apr-2024 02:08                1151
gettext.installation.php                           13-Apr-2024 02:08                1410
gettext.requirements.php                           13-Apr-2024 02:08                1359
gettext.resources.php                              13-Apr-2024 02:08                1215
gettext.setup.php                                  13-Apr-2024 02:08                1584
getting-started.php                                13-Apr-2024 02:08                1889
globiterator.construct.php                         13-Apr-2024 02:08                7693
globiterator.count.php                             13-Apr-2024 02:08                4471
gmagick.addimage.php                               13-Apr-2024 02:08                2859
gmagick.addnoiseimage.php                          13-Apr-2024 02:08                2914
gmagick.annotateimage.php                          13-Apr-2024 02:08                4449
gmagick.blurimage.php                              13-Apr-2024 02:08                3310
gmagick.borderimage.php                            13-Apr-2024 02:08                3759
gmagick.charcoalimage.php                          13-Apr-2024 02:08                3260
gmagick.chopimage.php                              13-Apr-2024 02:08                3912
gmagick.clear.php                                  13-Apr-2024 02:08                2612
gmagick.commentimage.php                           13-Apr-2024 02:08                2861
gmagick.compositeimage.php                         13-Apr-2024 02:08                4075
gmagick.configuration.php                          13-Apr-2024 02:08                1263
gmagick.constants.php                              13-Apr-2024 02:08              103150
gmagick.construct.php                              13-Apr-2024 02:08                2616
gmagick.cropimage.php                              13-Apr-2024 02:08                4047
gmagick.cropthumbnailimage.php                     13-Apr-2024 02:08                3297
gmagick.current.php                                13-Apr-2024 02:08                2513
gmagick.cyclecolormapimage.php                     13-Apr-2024 02:08                2987
gmagick.deconstructimages.php                      13-Apr-2024 02:08                2761
gmagick.despeckleimage.php                         13-Apr-2024 02:08                3455
gmagick.destroy.php                                13-Apr-2024 02:08                2752
gmagick.drawimage.php                              13-Apr-2024 02:08                2983
gmagick.edgeimage.php                              13-Apr-2024 02:08                2930
gmagick.embossimage.php                            13-Apr-2024 02:08                3438
gmagick.enhanceimage.php                           13-Apr-2024 02:08                2623
gmagick.equalizeimage.php                          13-Apr-2024 02:08                2582
gmagick.examples.php                               13-Apr-2024 02:08                3374
gmagick.flipimage.php                              13-Apr-2024 02:08                2925
gmagick.flopimage.php                              13-Apr-2024 02:08                2922
gmagick.frameimage.php                             13-Apr-2024 02:08                4584
gmagick.gammaimage.php                             13-Apr-2024 02:08                3141
gmagick.getcopyright.php                           13-Apr-2024 02:08                2604
gmagick.getfilename.php                            13-Apr-2024 02:08                2554
gmagick.getimagebackgroundcolor.php                13-Apr-2024 02:08                2691
gmagick.getimageblueprimary.php                    13-Apr-2024 02:08                2989
gmagick.getimagebordercolor.php                    13-Apr-2024 02:08                2735
gmagick.getimagechanneldepth.php                   13-Apr-2024 02:08                2796
gmagick.getimagecolors.php                         13-Apr-2024 02:08                2590
gmagick.getimagecolorspace.php                     13-Apr-2024 02:08                2548
gmagick.getimagecompose.php                        13-Apr-2024 02:08                2628
gmagick.getimagedelay.php                          13-Apr-2024 02:08                2525
gmagick.getimagedepth.php                          13-Apr-2024 02:08                2495
gmagick.getimagedispose.php                        13-Apr-2024 02:08                2549
gmagick.getimageextrema.php                        13-Apr-2024 02:08                2774
gmagick.getimagefilename.php                       13-Apr-2024 02:08                2633
gmagick.getimageformat.php                         13-Apr-2024 02:08                2616
gmagick.getimagegamma.php                          13-Apr-2024 02:08                2516
gmagick.getimagegreenprimary.php                   13-Apr-2024 02:08                2735
gmagick.getimageheight.php                         13-Apr-2024 02:08                2547
gmagick.getimagehistogram.php                      13-Apr-2024 02:08                2908
gmagick.getimageindex.php                          13-Apr-2024 02:08                2678
gmagick.getimageinterlacescheme.php                13-Apr-2024 02:08                2666
gmagick.getimageiterations.php                     13-Apr-2024 02:08                2593
gmagick.getimagematte.php                          13-Apr-2024 02:08                2933
gmagick.getimagemattecolor.php                     13-Apr-2024 02:08                2641
gmagick.getimageprofile.php                        13-Apr-2024 02:08                2748
gmagick.getimageredprimary.php                     13-Apr-2024 02:08                2756
gmagick.getimagerenderingintent.php                13-Apr-2024 02:08                2677
gmagick.getimageresolution.php                     13-Apr-2024 02:08                2609
gmagick.getimagescene.php                          13-Apr-2024 02:08                2512
gmagick.getimagesignature.php                      13-Apr-2024 02:08                2627
gmagick.getimagetype.php                           13-Apr-2024 02:08                2519
gmagick.getimageunits.php                          13-Apr-2024 02:08                2265
gmagick.getimagewhitepoint.php                     13-Apr-2024 02:08                2732
gmagick.getimagewidth.php                          13-Apr-2024 02:08                2526
gmagick.getpackagename.php                         13-Apr-2024 02:08                2580
gmagick.getquantumdepth.php                        13-Apr-2024 02:08                2757
gmagick.getreleasedate.php                         13-Apr-2024 02:08                2614
gmagick.getsamplingfactors.php                     13-Apr-2024 02:08                2667
gmagick.getsize.php                                13-Apr-2024 02:08                2816
gmagick.getversion.php                             13-Apr-2024 02:08                2557
gmagick.hasnextimage.php                           13-Apr-2024 02:08                2914
gmagick.haspreviousimage.php                       13-Apr-2024 02:08                2958
gmagick.implodeimage.php                           13-Apr-2024 02:08                2970
gmagick.installation.php                           13-Apr-2024 02:08                1902
gmagick.labelimage.php                             13-Apr-2024 02:08                2739
gmagick.levelimage.php                             13-Apr-2024 02:08                4690
gmagick.magnifyimage.php                           13-Apr-2024 02:08                2608
gmagick.mapimage.php                               13-Apr-2024 02:08                3275
gmagick.medianfilterimage.php                      13-Apr-2024 02:08                3059
gmagick.minifyimage.php                            13-Apr-2024 02:08                2642
gmagick.modulateimage.php                          13-Apr-2024 02:08                3888
gmagick.motionblurimage.php                        13-Apr-2024 02:08                3913
gmagick.newimage.php                               13-Apr-2024 02:08                3935
gmagick.nextimage.php                              13-Apr-2024 02:08                2773
gmagick.normalizeimage.php                         13-Apr-2024 02:08                3015
gmagick.oilpaintimage.php                          13-Apr-2024 02:08                3031
gmagick.previousimage.php                          13-Apr-2024 02:08                2768
gmagick.profileimage.php                           13-Apr-2024 02:08                3589
gmagick.quantizeimage.php                          13-Apr-2024 02:08                5358
gmagick.quantizeimages.php                         13-Apr-2024 02:08                5361
gmagick.queryfontmetrics.php                       13-Apr-2024 02:08                2935
gmagick.queryfonts.php                             13-Apr-2024 02:08                2711
gmagick.queryformats.php                           13-Apr-2024 02:08                3109
gmagick.radialblurimage.php                        13-Apr-2024 02:08                3235
gmagick.raiseimage.php                             13-Apr-2024 02:08                4426
gmagick.read.php                                   13-Apr-2024 02:08                2754
gmagick.readimage.php                              13-Apr-2024 02:08                2804
gmagick.readimageblob.php                          13-Apr-2024 02:08                3227
gmagick.readimagefile.php                          13-Apr-2024 02:08                3104
gmagick.reducenoiseimage.php                       13-Apr-2024 02:08                3209
gmagick.removeimage.php                            13-Apr-2024 02:08                2590
gmagick.removeimageprofile.php                     13-Apr-2024 02:08                2916
gmagick.requirements.php                           13-Apr-2024 02:08                1631
gmagick.resampleimage.php                          13-Apr-2024 02:08                3938
gmagick.resizeimage.php                            13-Apr-2024 02:08                4275
gmagick.rollimage.php                              13-Apr-2024 02:08                3014
gmagick.rotateimage.php                            13-Apr-2024 02:08                3189
gmagick.scaleimage.php                             13-Apr-2024 02:08                3557
gmagick.separateimagechannel.php                   13-Apr-2024 02:08                3201
gmagick.setcompressionquality.php                  13-Apr-2024 02:08                4207
gmagick.setfilename.php                            13-Apr-2024 02:08                2934
gmagick.setimagebackgroundcolor.php                13-Apr-2024 02:08                3003
gmagick.setimageblueprimary.php                    13-Apr-2024 02:08                3297
gmagick.setimagebordercolor.php                    13-Apr-2024 02:08                2965
gmagick.setimagechanneldepth.php                   13-Apr-2024 02:08                3444
gmagick.setimagecolorspace.php                     13-Apr-2024 02:08                3086
gmagick.setimagecompose.php                        13-Apr-2024 02:08                2852
gmagick.setimagedelay.php                          13-Apr-2024 02:08                2866
gmagick.setimagedepth.php                          13-Apr-2024 02:08                2864
gmagick.setimagedispose.php                        13-Apr-2024 02:08                2908
gmagick.setimagefilename.php                       13-Apr-2024 02:08                2958
gmagick.setimageformat.php                         13-Apr-2024 02:08                2921
gmagick.setimagegamma.php                          13-Apr-2024 02:08                2858
gmagick.setimagegreenprimary.php                   13-Apr-2024 02:08                3305
gmagick.setimageindex.php                          13-Apr-2024 02:08                3005
gmagick.setimageinterlacescheme.php                13-Apr-2024 02:08                3152
gmagick.setimageiterations.php                     13-Apr-2024 02:08                2961
gmagick.setimageprofile.php                        13-Apr-2024 02:08                3394
gmagick.setimageredprimary.php                     13-Apr-2024 02:08                3208
gmagick.setimagerenderingintent.php                13-Apr-2024 02:08                3183
gmagick.setimageresolution.php                     13-Apr-2024 02:08                3202
gmagick.setimagescene.php                          13-Apr-2024 02:08                2854
gmagick.setimagetype.php                           13-Apr-2024 02:08                2979
gmagick.setimageunits.php                          13-Apr-2024 02:08                3038
gmagick.setimagewhitepoint.php                     13-Apr-2024 02:08                3234
gmagick.setsamplingfactors.php                     13-Apr-2024 02:08                3080
gmagick.setsize.php                                13-Apr-2024 02:08                3550
gmagick.setup.php                                  13-Apr-2024 02:08                1495
gmagick.shearimage.php                             13-Apr-2024 02:08                3932
gmagick.solarizeimage.php                          13-Apr-2024 02:08                3112
gmagick.spreadimage.php                            13-Apr-2024 02:08                2956
gmagick.stripimage.php                             13-Apr-2024 02:08                2570
gmagick.swirlimage.php                             13-Apr-2024 02:08                3037
gmagick.thumbnailimage.php                         13-Apr-2024 02:08                3868
gmagick.trimimage.php                              13-Apr-2024 02:08                3101
gmagick.write.php                                  13-Apr-2024 02:08                1705
gmagick.writeimage.php                             13-Apr-2024 02:08                3513
gmagickdraw.annotate.php                           13-Apr-2024 02:08                3174
gmagickdraw.arc.php                                13-Apr-2024 02:08                4334
gmagickdraw.bezier.php                             13-Apr-2024 02:08                2613
gmagickdraw.ellipse.php                            13-Apr-2024 02:08                4255
gmagickdraw.getfillcolor.php                       13-Apr-2024 02:08                2435
gmagickdraw.getfillopacity.php                     13-Apr-2024 02:08                2386
gmagickdraw.getfont.php                            13-Apr-2024 02:08                2377
gmagickdraw.getfontsize.php                        13-Apr-2024 02:08                2428
gmagickdraw.getfontstyle.php                       13-Apr-2024 02:08                2504
gmagickdraw.getfontweight.php                      13-Apr-2024 02:08                2349
gmagickdraw.getstrokecolor.php                     13-Apr-2024 02:08                2490
gmagickdraw.getstrokeopacity.php                   13-Apr-2024 02:08                2463
gmagickdraw.getstrokewidth.php                     13-Apr-2024 02:08                2482
gmagickdraw.gettextdecoration.php                  13-Apr-2024 02:08                2416
gmagickdraw.gettextencoding.php                    13-Apr-2024 02:08                2505
gmagickdraw.line.php                               13-Apr-2024 02:08                3618
gmagickdraw.point.php                              13-Apr-2024 02:08                2905
gmagickdraw.polygon.php                            13-Apr-2024 02:08                2680
gmagickdraw.polyline.php                           13-Apr-2024 02:08                2715
gmagickdraw.rectangle.php                          13-Apr-2024 02:08                3722
gmagickdraw.rotate.php                             13-Apr-2024 02:08                2671
gmagickdraw.roundrectangle.php                     13-Apr-2024 02:08                4499
gmagickdraw.scale.php                              13-Apr-2024 02:08                2969
gmagickdraw.setfillcolor.php                       13-Apr-2024 02:08                2931
gmagickdraw.setfillopacity.php                     13-Apr-2024 02:08                2769
gmagickdraw.setfont.php                            13-Apr-2024 02:08                2669
gmagickdraw.setfontsize.php                        13-Apr-2024 02:08                2699
gmagickdraw.setfontstyle.php                       13-Apr-2024 02:08                2830
gmagickdraw.setfontweight.php                      13-Apr-2024 02:08                2701
gmagickdraw.setstrokecolor.php                     13-Apr-2024 02:08                2955
gmagickdraw.setstrokeopacity.php                   13-Apr-2024 02:08                2787
gmagickdraw.setstrokewidth.php                     13-Apr-2024 02:08                2747
gmagickdraw.settextdecoration.php                  13-Apr-2024 02:08                2833
gmagickdraw.settextencoding.php                    13-Apr-2024 02:08                3041
gmagickpixel.construct.php                         13-Apr-2024 02:08                2542
gmagickpixel.getcolor.php                          13-Apr-2024 02:08                4333
gmagickpixel.getcolorcount.php                     13-Apr-2024 02:08                2477
gmagickpixel.getcolorvalue.php                     13-Apr-2024 02:08                2877
gmagickpixel.setcolor.php                          13-Apr-2024 02:08                3008
gmagickpixel.setcolorvalue.php                     13-Apr-2024 02:08                3287
gmp.configuration.php                              13-Apr-2024 02:08                1235
gmp.constants.php                                  13-Apr-2024 02:08                4155
gmp.construct.php                                  13-Apr-2024 02:08                3730
gmp.examples.php                                   13-Apr-2024 02:08                3017
gmp.installation.php                               13-Apr-2024 02:08                1305
gmp.requirements.php                               13-Apr-2024 02:08                1676
gmp.serialize.php                                  13-Apr-2024 02:08                2250
gmp.setup.php                                      13-Apr-2024 02:08                1457
gmp.unserialize.php                                13-Apr-2024 02:08                2554
gnupg.configuration.php                            13-Apr-2024 02:08                1248
gnupg.constants.php                                13-Apr-2024 02:08                9375
gnupg.examples-clearsign.php                       13-Apr-2024 02:08                6302
gnupg.examples.php                                 13-Apr-2024 02:08                1344
gnupg.installation.php                             13-Apr-2024 02:08                1523
gnupg.requirements.php                             13-Apr-2024 02:08                1235
gnupg.resources.php                                13-Apr-2024 02:08                1201
gnupg.setup.php                                    13-Apr-2024 02:08                1558
hash.configuration.php                             13-Apr-2024 02:08                1243
hash.constants.php                                 13-Apr-2024 02:08                1810
hash.installation.php                              13-Apr-2024 02:08                1711
hash.requirements.php                              13-Apr-2024 02:08                1187
hash.resources.php                                 13-Apr-2024 02:08                1320
hash.setup.php                                     13-Apr-2024 02:08                1539
hashcontext.construct.php                          13-Apr-2024 02:08                1906
hashcontext.serialize.php                          13-Apr-2024 02:08                2379
hashcontext.unserialize.php                        13-Apr-2024 02:08                2682
history.php                                        13-Apr-2024 02:08                2111
history.php.books.php                              13-Apr-2024 02:08                2546
history.php.php                                    13-Apr-2024 02:08               10758
history.php.publications.php                       13-Apr-2024 02:08                1783
history.php.related.php                            13-Apr-2024 02:08                5945
hrtime-performancecounter.getfrequency.php         13-Apr-2024 02:08                2733
hrtime-performancecounter.getticks.php             13-Apr-2024 02:08                2606
hrtime-performancecounter.gettickssince.php        13-Apr-2024 02:08                2906
hrtime-stopwatch.getelapsedticks.php               13-Apr-2024 02:08                2508
hrtime-stopwatch.getelapsedtime.php                13-Apr-2024 02:08                2901
hrtime-stopwatch.getlastelapsedticks.php           13-Apr-2024 02:08                2576
hrtime-stopwatch.getlastelapsedtime.php            13-Apr-2024 02:08                2925
hrtime-stopwatch.isrunning.php                     13-Apr-2024 02:08                2469
hrtime-stopwatch.start.php                         13-Apr-2024 02:08                2370
hrtime-stopwatch.stop.php                          13-Apr-2024 02:08                2249
hrtime.example.basic.php                           13-Apr-2024 02:08                5427
hrtime.examples.php                                13-Apr-2024 02:08                1323
hrtime.installation.php                            13-Apr-2024 02:08                1901
hrtime.setup.php                                   13-Apr-2024 02:08                1323
ibase.configuration.php                            13-Apr-2024 02:08                8512
ibase.constants.php                                13-Apr-2024 02:08               21326
ibase.installation.php                             13-Apr-2024 02:08                3352
ibase.requirements.php                             13-Apr-2024 02:08                1157
ibase.resources.php                                13-Apr-2024 02:08                1201
ibase.setup.php                                    13-Apr-2024 02:08                1576
ibm-db2.configuration.php                          13-Apr-2024 02:08               21640
ibm-db2.constants.php                              13-Apr-2024 02:08                9069
ibm-db2.installation.php                           13-Apr-2024 02:08                3477
ibm-db2.requirements.php                           13-Apr-2024 02:08                3174
ibm-db2.resources.php                              13-Apr-2024 02:08                1267
ibm-db2.setup.php                                  13-Apr-2024 02:08                1588
iconv.configuration.php                            13-Apr-2024 02:08                4711
iconv.constants.php                                13-Apr-2024 02:08                3697
iconv.installation.php                             13-Apr-2024 02:08                1589
iconv.requirements.php                             13-Apr-2024 02:08                1461
iconv.resources.php                                13-Apr-2024 02:08                1201
iconv.setup.php                                    13-Apr-2024 02:08                1566
igbinary.configuration.php                         13-Apr-2024 02:08                3588
igbinary.installation.php                          13-Apr-2024 02:08                1910
igbinary.requirements.php                          13-Apr-2024 02:08                1178
igbinary.setup.php                                 13-Apr-2024 02:08                1502
image.configuration.php                            13-Apr-2024 02:08                3592
image.constants.php                                13-Apr-2024 02:08               52642
image.examples-png.php                             13-Apr-2024 02:08                4667
image.examples-watermark.php                       13-Apr-2024 02:08                5958
image.examples.merged-watermark.php                13-Apr-2024 02:08                8784
image.examples.php                                 13-Apr-2024 02:08                1595
image.installation.php                             13-Apr-2024 02:08                6602
image.requirements.php                             13-Apr-2024 02:08                4624
image.resources.php                                13-Apr-2024 02:08                2097
image.setup.php                                    13-Apr-2024 02:08                1561
imagick.adaptiveblurimage.php                      13-Apr-2024 02:08                6923
imagick.adaptiveresizeimage.php                    13-Apr-2024 02:08                9738
imagick.adaptivesharpenimage.php                   13-Apr-2024 02:08                6457
imagick.adaptivethresholdimage.php                 13-Apr-2024 02:08                6249
imagick.addimage.php                               13-Apr-2024 02:08                3248
imagick.addnoiseimage.php                          13-Apr-2024 02:08                5576
imagick.affinetransformimage.php                   13-Apr-2024 02:08                6672
imagick.animateimages.php                          13-Apr-2024 02:08                3242
imagick.annotateimage.php                          13-Apr-2024 02:08                8831
imagick.appendimages.php                           13-Apr-2024 02:08                6989
imagick.autolevelimage.php                         13-Apr-2024 02:08                4446
imagick.averageimages.php                          13-Apr-2024 02:08                2834
imagick.blackthresholdimage.php                    13-Apr-2024 02:08                5636
imagick.blueshiftimage.php                         13-Apr-2024 02:08                4491
imagick.blurimage.php                              13-Apr-2024 02:08                6222
imagick.borderimage.php                            13-Apr-2024 02:08                6447
imagick.brightnesscontrastimage.php                13-Apr-2024 02:08                5651
imagick.charcoalimage.php                          13-Apr-2024 02:08                5000
imagick.chopimage.php                              13-Apr-2024 02:08                7150
imagick.clampimage.php                             13-Apr-2024 02:08                2717
imagick.clear.php                                  13-Apr-2024 02:08                2445
imagick.clipimage.php                              13-Apr-2024 02:08                2728
imagick.clipimagepath.php                          13-Apr-2024 02:08                3130
imagick.clippathimage.php                          13-Apr-2024 02:08                3621
imagick.clone.php                                  13-Apr-2024 02:08                4635
imagick.clutimage.php                              13-Apr-2024 02:08                6380
imagick.coalesceimages.php                         13-Apr-2024 02:08                3147
imagick.colorfloodfillimage.php                    13-Apr-2024 02:08                5791
imagick.colorizeimage.php                          13-Apr-2024 02:08                7042
imagick.colormatriximage.php                       13-Apr-2024 02:08                7614
imagick.combineimages.php                          13-Apr-2024 02:08                3329
imagick.commentimage.php                           13-Apr-2024 02:08                5128
imagick.compareimagechannels.php                   13-Apr-2024 02:08                4209
imagick.compareimagelayers.php                     13-Apr-2024 02:08                5813
imagick.compareimages.php                          13-Apr-2024 02:08                5779
imagick.compositeimage.php                         13-Apr-2024 02:08                8413
imagick.configuration.php                          13-Apr-2024 02:08                4716
imagick.constants.php                              13-Apr-2024 02:08              163215
imagick.construct.php                              13-Apr-2024 02:08                2685
imagick.contrastimage.php                          13-Apr-2024 02:08                5173
imagick.contraststretchimage.php                   13-Apr-2024 02:08                3823
imagick.convolveimage.php                          13-Apr-2024 02:08                5938
imagick.count.php                                  13-Apr-2024 02:08                2698
imagick.cropimage.php                              13-Apr-2024 02:08                3958
imagick.cropthumbnailimage.php                     13-Apr-2024 02:08                3680
imagick.current.php                                13-Apr-2024 02:08                2587
imagick.cyclecolormapimage.php                     13-Apr-2024 02:08                3120
imagick.decipherimage.php                          13-Apr-2024 02:08                3298
imagick.deconstructimages.php                      13-Apr-2024 02:08                2834
imagick.deleteimageartifact.php                    13-Apr-2024 02:08                3767
imagick.deleteimageproperty.php                    13-Apr-2024 02:08                2639
imagick.deskewimage.php                            13-Apr-2024 02:08               11028
imagick.despeckleimage.php                         13-Apr-2024 02:08                4348
imagick.destroy.php                                13-Apr-2024 02:08                2567
imagick.displayimage.php                           13-Apr-2024 02:08                2889
imagick.displayimages.php                          13-Apr-2024 02:08                2916
imagick.distortimage.php                           13-Apr-2024 02:08               12349
imagick.drawimage.php                              13-Apr-2024 02:08                2718
imagick.edgeimage.php                              13-Apr-2024 02:08                4926
imagick.embossimage.php                            13-Apr-2024 02:08                5705
imagick.encipherimage.php                          13-Apr-2024 02:08                3344
imagick.enhanceimage.php                           13-Apr-2024 02:08                4478
imagick.equalizeimage.php                          13-Apr-2024 02:08                4298
imagick.evaluateimage.php                          13-Apr-2024 02:08                5983
imagick.examples-1.php                             13-Apr-2024 02:08               30506
imagick.examples.php                               13-Apr-2024 02:08                1354
imagick.exportimagepixels.php                      13-Apr-2024 02:08                8026
imagick.extentimage.php                            13-Apr-2024 02:08                5563
imagick.filter.php                                 13-Apr-2024 02:08                7435
imagick.flattenimages.php                          13-Apr-2024 02:08                3030
imagick.flipimage.php                              13-Apr-2024 02:08                4685
imagick.floodfillpaintimage.php                    13-Apr-2024 02:08               11698
imagick.flopimage.php                              13-Apr-2024 02:08                4831
imagick.forwardfouriertransformimage.php           13-Apr-2024 02:08               12078
imagick.frameimage.php                             13-Apr-2024 02:08                8724
imagick.functionimage.php                          13-Apr-2024 02:08               13824
imagick.fximage.php                                13-Apr-2024 02:08                6074
imagick.gammaimage.php                             13-Apr-2024 02:08                5650
imagick.gaussianblurimage.php                      13-Apr-2024 02:08                6615
imagick.getcolorspace.php                          13-Apr-2024 02:08                2465
imagick.getcompression.php                         13-Apr-2024 02:08                2443
imagick.getcompressionquality.php                  13-Apr-2024 02:08                2390
imagick.getcopyright.php                           13-Apr-2024 02:08                2311
imagick.getfilename.php                            13-Apr-2024 02:08                2710
imagick.getfont.php                                13-Apr-2024 02:08                3227
imagick.getformat.php                              13-Apr-2024 02:08                2758
imagick.getgravity.php                             13-Apr-2024 02:08                2448
imagick.gethomeurl.php                             13-Apr-2024 02:08                2291
imagick.getimage.php                               13-Apr-2024 02:08                2771
imagick.getimagealphachannel.php                   13-Apr-2024 02:08                3622
imagick.getimageartifact.php                       13-Apr-2024 02:08                3655
imagick.getimageattribute.php                      13-Apr-2024 02:08                2798
imagick.getimagebackgroundcolor.php                13-Apr-2024 02:08                2785
imagick.getimageblob.php                           13-Apr-2024 02:08                2895
imagick.getimageblueprimary.php                    13-Apr-2024 02:08                2644
imagick.getimagebordercolor.php                    13-Apr-2024 02:08                2791
imagick.getimagechanneldepth.php                   13-Apr-2024 02:08                3034
imagick.getimagechanneldistortion.php              13-Apr-2024 02:08                4160
imagick.getimagechanneldistortions.php             13-Apr-2024 02:08                4424
imagick.getimagechannelextrema.php                 13-Apr-2024 02:08                3782
imagick.getimagechannelkurtosis.php                13-Apr-2024 02:08                3559
imagick.getimagechannelmean.php                    13-Apr-2024 02:08                3340
imagick.getimagechannelrange.php                   13-Apr-2024 02:08                3412
imagick.getimagechannelstatistics.php              13-Apr-2024 02:08                2597
imagick.getimageclipmask.php                       13-Apr-2024 02:08                3267
imagick.getimagecolormapcolor.php                  13-Apr-2024 02:08                3094
imagick.getimagecolors.php                         13-Apr-2024 02:08                2381
imagick.getimagecolorspace.php                     13-Apr-2024 02:08                2424
imagick.getimagecompose.php                        13-Apr-2024 02:08                2444
imagick.getimagecompression.php                    13-Apr-2024 02:08                2521
imagick.getimagecompressionquality.php             13-Apr-2024 02:08                2527
imagick.getimagedelay.php                          13-Apr-2024 02:08                2722
imagick.getimagedepth.php                          13-Apr-2024 02:08                2281
imagick.getimagedispose.php                        13-Apr-2024 02:08                2736
imagick.getimagedistortion.php                     13-Apr-2024 02:08                3600
imagick.getimageextrema.php                        13-Apr-2024 02:08                2989
imagick.getimagefilename.php                       13-Apr-2024 02:08                2727
imagick.getimageformat.php                         13-Apr-2024 02:08                2694
imagick.getimagegamma.php                          13-Apr-2024 02:08                2575
imagick.getimagegeometry.php                       13-Apr-2024 02:08                4245
imagick.getimagegravity.php                        13-Apr-2024 02:08                2737
imagick.getimagegreenprimary.php                   13-Apr-2024 02:08                3002
imagick.getimageheight.php                         13-Apr-2024 02:08                2605
imagick.getimagehistogram.php                      13-Apr-2024 02:08               17491
imagick.getimageindex.php                          13-Apr-2024 02:08                3200
imagick.getimageinterlacescheme.php                13-Apr-2024 02:08                2676
imagick.getimageinterpolatemethod.php              13-Apr-2024 02:08                2814
imagick.getimageiterations.php                     13-Apr-2024 02:08                2662
imagick.getimagelength.php                         13-Apr-2024 02:08                3435
imagick.getimagematte.php                          13-Apr-2024 02:08                3034
imagick.getimagemattecolor.php                     13-Apr-2024 02:08                3024
imagick.getimagemimetype.php                       13-Apr-2024 02:08                2273
imagick.getimageorientation.php                    13-Apr-2024 02:08                2730
imagick.getimagepage.php                           13-Apr-2024 02:08                2779
imagick.getimagepixelcolor.php                     13-Apr-2024 02:08                3447
imagick.getimageprofile.php                        13-Apr-2024 02:08                2894
imagick.getimageprofiles.php                       13-Apr-2024 02:08                3777
imagick.getimageproperties.php                     13-Apr-2024 02:08                6016
imagick.getimageproperty.php                       13-Apr-2024 02:08                5004
imagick.getimageredprimary.php                     13-Apr-2024 02:08                2978
imagick.getimageregion.php                         13-Apr-2024 02:08                3995
imagick.getimagerenderingintent.php                13-Apr-2024 02:08                2815
imagick.getimageresolution.php                     13-Apr-2024 02:08                2672
imagick.getimagesblob.php                          13-Apr-2024 02:08                2760
imagick.getimagesignature.php                      13-Apr-2024 02:08                2622
imagick.getimagesize.php                           13-Apr-2024 02:08                2897
imagick.getimagetickspersecond.php                 13-Apr-2024 02:08                2708
imagick.getimagetotalinkdensity.php                13-Apr-2024 02:08                2595
imagick.getimagetype.php                           13-Apr-2024 02:08                5058
imagick.getimageunits.php                          13-Apr-2024 02:08                2853
imagick.getimagevirtualpixelmethod.php             13-Apr-2024 02:08                2989
imagick.getimagewhitepoint.php                     13-Apr-2024 02:08                2826
imagick.getimagewidth.php                          13-Apr-2024 02:08                2560
imagick.getinterlacescheme.php                     13-Apr-2024 02:08                2894
imagick.getiteratorindex.php                       13-Apr-2024 02:08                6368
imagick.getnumberimages.php                        13-Apr-2024 02:08                2815
imagick.getoption.php                              13-Apr-2024 02:08                2878
imagick.getpackagename.php                         13-Apr-2024 02:08                2553
imagick.getpage.php                                13-Apr-2024 02:08                2777
imagick.getpixeliterator.php                       13-Apr-2024 02:08                6358
imagick.getpixelregioniterator.php                 13-Apr-2024 02:08                7170
imagick.getpointsize.php                           13-Apr-2024 02:08                2898
imagick.getquantum.php                             13-Apr-2024 02:08                2297
imagick.getquantumdepth.php                        13-Apr-2024 02:08                2786
imagick.getquantumrange.php                        13-Apr-2024 02:08                3048
imagick.getregistry.php                            13-Apr-2024 02:08                2507
imagick.getreleasedate.php                         13-Apr-2024 02:08                2603
imagick.getresource.php                            13-Apr-2024 02:08                3048
imagick.getresourcelimit.php                       13-Apr-2024 02:08                3484
imagick.getsamplingfactors.php                     13-Apr-2024 02:08                2666
imagick.getsize.php                                13-Apr-2024 02:08                6216
imagick.getsizeoffset.php                          13-Apr-2024 02:08                2886
imagick.getversion.php                             13-Apr-2024 02:08                2581
imagick.haldclutimage.php                          13-Apr-2024 02:08                6026
imagick.hasnextimage.php                           13-Apr-2024 02:08                2632
imagick.haspreviousimage.php                       13-Apr-2024 02:08                2663
imagick.identifyformat.php                         13-Apr-2024 02:08                4467
imagick.identifyimage.php                          13-Apr-2024 02:08                4128
imagick.implodeimage.php                           13-Apr-2024 02:08                4778
imagick.importimagepixels.php                      13-Apr-2024 02:08               11492
imagick.installation.php                           13-Apr-2024 02:08                2996
imagick.inversefouriertransformimage.php           13-Apr-2024 02:08                3487
imagick.labelimage.php                             13-Apr-2024 02:08                2595
imagick.levelimage.php                             13-Apr-2024 02:08                7948
imagick.linearstretchimage.php                     13-Apr-2024 02:08                5707
imagick.liquidrescaleimage.php                     13-Apr-2024 02:08                4729
imagick.listregistry.php                           13-Apr-2024 02:08                2356
imagick.magnifyimage.php                           13-Apr-2024 02:08                4316
imagick.mapimage.php                               13-Apr-2024 02:08                3484
imagick.mattefloodfillimage.php                    13-Apr-2024 02:08                6003
imagick.medianfilterimage.php                      13-Apr-2024 02:08                5368
imagick.mergeimagelayers.php                       13-Apr-2024 02:08                6734
imagick.minifyimage.php                            13-Apr-2024 02:08                2377
imagick.modulateimage.php                          13-Apr-2024 02:08                5900
imagick.montageimage.php                           13-Apr-2024 02:08                4684
imagick.morphimages.php                            13-Apr-2024 02:08                2990
imagick.morphology.php                             13-Apr-2024 02:08               66496
imagick.mosaicimages.php                           13-Apr-2024 02:08                2816
imagick.motionblurimage.php                        13-Apr-2024 02:08                6932
imagick.negateimage.php                            13-Apr-2024 02:08                5860
imagick.newimage.php                               13-Apr-2024 02:08                6797
imagick.newpseudoimage.php                         13-Apr-2024 02:08                6036
imagick.nextimage.php                              13-Apr-2024 02:08                2430
imagick.normalizeimage.php                         13-Apr-2024 02:08                6347
imagick.oilpaintimage.php                          13-Apr-2024 02:08                4658
imagick.opaquepaintimage.php                       13-Apr-2024 02:08                5092
imagick.optimizeimagelayers.php                    13-Apr-2024 02:08                5613
imagick.orderedposterizeimage.php                  13-Apr-2024 02:08                6756
imagick.paintfloodfillimage.php                    13-Apr-2024 02:08                5825
imagick.paintopaqueimage.php                       13-Apr-2024 02:08                5547
imagick.painttransparentimage.php                  13-Apr-2024 02:08                4783
imagick.pingimage.php                              13-Apr-2024 02:08                2714
imagick.pingimageblob.php                          13-Apr-2024 02:08                6077
imagick.pingimagefile.php                          13-Apr-2024 02:08                5983
imagick.polaroidimage.php                          13-Apr-2024 02:08                4623
imagick.posterizeimage.php                         13-Apr-2024 02:08                5802
imagick.previewimages.php                          13-Apr-2024 02:08                3279
imagick.previousimage.php                          13-Apr-2024 02:08                2464
imagick.profileimage.php                           13-Apr-2024 02:08                3386
imagick.quantizeimage.php                          13-Apr-2024 02:08                7695
imagick.quantizeimages.php                         13-Apr-2024 02:08                5042
imagick.queryfontmetrics.php                       13-Apr-2024 02:08                5783
imagick.queryfonts.php                             13-Apr-2024 02:08                4870
imagick.queryformats.php                           13-Apr-2024 02:08                7235
imagick.radialblurimage.php                        13-Apr-2024 02:08                6012
imagick.raiseimage.php                             13-Apr-2024 02:08                6503
imagick.randomthresholdimage.php                   13-Apr-2024 02:08                6457
imagick.readimage.php                              13-Apr-2024 02:08                2579
imagick.readimageblob.php                          13-Apr-2024 02:08                5532
imagick.readimagefile.php                          13-Apr-2024 02:08                3306
imagick.readimages.php                             13-Apr-2024 02:08                2594
imagick.recolorimage.php                           13-Apr-2024 02:08                6464
imagick.reducenoiseimage.php                       13-Apr-2024 02:08                5305
imagick.remapimage.php                             13-Apr-2024 02:08                3544
imagick.removeimage.php                            13-Apr-2024 02:08                2605
imagick.removeimageprofile.php                     13-Apr-2024 02:08                2873
imagick.render.php                                 13-Apr-2024 02:08                2307
imagick.requirements.php                           13-Apr-2024 02:08                1509
imagick.resampleimage.php                          13-Apr-2024 02:08                5742
imagick.resetimagepage.php                         13-Apr-2024 02:08                2822
imagick.resizeimage.php                            13-Apr-2024 02:08                6061
imagick.resources.php                              13-Apr-2024 02:08                1215
imagick.rollimage.php                              13-Apr-2024 02:08                4858
imagick.rotateimage.php                            13-Apr-2024 02:08                5731
imagick.rotationalblurimage.php                    13-Apr-2024 02:08                5587
imagick.roundcorners.php                           13-Apr-2024 02:08                6775
imagick.sampleimage.php                            13-Apr-2024 02:08                2982
imagick.scaleimage.php                             13-Apr-2024 02:08                7320
imagick.segmentimage.php                           13-Apr-2024 02:08                6774
imagick.selectiveblurimage.php                     13-Apr-2024 02:08                6450
imagick.separateimagechannel.php                   13-Apr-2024 02:08                5312
imagick.sepiatoneimage.php                         13-Apr-2024 02:08                4981
imagick.setbackgroundcolor.php                     13-Apr-2024 02:08                3353
imagick.setcolorspace.php                          13-Apr-2024 02:08                3101
imagick.setcompression.php                         13-Apr-2024 02:08                2790
imagick.setcompressionquality.php                  13-Apr-2024 02:08                6906
imagick.setfilename.php                            13-Apr-2024 02:08                2614
imagick.setfirstiterator.php                       13-Apr-2024 02:08                2455
imagick.setfont.php                                13-Apr-2024 02:08                5633
imagick.setformat.php                              13-Apr-2024 02:08                2622
imagick.setgravity.php                             13-Apr-2024 02:08                2740
imagick.setimage.php                               13-Apr-2024 02:08                4720
imagick.setimagealphachannel.php                   13-Apr-2024 02:08                3896
imagick.setimageartifact.php                       13-Apr-2024 02:08                7420
imagick.setimageattribute.php                      13-Apr-2024 02:08                3151
imagick.setimagebackgroundcolor.php                13-Apr-2024 02:08                3683
imagick.setimagebias.php                           13-Apr-2024 02:08                6941
imagick.setimagebiasquantum.php                    13-Apr-2024 02:08                2873
imagick.setimageblueprimary.php                    13-Apr-2024 02:08                3297
imagick.setimagebordercolor.php                    13-Apr-2024 02:08                3684
imagick.setimagechanneldepth.php                   13-Apr-2024 02:08                3283
imagick.setimageclipmask.php                       13-Apr-2024 02:08                8922
imagick.setimagecolormapcolor.php                  13-Apr-2024 02:08                3280
imagick.setimagecolorspace.php                     13-Apr-2024 02:08                3335
imagick.setimagecompose.php                        13-Apr-2024 02:08                3304
imagick.setimagecompression.php                    13-Apr-2024 02:08                3135
imagick.setimagecompressionquality.php             13-Apr-2024 02:08                4984
imagick.setimagedelay.php                          13-Apr-2024 02:08                6100
imagick.setimagedepth.php                          13-Apr-2024 02:08                2872
imagick.setimagedispose.php                        13-Apr-2024 02:08                3061
imagick.setimageextent.php                         13-Apr-2024 02:08                3283
imagick.setimagefilename.php                       13-Apr-2024 02:08                2965
imagick.setimageformat.php                         13-Apr-2024 02:08                2775
imagick.setimagegamma.php                          13-Apr-2024 02:08                2876
imagick.setimagegravity.php                        13-Apr-2024 02:08                2905
imagick.setimagegreenprimary.php                   13-Apr-2024 02:08                3286
imagick.setimageindex.php                          13-Apr-2024 02:08                3457
imagick.setimageinterlacescheme.php                13-Apr-2024 02:08                3154
imagick.setimageinterpolatemethod.php              13-Apr-2024 02:08                2848
imagick.setimageiterations.php                     13-Apr-2024 02:08                5067
imagick.setimagematte.php                          13-Apr-2024 02:08                2975
imagick.setimagemattecolor.php                     13-Apr-2024 02:08                3908
imagick.setimageopacity.php                        13-Apr-2024 02:08                5006
imagick.setimageorientation.php                    13-Apr-2024 02:08                4793
imagick.setimagepage.php                           13-Apr-2024 02:08                3830
imagick.setimageprofile.php                        13-Apr-2024 02:08                3645
imagick.setimageproperty.php                       13-Apr-2024 02:08                5326
imagick.setimageredprimary.php                     13-Apr-2024 02:08                3294
imagick.setimagerenderingintent.php                13-Apr-2024 02:08                3189
imagick.setimageresolution.php                     13-Apr-2024 02:08                5151
imagick.setimagescene.php                          13-Apr-2024 02:08                2890
imagick.setimagetickspersecond.php                 13-Apr-2024 02:08                7533
imagick.setimagetype.php                           13-Apr-2024 02:08                2729
imagick.setimageunits.php                          13-Apr-2024 02:08                2650
imagick.setimagevirtualpixelmethod.php             13-Apr-2024 02:08                2899
imagick.setimagewhitepoint.php                     13-Apr-2024 02:08                3251
imagick.setinterlacescheme.php                     13-Apr-2024 02:08                2692
imagick.setiteratorindex.php                       13-Apr-2024 02:08                6354
imagick.setlastiterator.php                        13-Apr-2024 02:08                2552
imagick.setoption.php                              13-Apr-2024 02:08               11550
imagick.setpage.php                                13-Apr-2024 02:08                3647
imagick.setpointsize.php                           13-Apr-2024 02:08                5314
imagick.setprogressmonitor.php                     13-Apr-2024 02:08               10223
imagick.setregistry.php                            13-Apr-2024 02:08                3051
imagick.setresolution.php                          13-Apr-2024 02:08                3955
imagick.setresourcelimit.php                       13-Apr-2024 02:08                3593
imagick.setsamplingfactors.php                     13-Apr-2024 02:08                6793
imagick.setsize.php                                13-Apr-2024 02:08                3028
imagick.setsizeoffset.php                          13-Apr-2024 02:08                3604
imagick.settype.php                                13-Apr-2024 02:08                2693
imagick.setup.php                                  13-Apr-2024 02:08                1583
imagick.shadeimage.php                             13-Apr-2024 02:08                5946
imagick.shadowimage.php                            13-Apr-2024 02:08                5461
imagick.sharpenimage.php                           13-Apr-2024 02:08                6027
imagick.shaveimage.php                             13-Apr-2024 02:08                4667
imagick.shearimage.php                             13-Apr-2024 02:08                6674
imagick.sigmoidalcontrastimage.php                 13-Apr-2024 02:08                8140
imagick.sketchimage.php                            13-Apr-2024 02:08                6033
imagick.smushimages.php                            13-Apr-2024 02:08                5776
imagick.solarizeimage.php                          13-Apr-2024 02:08                4867
imagick.sparsecolorimage.php                       13-Apr-2024 02:08               26598
imagick.spliceimage.php                            13-Apr-2024 02:08                5816
imagick.spreadimage.php                            13-Apr-2024 02:08                4809
imagick.statisticimage.php                         13-Apr-2024 02:08                6720
imagick.steganoimage.php                           13-Apr-2024 02:08                3081
imagick.stereoimage.php                            13-Apr-2024 02:08                2921
imagick.subimagematch.php                          13-Apr-2024 02:08                7489
imagick.swirlimage.php                             13-Apr-2024 02:08                4869
imagick.textureimage.php                           13-Apr-2024 02:08                6246
imagick.thresholdimage.php                         13-Apr-2024 02:08                5464
imagick.thumbnailimage.php                         13-Apr-2024 02:08                7780
imagick.tintimage.php                              13-Apr-2024 02:08                8259
imagick.tostring.php                               13-Apr-2024 02:08                3022
imagick.transformimage.php                         13-Apr-2024 02:08                6782
imagick.transformimagecolorspace.php               13-Apr-2024 02:08                5715
imagick.transparentpaintimage.php                  13-Apr-2024 02:08                7288
imagick.transposeimage.php                         13-Apr-2024 02:08                4672
imagick.transverseimage.php                        13-Apr-2024 02:08                4671
imagick.trimimage.php                              13-Apr-2024 02:08                6229
imagick.uniqueimagecolors.php                      13-Apr-2024 02:08                5568
imagick.unsharpmaskimage.php                       13-Apr-2024 02:08                7142
imagick.valid.php                                  13-Apr-2024 02:08                2380
imagick.vignetteimage.php                          13-Apr-2024 02:08                6662
imagick.waveimage.php                              13-Apr-2024 02:08                6586
imagick.whitethresholdimage.php                    13-Apr-2024 02:08                5504
imagick.writeimage.php                             13-Apr-2024 02:08                3385
imagick.writeimagefile.php                         13-Apr-2024 02:08                3962
imagick.writeimages.php                            13-Apr-2024 02:08                2980
imagick.writeimagesfile.php                        13-Apr-2024 02:08                3971
imagickdraw.affine.php                             13-Apr-2024 02:08               16775
imagickdraw.annotation.php                         13-Apr-2024 02:08                3367
imagickdraw.arc.php                                13-Apr-2024 02:08                9688
imagickdraw.bezier.php                             13-Apr-2024 02:08               16804
imagickdraw.circle.php                             13-Apr-2024 02:08                9064
imagickdraw.clear.php                              13-Apr-2024 02:08                2497
imagickdraw.clone.php                              13-Apr-2024 02:08                2488
imagickdraw.color.php                              13-Apr-2024 02:08                3501
imagickdraw.comment.php                            13-Apr-2024 02:08                2765
imagickdraw.composite.php                          13-Apr-2024 02:08               11886
imagickdraw.construct.php                          13-Apr-2024 02:08                2268
imagickdraw.destroy.php                            13-Apr-2024 02:08                2393
imagickdraw.ellipse.php                            13-Apr-2024 02:08               12255
imagickdraw.getclippath.php                        13-Apr-2024 02:08                2441
imagickdraw.getcliprule.php                        13-Apr-2024 02:08                2469
imagickdraw.getclipunits.php                       13-Apr-2024 02:08                2298
imagickdraw.getfillcolor.php                       13-Apr-2024 02:08                2387
imagickdraw.getfillopacity.php                     13-Apr-2024 02:08                2397
imagickdraw.getfillrule.php                        13-Apr-2024 02:08                2402
imagickdraw.getfont.php                            13-Apr-2024 02:08                2357
imagickdraw.getfontfamily.php                      13-Apr-2024 02:08                2453
imagickdraw.getfontsize.php                        13-Apr-2024 02:08                2446
imagickdraw.getfontstretch.php                     13-Apr-2024 02:08                2364
imagickdraw.getfontstyle.php                       13-Apr-2024 02:08                2596
imagickdraw.getfontweight.php                      13-Apr-2024 02:08                2335
imagickdraw.getgravity.php                         13-Apr-2024 02:08                2470
imagickdraw.getstrokeantialias.php                 13-Apr-2024 02:08                2805
imagickdraw.getstrokecolor.php                     13-Apr-2024 02:08                2513
imagickdraw.getstrokedasharray.php                 13-Apr-2024 02:08                2569
imagickdraw.getstrokedashoffset.php                13-Apr-2024 02:08                2476
imagickdraw.getstrokelinecap.php                   13-Apr-2024 02:08                2551
imagickdraw.getstrokelinejoin.php                  13-Apr-2024 02:08                2534
imagickdraw.getstrokemiterlimit.php                13-Apr-2024 02:08                2720
imagickdraw.getstrokeopacity.php                   13-Apr-2024 02:08                2582
imagickdraw.getstrokewidth.php                     13-Apr-2024 02:08                2556
imagickdraw.gettextalignment.php                   13-Apr-2024 02:08                2480
imagickdraw.gettextantialias.php                   13-Apr-2024 02:08                2596
imagickdraw.gettextdecoration.php                  13-Apr-2024 02:08                2517
imagickdraw.gettextencoding.php                    13-Apr-2024 02:08                2571
imagickdraw.gettextinterlinespacing.php            13-Apr-2024 02:08                2401
imagickdraw.gettextinterwordspacing.php            13-Apr-2024 02:08                2425
imagickdraw.gettextkerning.php                     13-Apr-2024 02:08                2320
imagickdraw.gettextundercolor.php                  13-Apr-2024 02:08                2452
imagickdraw.getvectorgraphics.php                  13-Apr-2024 02:08                2501
imagickdraw.line.php                               13-Apr-2024 02:08                8396
imagickdraw.matte.php                              13-Apr-2024 02:08                8309
imagickdraw.pathclose.php                          13-Apr-2024 02:08                2352
imagickdraw.pathcurvetoabsolute.php                13-Apr-2024 02:08                5153
imagickdraw.pathcurvetoquadraticbezierabsolute.php 13-Apr-2024 02:08               11416
imagickdraw.pathcurvetoquadraticbezierrelative.php 13-Apr-2024 02:08                4477
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 13-Apr-2024 02:08               11132
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 13-Apr-2024 02:08               11104
imagickdraw.pathcurvetorelative.php                13-Apr-2024 02:08                5198
imagickdraw.pathcurvetosmoothabsolute.php          13-Apr-2024 02:08                5163
imagickdraw.pathcurvetosmoothrelative.php          13-Apr-2024 02:08                5172
imagickdraw.pathellipticarcabsolute.php            13-Apr-2024 02:08                6321
imagickdraw.pathellipticarcrelative.php            13-Apr-2024 02:08                6292
imagickdraw.pathfinish.php                         13-Apr-2024 02:08                2258
imagickdraw.pathlinetoabsolute.php                 13-Apr-2024 02:08                3214
imagickdraw.pathlinetohorizontalabsolute.php       13-Apr-2024 02:08                3060
imagickdraw.pathlinetohorizontalrelative.php       13-Apr-2024 02:08                3061
imagickdraw.pathlinetorelative.php                 13-Apr-2024 02:08                3263
imagickdraw.pathlinetoverticalabsolute.php         13-Apr-2024 02:08                3024
imagickdraw.pathlinetoverticalrelative.php         13-Apr-2024 02:08                3025
imagickdraw.pathmovetoabsolute.php                 13-Apr-2024 02:08                3281
imagickdraw.pathmovetorelative.php                 13-Apr-2024 02:08                3208
imagickdraw.pathstart.php                          13-Apr-2024 02:08               12076
imagickdraw.point.php                              13-Apr-2024 02:08                6863
imagickdraw.polygon.php                            13-Apr-2024 02:08                8998
imagickdraw.polyline.php                           13-Apr-2024 02:08                8998
imagickdraw.pop.php                                13-Apr-2024 02:08                2815
imagickdraw.popclippath.php                        13-Apr-2024 02:08                2241
imagickdraw.popdefs.php                            13-Apr-2024 02:08                7710
imagickdraw.poppattern.php                         13-Apr-2024 02:08                2423
imagickdraw.push.php                               13-Apr-2024 02:08                9188
imagickdraw.pushclippath.php                       13-Apr-2024 02:08                3018
imagickdraw.pushdefs.php                           13-Apr-2024 02:08                8260
imagickdraw.pushpattern.php                        13-Apr-2024 02:08               14960
imagickdraw.rectangle.php                          13-Apr-2024 02:08                8547
imagickdraw.render.php                             13-Apr-2024 02:08                2457
imagickdraw.resetvectorgraphics.php                13-Apr-2024 02:08                2416
imagickdraw.rotate.php                             13-Apr-2024 02:08                7735
imagickdraw.roundrectangle.php                     13-Apr-2024 02:08                9461
imagickdraw.scale.php                              13-Apr-2024 02:08                8056
imagickdraw.setclippath.php                        13-Apr-2024 02:08                8469
imagickdraw.setcliprule.php                        13-Apr-2024 02:08                9473
imagickdraw.setclipunits.php                       13-Apr-2024 02:08                8832
imagickdraw.setfillalpha.php                       13-Apr-2024 02:08                7792
imagickdraw.setfillcolor.php                       13-Apr-2024 02:08                7875
imagickdraw.setfillopacity.php                     13-Apr-2024 02:08                7828
imagickdraw.setfillpatternurl.php                  13-Apr-2024 02:08                3538
imagickdraw.setfillrule.php                        13-Apr-2024 02:08               12984
imagickdraw.setfont.php                            13-Apr-2024 02:08                9286
imagickdraw.setfontfamily.php                      13-Apr-2024 02:08                9862
imagickdraw.setfontsize.php                        13-Apr-2024 02:08                8238
imagickdraw.setfontstretch.php                     13-Apr-2024 02:08                9622
imagickdraw.setfontstyle.php                       13-Apr-2024 02:08                8887
imagickdraw.setfontweight.php                      13-Apr-2024 02:08                9144
imagickdraw.setgravity.php                         13-Apr-2024 02:08               10555
imagickdraw.setresolution.php                      13-Apr-2024 02:08                2893
imagickdraw.setstrokealpha.php                     13-Apr-2024 02:08                8464
imagickdraw.setstrokeantialias.php                 13-Apr-2024 02:08                9092
imagickdraw.setstrokecolor.php                     13-Apr-2024 02:08                8544
imagickdraw.setstrokedasharray.php                 13-Apr-2024 02:08               13488
imagickdraw.setstrokedashoffset.php                13-Apr-2024 02:08                9856
imagickdraw.setstrokelinecap.php                   13-Apr-2024 02:08                8510
imagickdraw.setstrokelinejoin.php                  13-Apr-2024 02:08               11387
imagickdraw.setstrokemiterlimit.php                13-Apr-2024 02:08               11312
imagickdraw.setstrokeopacity.php                   13-Apr-2024 02:08               10235
imagickdraw.setstrokepatternurl.php                13-Apr-2024 02:08                3062
imagickdraw.setstrokewidth.php                     13-Apr-2024 02:08                8531
imagickdraw.settextalignment.php                   13-Apr-2024 02:08                9407
imagickdraw.settextantialias.php                   13-Apr-2024 02:08                8910
imagickdraw.settextdecoration.php                  13-Apr-2024 02:08                7450
imagickdraw.settextencoding.php                    13-Apr-2024 02:08                3196
imagickdraw.settextinterlinespacing.php            13-Apr-2024 02:08                2923
imagickdraw.settextinterwordspacing.php            13-Apr-2024 02:08                2757
imagickdraw.settextkerning.php                     13-Apr-2024 02:08                2832
imagickdraw.settextundercolor.php                  13-Apr-2024 02:08                7733
imagickdraw.setvectorgraphics.php                  13-Apr-2024 02:08                9122
imagickdraw.setviewbox.php                         13-Apr-2024 02:08               10381
imagickdraw.skewx.php                              13-Apr-2024 02:08                8134
imagickdraw.skewy.php                              13-Apr-2024 02:08                8136
imagickdraw.translate.php                          13-Apr-2024 02:08                8493
imagickkernel.addkernel.php                        13-Apr-2024 02:08                7006
imagickkernel.addunitykernel.php                   13-Apr-2024 02:08               13660
imagickkernel.frombuiltin.php                      13-Apr-2024 02:08               26211
imagickkernel.frommatrix.php                       13-Apr-2024 02:08               23143
imagickkernel.getmatrix.php                        13-Apr-2024 02:08                7070
imagickkernel.scale.php                            13-Apr-2024 02:08               13173
imagickkernel.separate.php                         13-Apr-2024 02:08                9694
imagickpixel.clear.php                             13-Apr-2024 02:08                2388
imagickpixel.construct.php                         13-Apr-2024 02:08               11995
imagickpixel.destroy.php                           13-Apr-2024 02:08                2508
imagickpixel.getcolor.php                          13-Apr-2024 02:08                7828
imagickpixel.getcolorasstring.php                  13-Apr-2024 02:08                4859
imagickpixel.getcolorcount.php                     13-Apr-2024 02:08                5139
imagickpixel.getcolorquantum.php                   13-Apr-2024 02:08                2880
imagickpixel.getcolorvalue.php                     13-Apr-2024 02:08                7135
imagickpixel.getcolorvaluequantum.php              13-Apr-2024 02:08                6086
imagickpixel.gethsl.php                            13-Apr-2024 02:08                4562
imagickpixel.getindex.php                          13-Apr-2024 02:08                2267
imagickpixel.ispixelsimilar.php                    13-Apr-2024 02:08                3614
imagickpixel.ispixelsimilarquantum.php             13-Apr-2024 02:08                3212
imagickpixel.issimilar.php                         13-Apr-2024 02:08               16542
imagickpixel.setcolor.php                          13-Apr-2024 02:08                7333
imagickpixel.setcolorcount.php                     13-Apr-2024 02:08                2666
imagickpixel.setcolorvalue.php                     13-Apr-2024 02:08                5190
imagickpixel.setcolorvaluequantum.php              13-Apr-2024 02:08                8440
imagickpixel.sethsl.php                            13-Apr-2024 02:08                7698
imagickpixel.setindex.php                          13-Apr-2024 02:08                2595
imagickpixeliterator.clear.php                     13-Apr-2024 02:08                6279
imagickpixeliterator.construct.php                 13-Apr-2024 02:08                6149
imagickpixeliterator.destroy.php                   13-Apr-2024 02:08                2533
imagickpixeliterator.getcurrentiteratorrow.php     13-Apr-2024 02:08                2875
imagickpixeliterator.getiteratorrow.php            13-Apr-2024 02:08                2534
imagickpixeliterator.getnextiteratorrow.php        13-Apr-2024 02:08                6749
imagickpixeliterator.getpreviousiteratorrow.php    13-Apr-2024 02:08                2852
imagickpixeliterator.newpixeliterator.php          13-Apr-2024 02:08                2864
imagickpixeliterator.newpixelregioniterator.php    13-Apr-2024 02:08                4546
imagickpixeliterator.resetiterator.php             13-Apr-2024 02:08                9034
imagickpixeliterator.setiteratorfirstrow.php       13-Apr-2024 02:08                2592
imagickpixeliterator.setiteratorlastrow.php        13-Apr-2024 02:08                2587
imagickpixeliterator.setiteratorrow.php            13-Apr-2024 02:08                6952
imagickpixeliterator.synciterator.php              13-Apr-2024 02:08                2448
imap.configuration.php                             13-Apr-2024 02:08                3404
imap.constants.php                                 13-Apr-2024 02:08               25115
imap.installation.php                              13-Apr-2024 02:08                2770
imap.requirements.php                              13-Apr-2024 02:08                2643
imap.resources.php                                 13-Apr-2024 02:08                1434
imap.setup.php                                     13-Apr-2024 02:08                1553
index.php                                          13-Apr-2024 02:08               14905
indexes.examples.php                               13-Apr-2024 02:08              744557
indexes.functions.php                              13-Apr-2024 02:08             1206980
indexes.php                                        13-Apr-2024 02:08                1408
infiniteiterator.construct.php                     13-Apr-2024 02:08                5029
infiniteiterator.next.php                          13-Apr-2024 02:08                3290
info.configuration.php                             13-Apr-2024 02:08               14589
info.constants.php                                 13-Apr-2024 02:08               20506
info.installation.php                              13-Apr-2024 02:08                1206
info.requirements.php                              13-Apr-2024 02:08                1150
info.resources.php                                 13-Apr-2024 02:08                1194
info.setup.php                                     13-Apr-2024 02:08                1528
ini.core.php                                       13-Apr-2024 02:08               79569
ini.list.php                                       13-Apr-2024 02:08              128698
ini.php                                            13-Apr-2024 02:08                1573
ini.sections.php                                   13-Apr-2024 02:08                4221
inotify.configuration.php                          13-Apr-2024 02:08                1274
inotify.constants.php                              13-Apr-2024 02:08               10379
inotify.install.php                                13-Apr-2024 02:08                1697
inotify.requirements.php                           13-Apr-2024 02:08                1189
inotify.resources.php                              13-Apr-2024 02:08                1324
inotify.setup.php                                  13-Apr-2024 02:08                1588
install.cloud.azure.php                            13-Apr-2024 02:08                4240
install.cloud.digitalocean.php                     13-Apr-2024 02:08                2967
install.cloud.ec2.php                              13-Apr-2024 02:08                1396
install.cloud.php                                  13-Apr-2024 02:08                1646
install.fpm.configuration.php                      13-Apr-2024 02:08               36070
install.fpm.install.php                            13-Apr-2024 02:08                3282
install.fpm.php                                    13-Apr-2024 02:08                3605
install.general.php                                13-Apr-2024 02:08                4715
install.macosx.bundled.php                         13-Apr-2024 02:08               10687
install.macosx.compile.php                         13-Apr-2024 02:08                1334
install.macosx.packages.php                        13-Apr-2024 02:08                2999
install.macosx.php                                 13-Apr-2024 02:08                2002
install.pecl.downloads.php                         13-Apr-2024 02:08                3564
install.pecl.intro.php                             13-Apr-2024 02:08                3214
install.pecl.pear.php                              13-Apr-2024 02:08                3026
install.pecl.php                                   13-Apr-2024 02:08                1954
install.pecl.php-config.php                        13-Apr-2024 02:08                4092
install.pecl.phpize.php                            13-Apr-2024 02:08                3039
install.pecl.static.php                            13-Apr-2024 02:08                3578
install.pecl.windows.php                           13-Apr-2024 02:08                9777
install.php                                        13-Apr-2024 02:08                5631
install.problems.bugs.php                          13-Apr-2024 02:08                1942
install.problems.faq.php                           13-Apr-2024 02:08                1310
install.problems.php                               13-Apr-2024 02:08                1529
install.problems.support.php                       13-Apr-2024 02:08                2558
install.unix.apache2.php                           13-Apr-2024 02:08               13133
install.unix.commandline.php                       13-Apr-2024 02:08                3982
install.unix.debian.php                            13-Apr-2024 02:08                7292
install.unix.lighttpd-14.php                       13-Apr-2024 02:08                6401
install.unix.litespeed.php                         13-Apr-2024 02:08                8938
install.unix.nginx.php                             13-Apr-2024 02:08                8305
install.unix.openbsd.php                           13-Apr-2024 02:08                5954
install.unix.php                                   13-Apr-2024 02:08                7445
install.unix.solaris.php                           13-Apr-2024 02:08                3869
install.windows.apache2.php                        13-Apr-2024 02:08                7198
install.windows.building.php                       13-Apr-2024 02:08                1664
install.windows.commandline.php                    13-Apr-2024 02:08                8713
install.windows.manual.php                         13-Apr-2024 02:08                5525
install.windows.pecl.php                           13-Apr-2024 02:08                1611
install.windows.php                                13-Apr-2024 02:08                3262
install.windows.recommended.php                    13-Apr-2024 02:08                5109
install.windows.requirements.php                   13-Apr-2024 02:08                2215
install.windows.tools.php                          13-Apr-2024 02:08                1801
install.windows.troubleshooting.php                13-Apr-2024 02:08                1709
internaliterator.construct.php                     13-Apr-2024 02:08                1965
internaliterator.current.php                       13-Apr-2024 02:08                2274
internaliterator.key.php                           13-Apr-2024 02:08                2270
internaliterator.next.php                          13-Apr-2024 02:08                2236
internaliterator.rewind.php                        13-Apr-2024 02:08                2267
internaliterator.valid.php                         13-Apr-2024 02:08                2397
intl.configuration.php                             13-Apr-2024 02:08                5499
intl.constants.php                                 13-Apr-2024 02:08                9546
intl.examples.basic.php                            13-Apr-2024 02:08                4307
intl.examples.php                                  13-Apr-2024 02:08                1362
intl.installation.php                              13-Apr-2024 02:08                1768
intl.requirements.php                              13-Apr-2024 02:08                1320
intl.resources.php                                 13-Apr-2024 02:08                1194
intl.setup.php                                     13-Apr-2024 02:08                1550
intlbreakiterator.construct.php                    13-Apr-2024 02:08                4050
intlbreakiterator.createcharacterinstance.php      13-Apr-2024 02:08                3319
intlbreakiterator.createcodepointinstance.php      13-Apr-2024 02:08                2768
intlbreakiterator.createlineinstance.php           13-Apr-2024 02:08                3280
intlbreakiterator.createsentenceinstance.php       13-Apr-2024 02:08                3282
intlbreakiterator.createtitleinstance.php          13-Apr-2024 02:08                3262
intlbreakiterator.createwordinstance.php           13-Apr-2024 02:08                3216
intlbreakiterator.current.php                      13-Apr-2024 02:08                2457
intlbreakiterator.first.php                        13-Apr-2024 02:08                2441
intlbreakiterator.following.php                    13-Apr-2024 02:08                2737
intlbreakiterator.geterrorcode.php                 13-Apr-2024 02:08                2992
intlbreakiterator.geterrormessage.php              13-Apr-2024 02:08                3041
intlbreakiterator.getlocale.php                    13-Apr-2024 02:08                2847
intlbreakiterator.getpartsiterator.php             13-Apr-2024 02:08                3674
intlbreakiterator.gettext.php                      13-Apr-2024 02:08                2574
intlbreakiterator.isboundary.php                   13-Apr-2024 02:08                2707
intlbreakiterator.last.php                         13-Apr-2024 02:08                2440
intlbreakiterator.next.php                         13-Apr-2024 02:08                2871
intlbreakiterator.preceding.php                    13-Apr-2024 02:08                2715
intlbreakiterator.previous.php                     13-Apr-2024 02:08                2496
intlbreakiterator.settext.php                      13-Apr-2024 02:08                3584
intlcalendar.add.php                               13-Apr-2024 02:08                8823
intlcalendar.after.php                             13-Apr-2024 02:08                6861
intlcalendar.before.php                            13-Apr-2024 02:08                4247
intlcalendar.clear.php                             13-Apr-2024 02:08               19074
intlcalendar.construct.php                         13-Apr-2024 02:08                2320
intlcalendar.createinstance.php                    13-Apr-2024 02:08               13535
intlcalendar.equals.php                            13-Apr-2024 02:08               10956
intlcalendar.fielddifference.php                   13-Apr-2024 02:08               11349
intlcalendar.fromdatetime.php                      13-Apr-2024 02:08                8029
intlcalendar.get.php                               13-Apr-2024 02:08                8838
intlcalendar.getactualmaximum.php                  13-Apr-2024 02:08                8759
intlcalendar.getactualminimum.php                  13-Apr-2024 02:08                5942
intlcalendar.getavailablelocales.php               13-Apr-2024 02:08                4441
intlcalendar.getdayofweektype.php                  13-Apr-2024 02:08               10669
intlcalendar.geterrorcode.php                      13-Apr-2024 02:08                9181
intlcalendar.geterrormessage.php                   13-Apr-2024 02:08                6175
intlcalendar.getfirstdayofweek.php                 13-Apr-2024 02:08                8769
intlcalendar.getgreatestminimum.php                13-Apr-2024 02:08                4820
intlcalendar.getkeywordvaluesforlocale.php         13-Apr-2024 02:08                7520
intlcalendar.getleastmaximum.php                   13-Apr-2024 02:08                8406
intlcalendar.getlocale.php                         13-Apr-2024 02:08                6349
intlcalendar.getmaximum.php                        13-Apr-2024 02:08                5475
intlcalendar.getminimaldaysinfirstweek.php         13-Apr-2024 02:08                9057
intlcalendar.getminimum.php                        13-Apr-2024 02:08                4764
intlcalendar.getnow.php                            13-Apr-2024 02:08                5358
intlcalendar.getrepeatedwalltimeoption.php         13-Apr-2024 02:08               10333
intlcalendar.getskippedwalltimeoption.php          13-Apr-2024 02:08               12672
intlcalendar.gettime.php                           13-Apr-2024 02:08                6622
intlcalendar.gettimezone.php                       13-Apr-2024 02:08                7570
intlcalendar.gettype.php                           13-Apr-2024 02:08                5744
intlcalendar.getweekendtransition.php              13-Apr-2024 02:08                5426
intlcalendar.indaylighttime.php                    13-Apr-2024 02:08                8785
intlcalendar.isequivalentto.php                    13-Apr-2024 02:08                8494
intlcalendar.islenient.php                         13-Apr-2024 02:08                8390
intlcalendar.isset.php                             13-Apr-2024 02:08                4861
intlcalendar.isweekend.php                         13-Apr-2024 02:08                9038
intlcalendar.roll.php                              13-Apr-2024 02:08                9533
intlcalendar.set.php                               13-Apr-2024 02:08               16054
intlcalendar.setdate.php                           13-Apr-2024 02:08                4841
intlcalendar.setdatetime.php                       13-Apr-2024 02:08                6655
intlcalendar.setfirstdayofweek.php                 13-Apr-2024 02:08                8897
intlcalendar.setlenient.php                        13-Apr-2024 02:08                5087
intlcalendar.setminimaldaysinfirstweek.php         13-Apr-2024 02:08                5432
intlcalendar.setrepeatedwalltimeoption.php         13-Apr-2024 02:08                6560
intlcalendar.setskippedwalltimeoption.php          13-Apr-2024 02:08                7427
intlcalendar.settime.php                           13-Apr-2024 02:08                8722
intlcalendar.settimezone.php                       13-Apr-2024 02:08               11264
intlcalendar.todatetime.php                        13-Apr-2024 02:08                7178
intlchar.charage.php                               13-Apr-2024 02:08                5907
intlchar.chardigitvalue.php                        13-Apr-2024 02:08                5568
intlchar.chardirection.php                         13-Apr-2024 02:08               10721
intlchar.charfromname.php                          13-Apr-2024 02:08                7276
intlchar.charmirror.php                            13-Apr-2024 02:08                6736
intlchar.charname.php                              13-Apr-2024 02:08                7679
intlchar.chartype.php                              13-Apr-2024 02:08               11609
intlchar.chr.php                                   13-Apr-2024 02:08                5681
intlchar.digit.php                                 13-Apr-2024 02:08                8507
intlchar.enumcharnames.php                         13-Apr-2024 02:08                9091
intlchar.enumchartypes.php                         13-Apr-2024 02:08                5820
intlchar.foldcase.php                              13-Apr-2024 02:08                4088
intlchar.fordigit.php                              13-Apr-2024 02:08                7103
intlchar.getbidipairedbracket.php                  13-Apr-2024 02:08                6496
intlchar.getblockcode.php                          13-Apr-2024 02:08                5622
intlchar.getcombiningclass.php                     13-Apr-2024 02:08                4966
intlchar.getfc-nfkc-closure.php                    13-Apr-2024 02:08                4987
intlchar.getintpropertymaxvalue.php                13-Apr-2024 02:08                6368
intlchar.getintpropertyminvalue.php                13-Apr-2024 02:08                6361
intlchar.getintpropertyvalue.php                   13-Apr-2024 02:08                8089
intlchar.getnumericvalue.php                       13-Apr-2024 02:08                5672
intlchar.getpropertyenum.php                       13-Apr-2024 02:08                6720
intlchar.getpropertyname.php                       13-Apr-2024 02:08                9066
intlchar.getpropertyvalueenum.php                  13-Apr-2024 02:08                7964
intlchar.getpropertyvaluename.php                  13-Apr-2024 02:08               10879
intlchar.getunicodeversion.php                     13-Apr-2024 02:08                3967
intlchar.hasbinaryproperty.php                     13-Apr-2024 02:08                9050
intlchar.isalnum.php                               13-Apr-2024 02:08                6021
intlchar.isalpha.php                               13-Apr-2024 02:08                5904
intlchar.isbase.php                                13-Apr-2024 02:08                6200
intlchar.isblank.php                               13-Apr-2024 02:08                6863
intlchar.iscntrl.php                               13-Apr-2024 02:08                6976
intlchar.isdefined.php                             13-Apr-2024 02:08                6877
intlchar.isdigit.php                               13-Apr-2024 02:08                6215
intlchar.isgraph.php                               13-Apr-2024 02:08                6183
intlchar.isidignorable.php                         13-Apr-2024 02:08                6409
intlchar.isidpart.php                              13-Apr-2024 02:08                7050
intlchar.isidstart.php                             13-Apr-2024 02:08                6476
intlchar.isisocontrol.php                          13-Apr-2024 02:08                5683
intlchar.isjavaidpart.php                          13-Apr-2024 02:08                6968
intlchar.isjavaidstart.php                         13-Apr-2024 02:08                6698
intlchar.isjavaspacechar.php                       13-Apr-2024 02:08                6931
intlchar.islower.php                               13-Apr-2024 02:08                7393
intlchar.ismirrored.php                            13-Apr-2024 02:08                5807
intlchar.isprint.php                               13-Apr-2024 02:08                6302
intlchar.ispunct.php                               13-Apr-2024 02:08                5946
intlchar.isspace.php                               13-Apr-2024 02:08                6709
intlchar.istitle.php                               13-Apr-2024 02:08                7573
intlchar.isualphabetic.php                         13-Apr-2024 02:08                6020
intlchar.isulowercase.php                          13-Apr-2024 02:08                7055
intlchar.isupper.php                               13-Apr-2024 02:08                7384
intlchar.isuuppercase.php                          13-Apr-2024 02:08                7093
intlchar.isuwhitespace.php                         13-Apr-2024 02:08                7515
intlchar.iswhitespace.php                          13-Apr-2024 02:08                7405
intlchar.isxdigit.php                              13-Apr-2024 02:08                7273
intlchar.ord.php                                   13-Apr-2024 02:08                5544
intlchar.tolower.php                               13-Apr-2024 02:08                7927
intlchar.totitle.php                               13-Apr-2024 02:08                8113
intlchar.toupper.php                               13-Apr-2024 02:08                7812
intlcodepointbreakiterator.getlastcodepoint.php    13-Apr-2024 02:08                2699
intldateformatter.create.php                       13-Apr-2024 02:08               27913
intldateformatter.format.php                       13-Apr-2024 02:08               26754
intldateformatter.formatobject.php                 13-Apr-2024 02:08               14626
intldateformatter.getcalendar.php                  13-Apr-2024 02:08                9456
intldateformatter.getcalendarobject.php            13-Apr-2024 02:08                7709
intldateformatter.getdatetype.php                  13-Apr-2024 02:08               11835
intldateformatter.geterrorcode.php                 13-Apr-2024 02:08                8743
intldateformatter.geterrormessage.php              13-Apr-2024 02:08                8662
intldateformatter.getlocale.php                    13-Apr-2024 02:08               12140
intldateformatter.getpattern.php                   13-Apr-2024 02:08               11009
intldateformatter.gettimetype.php                  13-Apr-2024 02:08               11736
intldateformatter.gettimezone.php                  13-Apr-2024 02:08                8701
intldateformatter.gettimezoneid.php                13-Apr-2024 02:08                8979
intldateformatter.islenient.php                    13-Apr-2024 02:08               14969
intldateformatter.localtime.php                    13-Apr-2024 02:08               11619
intldateformatter.parse.php                        13-Apr-2024 02:08               13342
intldateformatter.setcalendar.php                  13-Apr-2024 02:08               14127
intldateformatter.setlenient.php                   13-Apr-2024 02:08               15842
intldateformatter.setpattern.php                   13-Apr-2024 02:08               11635
intldateformatter.settimezone.php                  13-Apr-2024 02:08               12513
intldatepatterngenerator.create.php                13-Apr-2024 02:08                4377
intldatepatterngenerator.getbestpattern.php        13-Apr-2024 02:08                6896
intlgregoriancalendar.construct.php                13-Apr-2024 02:08                5633
intlgregoriancalendar.createfromdate.php           13-Apr-2024 02:08                7358
intlgregoriancalendar.createfromdatetime.php       13-Apr-2024 02:08                8958
intlgregoriancalendar.getgregorianchange.php       13-Apr-2024 02:08                2679
intlgregoriancalendar.isleapyear.php               13-Apr-2024 02:08                3039
intlgregoriancalendar.setgregorianchange.php       13-Apr-2024 02:08                3069
intliterator.current.php                           13-Apr-2024 02:08                2331
intliterator.key.php                               13-Apr-2024 02:08                2300
intliterator.next.php                              13-Apr-2024 02:08                2316
intliterator.rewind.php                            13-Apr-2024 02:08                2344
intliterator.valid.php                             13-Apr-2024 02:08                2322
intlpartsiterator.getbreakiterator.php             13-Apr-2024 02:08                2542
intlrulebasedbreakiterator.construct.php           13-Apr-2024 02:08                3173
intlrulebasedbreakiterator.getbinaryrules.php      13-Apr-2024 02:08                2799
intlrulebasedbreakiterator.getrules.php            13-Apr-2024 02:08                2763
intlrulebasedbreakiterator.getrulestatus.php       13-Apr-2024 02:08                2735
intlrulebasedbreakiterator.getrulestatusvec.php    13-Apr-2024 02:08                2857
intltimezone.construct.php                         13-Apr-2024 02:08                1961
intltimezone.countequivalentids.php                13-Apr-2024 02:08                3667
intltimezone.createdefault.php                     13-Apr-2024 02:08                2999
intltimezone.createenumeration.php                 13-Apr-2024 02:08                4753
intltimezone.createtimezone.php                    13-Apr-2024 02:08                3643
intltimezone.createtimezoneidenumeration.php       13-Apr-2024 02:08                5837
intltimezone.fromdatetimezone.php                  13-Apr-2024 02:08                3764
intltimezone.getcanonicalid.php                    13-Apr-2024 02:08                4390
intltimezone.getdisplayname.php                    13-Apr-2024 02:08                5571
intltimezone.getdstsavings.php                     13-Apr-2024 02:08                3131
intltimezone.getequivalentid.php                   13-Apr-2024 02:08                4073
intltimezone.geterrorcode.php                      13-Apr-2024 02:08                3303
intltimezone.geterrormessage.php                   13-Apr-2024 02:08                3331
intltimezone.getgmt.php                            13-Apr-2024 02:08                2848
intltimezone.getid.php                             13-Apr-2024 02:08                3183
intltimezone.getidforwindowsid.php                 13-Apr-2024 02:08                5854
intltimezone.getoffset.php                         13-Apr-2024 02:08                5091
intltimezone.getrawoffset.php                      13-Apr-2024 02:08                3082
intltimezone.getregion.php                         13-Apr-2024 02:08                3678
intltimezone.gettzdataversion.php                  13-Apr-2024 02:08                3222
intltimezone.getunknown.php                        13-Apr-2024 02:08                3114
intltimezone.getwindowsid.php                      13-Apr-2024 02:08                4429
intltimezone.hassamerules.php                      13-Apr-2024 02:08                3505
intltimezone.todatetimezone.php                    13-Apr-2024 02:08                3432
intltimezone.usedaylighttime.php                   13-Apr-2024 02:08                3115
intro-whatcando.php                                13-Apr-2024 02:08                8403
intro-whatis.php                                   13-Apr-2024 02:08                4375
intro.apache.php                                   13-Apr-2024 02:08                1133
intro.apcu.php                                     13-Apr-2024 02:08                1772
intro.array.php                                    13-Apr-2024 02:08                2000
intro.bc.php                                       13-Apr-2024 02:08                4520
intro.bzip2.php                                    13-Apr-2024 02:08                1154
intro.calendar.php                                 13-Apr-2024 02:08                2100
intro.classobj.php                                 13-Apr-2024 02:08                1694
intro.cmark.php                                    13-Apr-2024 02:08                7285
intro.com.php                                      13-Apr-2024 02:08                3145
intro.componere.php                                13-Apr-2024 02:08                6611
intro.ctype.php                                    13-Apr-2024 02:08                3996
intro.cubrid.php                                   13-Apr-2024 02:08                1418
intro.curl.php                                     13-Apr-2024 02:08                1613
intro.datetime.php                                 13-Apr-2024 02:08                2740
intro.dba.php                                      13-Apr-2024 02:08                1438
intro.dbase.php                                    13-Apr-2024 02:08                6741
intro.dio.php                                      13-Apr-2024 02:08                1595
intro.dom.php                                      13-Apr-2024 02:08                1656
intro.ds.php                                       13-Apr-2024 02:08                1398
intro.eio.php                                      13-Apr-2024 02:08               14304
intro.enchant.php                                  13-Apr-2024 02:08                2551
intro.errorfunc.php                                13-Apr-2024 02:08                2055
intro.ev.php                                       13-Apr-2024 02:08                2209
intro.event.php                                    13-Apr-2024 02:08                1911
intro.exec.php                                     13-Apr-2024 02:08                1711
intro.exif.php                                     13-Apr-2024 02:08                1437
intro.expect.php                                   13-Apr-2024 02:08                1372
intro.fann.php                                     13-Apr-2024 02:08                1351
intro.fdf.php                                      13-Apr-2024 02:08                3767
intro.ffi.php                                      13-Apr-2024 02:08                2794
intro.fileinfo.php                                 13-Apr-2024 02:08                1350
intro.filesystem.php                               13-Apr-2024 02:08                1417
intro.filter.php                                   13-Apr-2024 02:08                2761
intro.fpm.php                                      13-Apr-2024 02:08                1294
intro.ftp.php                                      13-Apr-2024 02:08                1792
intro.funchand.php                                 13-Apr-2024 02:08                1156
intro.gearman.php                                  13-Apr-2024 02:08                1602
intro.gender.php                                   13-Apr-2024 02:08                1270
intro.geoip.php                                    13-Apr-2024 02:08                1509
intro.gettext.php                                  13-Apr-2024 02:08                1489
intro.gmagick.php                                  13-Apr-2024 02:08                1632
intro.gmp.php                                      13-Apr-2024 02:08                2952
intro.gnupg.php                                    13-Apr-2024 02:08                1159
intro.hash.php                                     13-Apr-2024 02:08                1177
intro.hrtime.php                                   13-Apr-2024 02:08                1607
intro.ibase.php                                    13-Apr-2024 02:08                3115
intro.ibm-db2.php                                  13-Apr-2024 02:08                1219
intro.iconv.php                                    13-Apr-2024 02:08                1851
intro.igbinary.php                                 13-Apr-2024 02:08                1614
intro.image.php                                    13-Apr-2024 02:08                5810
intro.imagick.php                                  13-Apr-2024 02:08                1784
intro.imap.php                                     13-Apr-2024 02:08                1694
intro.info.php                                     13-Apr-2024 02:08                1482
intro.inotify.php                                  13-Apr-2024 02:08                2281
intro.intl.php                                     13-Apr-2024 02:08                5839
intro.json.php                                     13-Apr-2024 02:08                1633
intro.ldap.php                                     13-Apr-2024 02:08                4019
intro.libxml.php                                   13-Apr-2024 02:08                1616
intro.lua.php                                      13-Apr-2024 02:08                1207
intro.luasandbox.php                               13-Apr-2024 02:08                2304
intro.lzf.php                                      13-Apr-2024 02:08                1523
intro.mail.php                                     13-Apr-2024 02:08                1162
intro.mailparse.php                                13-Apr-2024 02:08                1881
intro.math.php                                     13-Apr-2024 02:08                1952
intro.mbstring.php                                 13-Apr-2024 02:08                2686
intro.mcrypt.php                                   13-Apr-2024 02:08                2284
intro.memcache.php                                 13-Apr-2024 02:08                1623
intro.memcached.php                                13-Apr-2024 02:08                1816
intro.mhash.php                                    13-Apr-2024 02:08                2845
intro.misc.php                                     13-Apr-2024 02:08                1109
intro.mqseries.php                                 13-Apr-2024 02:08                1683
intro.mysql-xdevapi.php                            13-Apr-2024 02:08                1819
intro.mysql.php                                    13-Apr-2024 02:08                2102
intro.mysqli.php                                   13-Apr-2024 02:08                2107
intro.mysqlnd.php                                  13-Apr-2024 02:08                1885
intro.network.php                                  13-Apr-2024 02:08                1104
intro.oauth.php                                    13-Apr-2024 02:08                1273
intro.oci8.php                                     13-Apr-2024 02:08                1415
intro.opcache.php                                  13-Apr-2024 02:08                1469
intro.openal.php                                   13-Apr-2024 02:08                1192
intro.openssl.php                                  13-Apr-2024 02:08                1523
intro.outcontrol.php                               13-Apr-2024 02:08                1802
intro.parallel.php                                 13-Apr-2024 02:08                6849
intro.parle.php                                    13-Apr-2024 02:08                3378
intro.password.php                                 13-Apr-2024 02:08                1375
intro.pcntl.php                                    13-Apr-2024 02:08                2556
intro.pcre.php                                     13-Apr-2024 02:08                2764
intro.pdo.php                                      13-Apr-2024 02:08                2090
intro.pgsql.php                                    13-Apr-2024 02:08                1517
intro.phar.php                                     13-Apr-2024 02:08                9954
intro.phpdbg.php                                   13-Apr-2024 02:08                5980
intro.posix.php                                    13-Apr-2024 02:08                1581
intro.ps.php                                       13-Apr-2024 02:08                1701
intro.pspell.php                                   13-Apr-2024 02:08                1134
intro.pthreads.php                                 13-Apr-2024 02:08                9071
intro.quickhash.php                                13-Apr-2024 02:08                1206
intro.radius.php                                   13-Apr-2024 02:08                2109
intro.random.php                                   13-Apr-2024 02:08                1048
intro.rar.php                                      13-Apr-2024 02:08                1480
intro.readline.php                                 13-Apr-2024 02:08                1901
intro.recode.php                                   13-Apr-2024 02:08                2296
intro.reflection.php                               13-Apr-2024 02:08                1824
intro.rnp.php                                      13-Apr-2024 02:08                1219
intro.rpminfo.php                                  13-Apr-2024 02:08                1336
intro.rrd.php                                      13-Apr-2024 02:08                1375
intro.runkit7.php                                  13-Apr-2024 02:08                1418
intro.scoutapm.php                                 13-Apr-2024 02:08                1402
intro.seaslog.php                                  13-Apr-2024 02:08                3872
intro.sem.php                                      13-Apr-2024 02:08                3167
intro.session.php                                  13-Apr-2024 02:08                5469
intro.shmop.php                                    13-Apr-2024 02:08                1180
intro.simdjson.php                                 13-Apr-2024 02:08                1168
intro.simplexml.php                                13-Apr-2024 02:08                1252
intro.snmp.php                                     13-Apr-2024 02:08                1598
intro.soap.php                                     13-Apr-2024 02:08                1403
intro.sockets.php                                  13-Apr-2024 02:08                2576
intro.sodium.php                                   13-Apr-2024 02:08                1269
intro.solr.php                                     13-Apr-2024 02:08                1724
intro.spl.php                                      13-Apr-2024 02:08                1514
intro.sqlite3.php                                  13-Apr-2024 02:08                1115
intro.sqlsrv.php                                   13-Apr-2024 02:08                2105
intro.ssdeep.php                                   13-Apr-2024 02:08                1698
intro.ssh2.php                                     13-Apr-2024 02:08                1305
intro.stats.php                                    13-Apr-2024 02:08                1450
intro.stomp.php                                    13-Apr-2024 02:08                1283
intro.stream.php                                   13-Apr-2024 02:08                4312
intro.strings.php                                  13-Apr-2024 02:08                1629
intro.svm.php                                      13-Apr-2024 02:08                1181
intro.svn.php                                      13-Apr-2024 02:08                1705
intro.swoole.php                                   13-Apr-2024 02:08                1575
intro.sync.php                                     13-Apr-2024 02:08                2296
intro.taint.php                                    13-Apr-2024 02:08                4235
intro.tcpwrap.php                                  13-Apr-2024 02:08                1204
intro.tidy.php                                     13-Apr-2024 02:08                1437
intro.tokenizer.php                                13-Apr-2024 02:08                1488
intro.trader.php                                   13-Apr-2024 02:08                2327
intro.ui.php                                       13-Apr-2024 02:08                1140
intro.uodbc.php                                    13-Apr-2024 02:08                2762
intro.uopz.php                                     13-Apr-2024 02:08                2225
intro.url.php                                      13-Apr-2024 02:08                1099
intro.v8js.php                                     13-Apr-2024 02:08                1167
intro.var.php                                      13-Apr-2024 02:08                1261
intro.var_representation.php                       13-Apr-2024 02:08                1368
intro.varnish.php                                  13-Apr-2024 02:08                1257
intro.wddx.php                                     13-Apr-2024 02:08                2244
intro.win32service.php                             13-Apr-2024 02:08                1390
intro.wincache.php                                 13-Apr-2024 02:08                4829
intro.wkhtmltox.php                                13-Apr-2024 02:08                1216
intro.xattr.php                                    13-Apr-2024 02:08                1130
intro.xdiff.php                                    13-Apr-2024 02:08                2658
intro.xhprof.php                                   13-Apr-2024 02:08                2733
intro.xlswriter.php                                13-Apr-2024 02:08                1129
intro.xml.php                                      13-Apr-2024 02:08                2604
intro.xmldiff.php                                  13-Apr-2024 02:08                1350
intro.xmlreader.php                                13-Apr-2024 02:08                1441
intro.xmlrpc.php                                   13-Apr-2024 02:08                1848
intro.xmlwriter.php                                13-Apr-2024 02:08                1519
intro.xsl.php                                      13-Apr-2024 02:08                1292
intro.yac.php                                      13-Apr-2024 02:08                1141
intro.yaconf.php                                   13-Apr-2024 02:08                2484
intro.yaf.php                                      13-Apr-2024 02:08                1489
intro.yaml.php                                     13-Apr-2024 02:08                1345
intro.yar.php                                      13-Apr-2024 02:08                1210
intro.yaz.php                                      13-Apr-2024 02:08                2536
intro.zip.php                                      13-Apr-2024 02:08                1145
intro.zlib.php                                     13-Apr-2024 02:08                1696
intro.zmq.php                                      13-Apr-2024 02:08                1326
intro.zookeeper.php                                13-Apr-2024 02:08                1387
introduction.php                                   13-Apr-2024 02:08                1358
iterator.current.php                               13-Apr-2024 02:08                2141
iterator.key.php                                   13-Apr-2024 02:08                2584
iterator.next.php                                  13-Apr-2024 02:08                2392
iterator.rewind.php                                13-Apr-2024 02:08                2541
iterator.valid.php                                 13-Apr-2024 02:08                2806
iteratoraggregate.getiterator.php                  13-Apr-2024 02:08                2882
iteratoriterator.construct.php                     13-Apr-2024 02:08                3427
iteratoriterator.current.php                       13-Apr-2024 02:08                2707
iteratoriterator.getinneriterator.php              13-Apr-2024 02:08                3154
iteratoriterator.key.php                           13-Apr-2024 02:08                2655
iteratoriterator.next.php                          13-Apr-2024 02:08                2814
iteratoriterator.rewind.php                        13-Apr-2024 02:08                2833
iteratoriterator.valid.php                         13-Apr-2024 02:08                3026
json.configuration.php                             13-Apr-2024 02:08                1243
json.constants.php                                 13-Apr-2024 02:08               16873
json.installation.php                              13-Apr-2024 02:08                1770
json.requirements.php                              13-Apr-2024 02:08                1187
json.resources.php                                 13-Apr-2024 02:08                1194
json.setup.php                                     13-Apr-2024 02:08                1523
jsonserializable.jsonserialize.php                 13-Apr-2024 02:08               12217
langref.php                                        13-Apr-2024 02:08               21375
language.attributes.classes.php                    13-Apr-2024 02:08                6678
language.attributes.overview.php                   13-Apr-2024 02:08               10443
language.attributes.php                            13-Apr-2024 02:08                1776
language.attributes.reflection.php                 13-Apr-2024 02:08                8403
language.attributes.syntax.php                     13-Apr-2024 02:08                6129
language.basic-syntax.comments.php                 13-Apr-2024 02:08                3963
language.basic-syntax.instruction-separation.php   13-Apr-2024 02:08                4217
language.basic-syntax.php                          13-Apr-2024 02:08                1643
language.basic-syntax.phpmode.php                  13-Apr-2024 02:08                4688
language.basic-syntax.phptags.php                  13-Apr-2024 02:08                4905
language.constants.magic.php                       13-Apr-2024 02:08                5645
language.constants.php                             13-Apr-2024 02:08                6497
language.constants.predefined.php                  13-Apr-2024 02:08                1468
language.constants.syntax.php                      13-Apr-2024 02:08               10324
language.control-structures.php                    13-Apr-2024 02:08                2704
language.enumerations.backed.php                   13-Apr-2024 02:08               10536
language.enumerations.basics.php                   13-Apr-2024 02:08                8578
language.enumerations.constants.php                13-Apr-2024 02:08                2247
language.enumerations.examples.php                 13-Apr-2024 02:08                7278
language.enumerations.expressions.php              13-Apr-2024 02:08                6658
language.enumerations.listing.php                  13-Apr-2024 02:08                2269
language.enumerations.methods.php                  13-Apr-2024 02:08               13545
language.enumerations.object-differences.inheri..> 13-Apr-2024 02:08                6185
language.enumerations.object-differences.php       13-Apr-2024 02:08                4826
language.enumerations.overview.php                 13-Apr-2024 02:08                2473
language.enumerations.php                          13-Apr-2024 02:08                2473
language.enumerations.serialization.php            13-Apr-2024 02:08                4953
language.enumerations.static-methods.php           13-Apr-2024 02:08                3211
language.enumerations.traits.php                   13-Apr-2024 02:08                4292
language.errors.basics.php                         13-Apr-2024 02:08                5211
language.errors.php                                13-Apr-2024 02:08                1859
language.errors.php7.php                           13-Apr-2024 02:08                5741
language.exceptions.extending.php                  13-Apr-2024 02:08               20192
language.exceptions.php                            13-Apr-2024 02:08               28001
language.expressions.php                           13-Apr-2024 02:08               16527
language.fibers.php                                13-Apr-2024 02:08                6718
language.functions.php                             13-Apr-2024 02:08                1941
language.generators.comparison.php                 13-Apr-2024 02:08                8876
language.generators.overview.php                   13-Apr-2024 02:08                9049
language.generators.php                            13-Apr-2024 02:08                1608
language.generators.syntax.php                     13-Apr-2024 02:08               23878
language.namespaces.basics.php                     13-Apr-2024 02:08               11352
language.namespaces.definition.php                 13-Apr-2024 02:08                4318
language.namespaces.definitionmultiple.php         13-Apr-2024 02:08                9163
language.namespaces.dynamic.php                    13-Apr-2024 02:08                8300
language.namespaces.fallback.php                   13-Apr-2024 02:08                6106
language.namespaces.faq.php                        13-Apr-2024 02:08               32642
language.namespaces.global.php                     13-Apr-2024 02:08                2812
language.namespaces.importing.php                  13-Apr-2024 02:08               15173
language.namespaces.nested.php                     13-Apr-2024 02:08                2833
language.namespaces.nsconstants.php                13-Apr-2024 02:08                8898
language.namespaces.php                            13-Apr-2024 02:08                2557
language.namespaces.rationale.php                  13-Apr-2024 02:08                6386
language.namespaces.rules.php                      13-Apr-2024 02:08               12224
language.oop5.abstract.php                         13-Apr-2024 02:08               10936
language.oop5.anonymous.php                        13-Apr-2024 02:08               10457
language.oop5.autoload.php                         13-Apr-2024 02:08                6978
language.oop5.basic.php                            13-Apr-2024 02:08               48981
language.oop5.changelog.php                        13-Apr-2024 02:08               14048
language.oop5.cloning.php                          13-Apr-2024 02:08                9003
language.oop5.constants.php                        13-Apr-2024 02:08                9108
language.oop5.decon.php                            13-Apr-2024 02:08               28929
language.oop5.final.php                            13-Apr-2024 02:08                6244
language.oop5.inheritance.php                      13-Apr-2024 02:08               13984
language.oop5.interfaces.php                       13-Apr-2024 02:08               23115
language.oop5.iterations.php                       13-Apr-2024 02:08                5779
language.oop5.late-static-bindings.php             13-Apr-2024 02:08               14590
language.oop5.magic.php                            13-Apr-2024 02:08               44783
language.oop5.object-comparison.php                13-Apr-2024 02:08                8862
language.oop5.overloading.php                      13-Apr-2024 02:08               25102
language.oop5.paamayim-nekudotayim.php             13-Apr-2024 02:08                8475
language.oop5.php                                  13-Apr-2024 02:08                3480
language.oop5.properties.php                       13-Apr-2024 02:08               27734
language.oop5.references.php                       13-Apr-2024 02:08                5829
language.oop5.serialization.php                    13-Apr-2024 02:08                7269
language.oop5.static.php                           13-Apr-2024 02:08                9849
language.oop5.traits.php                           13-Apr-2024 02:08               35229
language.oop5.variance.php                         13-Apr-2024 02:08               16158
language.oop5.visibility.php                       13-Apr-2024 02:08               25129
language.operators.arithmetic.php                  13-Apr-2024 02:08                6339
language.operators.array.php                       13-Apr-2024 02:08                8797
language.operators.assignment.php                  13-Apr-2024 02:08               11176
language.operators.bitwise.php                     13-Apr-2024 02:08               43668
language.operators.comparison.php                  13-Apr-2024 02:08               42002
language.operators.errorcontrol.php                13-Apr-2024 02:08                5793
language.operators.execution.php                   13-Apr-2024 02:08                3391
language.operators.increment.php                   13-Apr-2024 02:08               13979
language.operators.logical.php                     13-Apr-2024 02:08                7281
language.operators.php                             13-Apr-2024 02:08                3871
language.operators.precedence.php                  13-Apr-2024 02:08               19599
language.operators.string.php                      13-Apr-2024 02:08                3117
language.operators.type.php                        13-Apr-2024 02:08               18249
language.references.arent.php                      13-Apr-2024 02:08                3348
language.references.pass.php                       13-Apr-2024 02:08                6839
language.references.php                            13-Apr-2024 02:08                1987
language.references.return.php                     13-Apr-2024 02:08                7381
language.references.spot.php                       13-Apr-2024 02:08                2697
language.references.unset.php                      13-Apr-2024 02:08                2493
language.references.whatare.php                    13-Apr-2024 02:08                2027
language.references.whatdo.php                     13-Apr-2024 02:08               18562
language.types.array.php                           13-Apr-2024 02:08               99770
language.types.boolean.php                         13-Apr-2024 02:08               10033
language.types.callable.php                        13-Apr-2024 02:08               12105
language.types.declarations.php                    13-Apr-2024 02:08               42900
language.types.enumerations.php                    13-Apr-2024 02:08                3726
language.types.float.php                           13-Apr-2024 02:08                9618
language.types.integer.php                         13-Apr-2024 02:08               21005
language.types.intro.php                           13-Apr-2024 02:08                8560
language.types.iterable.php                        13-Apr-2024 02:08                3008
language.types.mixed.php                           13-Apr-2024 02:08                1748
language.types.never.php                           13-Apr-2024 02:08                1877
language.types.null.php                            13-Apr-2024 02:08                3552
language.types.numeric-strings.php                 13-Apr-2024 02:08               10349
language.types.object.php                          13-Apr-2024 02:08                5732
language.types.php                                 13-Apr-2024 02:08                2742
language.types.relative-class-types.php            13-Apr-2024 02:08                2375
language.types.resource.php                        13-Apr-2024 02:08                3160
language.types.string.php                          13-Apr-2024 02:08               78676
language.types.type-juggling.php                   13-Apr-2024 02:08               27014
language.types.type-system.php                     13-Apr-2024 02:08                8355
language.types.value.php                           13-Apr-2024 02:08                2090
language.types.void.php                            13-Apr-2024 02:08                1911
language.variables.basics.php                      13-Apr-2024 02:08               14703
language.variables.external.php                    13-Apr-2024 02:08               17042
language.variables.php                             13-Apr-2024 02:08                1727
language.variables.predefined.php                  13-Apr-2024 02:08                3042
language.variables.scope.php                       13-Apr-2024 02:08               27945
language.variables.superglobals.php                13-Apr-2024 02:08                4382
language.variables.variable.php                    13-Apr-2024 02:08               10067
ldap.configuration.php                             13-Apr-2024 02:08                2486
ldap.constants.php                                 13-Apr-2024 02:08               32794
ldap.controls.php                                  13-Apr-2024 02:08                9858
ldap.examples-basic.php                            13-Apr-2024 02:08                8069
ldap.examples-controls.php                         13-Apr-2024 02:08               15932
ldap.examples.php                                  13-Apr-2024 02:08                1372
ldap.installation.php                              13-Apr-2024 02:08                2847
ldap.requirements.php                              13-Apr-2024 02:08                1473
ldap.resources.php                                 13-Apr-2024 02:08                1403
ldap.setup.php                                     13-Apr-2024 02:08                1550
ldap.using.php                                     13-Apr-2024 02:08                2180
libxml.configuration.php                           13-Apr-2024 02:08                1306
libxml.constants.php                               13-Apr-2024 02:08               13722
libxml.installation.php                            13-Apr-2024 02:08                1996
libxml.installation_old.php                        13-Apr-2024 02:08                2625
libxml.requirements.php                            13-Apr-2024 02:08                1339
libxml.resources.php                               13-Apr-2024 02:08                1208
libxml.setup.php                                   13-Apr-2024 02:08                1721
limititerator.construct.php                        13-Apr-2024 02:08                7291
limititerator.current.php                          13-Apr-2024 02:08                3540
limititerator.getposition.php                      13-Apr-2024 02:08                5722
limititerator.key.php                              13-Apr-2024 02:08                3590
limititerator.next.php                             13-Apr-2024 02:08                3272
limititerator.rewind.php                           13-Apr-2024 02:08                3440
limititerator.seek.php                             13-Apr-2024 02:08                4099
limititerator.valid.php                            13-Apr-2024 02:08                3505
locale.acceptfromhttp.php                          13-Apr-2024 02:08                6232
locale.canonicalize.php                            13-Apr-2024 02:08                3136
locale.composelocale.php                           13-Apr-2024 02:08               13483
locale.filtermatches.php                           13-Apr-2024 02:08                9459
locale.getallvariants.php                          13-Apr-2024 02:08                6651
locale.getdefault.php                              13-Apr-2024 02:08                6069
locale.getdisplaylanguage.php                      13-Apr-2024 02:08               10099
locale.getdisplayname.php                          13-Apr-2024 02:08               10121
locale.getdisplayregion.php                        13-Apr-2024 02:08               10090
locale.getdisplayscript.php                        13-Apr-2024 02:08               10103
locale.getdisplayvariant.php                       13-Apr-2024 02:08               10143
locale.getkeywords.php                             13-Apr-2024 02:08                7246
locale.getprimarylanguage.php                      13-Apr-2024 02:08                6117
locale.getregion.php                               13-Apr-2024 02:08                6080
locale.getscript.php                               13-Apr-2024 02:08                5769
locale.lookup.php                                  13-Apr-2024 02:08               10369
locale.parselocale.php                             13-Apr-2024 02:08                7508
locale.setdefault.php                              13-Apr-2024 02:08                5418
lua.assign.php                                     13-Apr-2024 02:08                4590
lua.call.php                                       13-Apr-2024 02:08                7484
lua.configuration.php                              13-Apr-2024 02:08                1236
lua.construct.php                                  13-Apr-2024 02:08                2380
lua.eval.php                                       13-Apr-2024 02:08                3741
lua.getversion.php                                 13-Apr-2024 02:08                2262
lua.include.php                                    13-Apr-2024 02:08                2684
lua.installation.php                               13-Apr-2024 02:08                1948
lua.registercallback.php                           13-Apr-2024 02:08                4549
lua.requirements.php                               13-Apr-2024 02:08                1236
lua.resources.php                                  13-Apr-2024 02:08                1187
lua.setup.php                                      13-Apr-2024 02:08                1510
luaclosure.invoke.php                              13-Apr-2024 02:08                4098
luasandbox.callfunction.php                        13-Apr-2024 02:08                5045
luasandbox.configuration.php                       13-Apr-2024 02:08                1285
luasandbox.disableprofiler.php                     13-Apr-2024 02:08                2858
luasandbox.enableprofiler.php                      13-Apr-2024 02:08                3490
luasandbox.examples-basic.php                      13-Apr-2024 02:08                6598
luasandbox.examples.php                            13-Apr-2024 02:08                1432
luasandbox.getcpuusage.php                         13-Apr-2024 02:08                3614
luasandbox.getmemoryusage.php                      13-Apr-2024 02:08                3189
luasandbox.getpeakmemoryusage.php                  13-Apr-2024 02:08                3239
luasandbox.getprofilerfunctionreport.php           13-Apr-2024 02:08                5984
luasandbox.getversioninfo.php                      13-Apr-2024 02:08                3095
luasandbox.installation.php                        13-Apr-2024 02:08                2049
luasandbox.loadbinary.php                          13-Apr-2024 02:08                3619
luasandbox.loadstring.php                          13-Apr-2024 02:08                5610
luasandbox.pauseusagetimer.php                     13-Apr-2024 02:08                9412
luasandbox.registerlibrary.php                     13-Apr-2024 02:08                6616
luasandbox.requirements.php                        13-Apr-2024 02:08                1722
luasandbox.resources.php                           13-Apr-2024 02:08                1252
luasandbox.setcpulimit.php                         13-Apr-2024 02:08                6132
luasandbox.setmemorylimit.php                      13-Apr-2024 02:08                5532
luasandbox.setup.php                               13-Apr-2024 02:08                1601
luasandbox.unpauseusagetimer.php                   13-Apr-2024 02:08                3154
luasandbox.wrapphpfunction.php                     13-Apr-2024 02:08                4357
luasandboxfunction.call.php                        13-Apr-2024 02:08                8023
luasandboxfunction.construct.php                   13-Apr-2024 02:08                2673
luasandboxfunction.dump.php                        13-Apr-2024 02:08                2436
lzf.configuration.php                              13-Apr-2024 02:08                1236
lzf.constants.php                                  13-Apr-2024 02:08                1115
lzf.installation.php                               13-Apr-2024 02:08                2687
lzf.requirements.php                               13-Apr-2024 02:08                1143
lzf.resources.php                                  13-Apr-2024 02:08                1187
lzf.setup.php                                      13-Apr-2024 02:08                1533
magick.getimagescene.php                           13-Apr-2024 02:08                2563
magick.stripimage.php                              13-Apr-2024 02:08                2616
mail.configuration.php                             13-Apr-2024 02:08                9204
mail.constants.php                                 13-Apr-2024 02:08                1126
mail.installation.php                              13-Apr-2024 02:08                1206
mail.requirements.php                              13-Apr-2024 02:08                2074
mail.resources.php                                 13-Apr-2024 02:08                1194
mail.setup.php                                     13-Apr-2024 02:08                1544
mailparse.configuration.php                        13-Apr-2024 02:08                2615
mailparse.constants.php                            13-Apr-2024 02:08                2352
mailparse.installation.php                         13-Apr-2024 02:08                2410
mailparse.requirements.php                         13-Apr-2024 02:08                1185
mailparse.resources.php                            13-Apr-2024 02:08                1546
mailparse.setup.php                                13-Apr-2024 02:08                1609
manual.php                                         13-Apr-2024 02:08                1252
math.configuration.php                             13-Apr-2024 02:08                1243
math.constants.php                                 13-Apr-2024 02:08                7178
math.installation.php                              13-Apr-2024 02:08                1206
math.requirements.php                              13-Apr-2024 02:08                1150
math.resources.php                                 13-Apr-2024 02:08                1194
math.setup.php                                     13-Apr-2024 02:08                1539
mbstring.configuration.php                         13-Apr-2024 02:08               18021
mbstring.constants.php                             13-Apr-2024 02:08                6940
mbstring.encodings.php                             13-Apr-2024 02:08               15733
mbstring.http.php                                  13-Apr-2024 02:08                5338
mbstring.installation.php                          13-Apr-2024 02:08                3498
mbstring.ja-basic.php                              13-Apr-2024 02:08                3765
mbstring.overload.php                              13-Apr-2024 02:08                7517
mbstring.php4.req.php                              13-Apr-2024 02:08                4084
mbstring.requirements.php                          13-Apr-2024 02:08                1178
mbstring.resources.php                             13-Apr-2024 02:08                1222
mbstring.setup.php                                 13-Apr-2024 02:08                1603
mbstring.supported-encodings.php                   13-Apr-2024 02:08                8353
mcrypt.ciphers.php                                 13-Apr-2024 02:08                6507
mcrypt.configuration.php                           13-Apr-2024 02:08                3885
mcrypt.constants.php                               13-Apr-2024 02:08                6533
mcrypt.installation.php                            13-Apr-2024 02:08                1746
mcrypt.requirements.php                            13-Apr-2024 02:08                2162
mcrypt.resources.php                               13-Apr-2024 02:08                1326
mcrypt.setup.php                                   13-Apr-2024 02:08                1578
memcache.add.php                                   13-Apr-2024 02:08                7227
memcache.addserver.php                             13-Apr-2024 02:08               13774
memcache.close.php                                 13-Apr-2024 02:08                5171
memcache.connect.php                               13-Apr-2024 02:08                7429
memcache.constants.php                             13-Apr-2024 02:08                5148
memcache.decrement.php                             13-Apr-2024 02:08                7262
memcache.delete.php                                13-Apr-2024 02:08                6531
memcache.examples-overview.php                     13-Apr-2024 02:08                6402
memcache.examples.php                              13-Apr-2024 02:08                1366
memcache.flush.php                                 13-Apr-2024 02:08                4582
memcache.get.php                                   13-Apr-2024 02:08                8824
memcache.getextendedstats.php                      13-Apr-2024 02:08                8198
memcache.getserverstatus.php                       13-Apr-2024 02:08                6171
memcache.getstats.php                              13-Apr-2024 02:08                4827
memcache.getversion.php                            13-Apr-2024 02:08                5047
memcache.increment.php                             13-Apr-2024 02:08                7055
memcache.ini.php                                   13-Apr-2024 02:08               11366
memcache.installation.php                          13-Apr-2024 02:08                2060
memcache.pconnect.php                              13-Apr-2024 02:08                6280
memcache.replace.php                               13-Apr-2024 02:08                7330
memcache.requirements.php                          13-Apr-2024 02:08                1312
memcache.resources.php                             13-Apr-2024 02:08                1284
memcache.set.php                                   13-Apr-2024 02:08                9691
memcache.setcompressthreshold.php                  13-Apr-2024 02:08                6017
memcache.setserverparams.php                       13-Apr-2024 02:08               11196
memcache.setup.php                                 13-Apr-2024 02:08                1591
memcached.add.php                                  13-Apr-2024 02:08                4681
memcached.addbykey.php                             13-Apr-2024 02:08                5623
memcached.addserver.php                            13-Apr-2024 02:08                7669
memcached.addservers.php                           13-Apr-2024 02:08                5429
memcached.append.php                               13-Apr-2024 02:08                7481
memcached.appendbykey.php                          13-Apr-2024 02:08                5156
memcached.callbacks.php                            13-Apr-2024 02:08                1469
memcached.callbacks.read-through.php               13-Apr-2024 02:08                4318
memcached.callbacks.result.php                     13-Apr-2024 02:08                4818
memcached.cas.php                                  13-Apr-2024 02:08                9455
memcached.casbykey.php                             13-Apr-2024 02:08                5949
memcached.configuration.php                        13-Apr-2024 02:08               29802
memcached.constants.php                            13-Apr-2024 02:08               29403
memcached.construct.php                            13-Apr-2024 02:08                5677
memcached.decrement.php                            13-Apr-2024 02:08                9137
memcached.decrementbykey.php                       13-Apr-2024 02:08                5973
memcached.delete.php                               13-Apr-2024 02:08                5720
memcached.deletebykey.php                          13-Apr-2024 02:08                5649
memcached.deletemulti.php                          13-Apr-2024 02:08                4862
memcached.deletemultibykey.php                     13-Apr-2024 02:08                5815
memcached.expiration.php                           13-Apr-2024 02:08                1880
memcached.fetch.php                                13-Apr-2024 02:08                6742
memcached.fetchall.php                             13-Apr-2024 02:08                6560
memcached.flush.php                                13-Apr-2024 02:08                4712
memcached.get.php                                  13-Apr-2024 02:08               10441
memcached.getallkeys.php                           13-Apr-2024 02:08                3059
memcached.getbykey.php                             13-Apr-2024 02:08                6607
memcached.getdelayed.php                           13-Apr-2024 02:08                8855
memcached.getdelayedbykey.php                      13-Apr-2024 02:08                5804
memcached.getmulti.php                             13-Apr-2024 02:08               20852
memcached.getmultibykey.php                        13-Apr-2024 02:08                5667
memcached.getoption.php                            13-Apr-2024 02:08                5154
memcached.getresultcode.php                        13-Apr-2024 02:08                4244
memcached.getresultmessage.php                     13-Apr-2024 02:08                4683
memcached.getserverbykey.php                       13-Apr-2024 02:08                7400
memcached.getserverlist.php                        13-Apr-2024 02:08                4597
memcached.getstats.php                             13-Apr-2024 02:08                5741
memcached.getversion.php                           13-Apr-2024 02:08                3985
memcached.increment.php                            13-Apr-2024 02:08                8467
memcached.incrementbykey.php                       13-Apr-2024 02:08                5906
memcached.installation.php                         13-Apr-2024 02:08                2564
memcached.ispersistent.php                         13-Apr-2024 02:08                3004
memcached.ispristine.php                           13-Apr-2024 02:08                2931
memcached.prepend.php                              13-Apr-2024 02:08                7516
memcached.prependbykey.php                         13-Apr-2024 02:08                5189
memcached.quit.php                                 13-Apr-2024 02:08                2452
memcached.replace.php                              13-Apr-2024 02:08                4753
memcached.replacebykey.php                         13-Apr-2024 02:08                5710
memcached.requirements.php                         13-Apr-2024 02:08                1486
memcached.resetserverlist.php                      13-Apr-2024 02:08                3170
memcached.resources.php                            13-Apr-2024 02:08                1229
memcached.sessions.php                             13-Apr-2024 02:08                2378
memcached.set.php                                  13-Apr-2024 02:08                9212
memcached.setbykey.php                             13-Apr-2024 02:08                7043
memcached.setmulti.php                             13-Apr-2024 02:08                6271
memcached.setmultibykey.php                        13-Apr-2024 02:08                4976
memcached.setoption.php                            13-Apr-2024 02:08                7328
memcached.setoptions.php                           13-Apr-2024 02:08                6942
memcached.setsaslauthdata.php                      13-Apr-2024 02:08                3509
memcached.setup.php                                13-Apr-2024 02:08                1609
memcached.touch.php                                13-Apr-2024 02:08                3801
memcached.touchbykey.php                           13-Apr-2024 02:08                4698
messageformatter.create.php                        13-Apr-2024 02:08               11250
messageformatter.format.php                        13-Apr-2024 02:08                9966
messageformatter.formatmessage.php                 13-Apr-2024 02:08               14660
messageformatter.geterrorcode.php                  13-Apr-2024 02:08                4049
messageformatter.geterrormessage.php               13-Apr-2024 02:08                7697
messageformatter.getlocale.php                     13-Apr-2024 02:08                5505
messageformatter.getpattern.php                    13-Apr-2024 02:08               10202
messageformatter.parse.php                         13-Apr-2024 02:08                9768
messageformatter.parsemessage.php                  13-Apr-2024 02:08               10066
messageformatter.setpattern.php                    13-Apr-2024 02:08               10801
mhash.configuration.php                            13-Apr-2024 02:08                1250
mhash.constants.php                                13-Apr-2024 02:08                4917
mhash.examples.php                                 13-Apr-2024 02:08                3313
mhash.installation.php                             13-Apr-2024 02:08                1567
mhash.requirements.php                             13-Apr-2024 02:08                1286
mhash.resources.php                                13-Apr-2024 02:08                1201
mhash.setup.php                                    13-Apr-2024 02:08                1558
migration56.changed-functions.php                  13-Apr-2024 02:08                6867
migration56.constants.php                          13-Apr-2024 02:08                6111
migration56.deprecated.php                         13-Apr-2024 02:08                6223
migration56.extensions.php                         13-Apr-2024 02:08                4313
migration56.incompatible.php                       13-Apr-2024 02:08                8463
migration56.new-features.php                       13-Apr-2024 02:08               28896
migration56.new-functions.php                      13-Apr-2024 02:08                7495
migration56.openssl.php                            13-Apr-2024 02:08               25825
migration56.php                                    13-Apr-2024 02:08                2418
migration70.changed-functions.php                  13-Apr-2024 02:08                5189
migration70.classes.php                            13-Apr-2024 02:08                3875
migration70.constants.php                          13-Apr-2024 02:08                9463
migration70.deprecated.php                         13-Apr-2024 02:08                5651
migration70.incompatible.php                       13-Apr-2024 02:08               62254
migration70.new-features.php                       13-Apr-2024 02:08               41094
migration70.new-functions.php                      13-Apr-2024 02:08                7333
migration70.other-changes.php                      13-Apr-2024 02:08                3398
migration70.php                                    13-Apr-2024 02:08                2798
migration70.removed-exts-sapis.php                 13-Apr-2024 02:08                3129
migration70.sapi-changes.php                       13-Apr-2024 02:08                1974
migration71.changed-functions.php                  13-Apr-2024 02:08                7568
migration71.constants.php                          13-Apr-2024 02:08                8746
migration71.deprecated.php                         13-Apr-2024 02:08                2246
migration71.incompatible.php                       13-Apr-2024 02:08               32249
migration71.new-features.php                       13-Apr-2024 02:08               27263
migration71.new-functions.php                      13-Apr-2024 02:08                5030
migration71.other-changes.php                      13-Apr-2024 02:08                8565
migration71.php                                    13-Apr-2024 02:08                2494
migration71.windows-support.php                    13-Apr-2024 02:08                7125
migration72.constants.php                          13-Apr-2024 02:08               31938
migration72.deprecated.php                         13-Apr-2024 02:08               10463
migration72.incompatible.php                       13-Apr-2024 02:08               19669
migration72.new-features.php                       13-Apr-2024 02:08               18946
migration72.new-functions.php                      13-Apr-2024 02:08               24374
migration72.other-changes.php                      13-Apr-2024 02:08                5840
migration72.php                                    13-Apr-2024 02:08                2394
migration73.constants.php                          13-Apr-2024 02:08               25832
migration73.deprecated.php                         13-Apr-2024 02:08                8709
migration73.incompatible.php                       13-Apr-2024 02:08               18076
migration73.new-features.php                       13-Apr-2024 02:08               16684
migration73.new-functions.php                      13-Apr-2024 02:08                7404
migration73.other-changes.php                      13-Apr-2024 02:08               16516
migration73.php                                    13-Apr-2024 02:08                2512
migration73.windows-support.php                    13-Apr-2024 02:08                1801
migration74.constants.php                          13-Apr-2024 02:08                7742
migration74.deprecated.php                         13-Apr-2024 02:08               15218
migration74.incompatible.php                       13-Apr-2024 02:08               18400
migration74.new-classes.php                        13-Apr-2024 02:08                1481
migration74.new-features.php                       13-Apr-2024 02:08               21934
migration74.new-functions.php                      13-Apr-2024 02:08                3697
migration74.other-changes.php                      13-Apr-2024 02:08               21224
migration74.php                                    13-Apr-2024 02:08                2728
migration74.removed-extensions.php                 13-Apr-2024 02:08                1889
migration74.windows-support.php                    13-Apr-2024 02:08                3754
migration80.deprecated.php                         13-Apr-2024 02:08               18750
migration80.incompatible.php                       13-Apr-2024 02:08               98632
migration80.new-features.php                       13-Apr-2024 02:08               32498
migration80.other-changes.php                      13-Apr-2024 02:08               15082
migration80.php                                    13-Apr-2024 02:08                2381
migration81.constants.php                          13-Apr-2024 02:08                8204
migration81.deprecated.php                         13-Apr-2024 02:08               19434
migration81.incompatible.php                       13-Apr-2024 02:08               23253
migration81.new-classes.php                        13-Apr-2024 02:08                2117
migration81.new-features.php                       13-Apr-2024 02:08               23906
migration81.new-functions.php                      13-Apr-2024 02:08                8457
migration81.other-changes.php                      13-Apr-2024 02:08                9856
migration81.php                                    13-Apr-2024 02:08                2601
migration82.constants.php                          13-Apr-2024 02:08               22024
migration82.deprecated.php                         13-Apr-2024 02:08                5851
migration82.incompatible.php                       13-Apr-2024 02:08                9621
migration82.new-features.php                       13-Apr-2024 02:08                7177
migration82.new-functions.php                      13-Apr-2024 02:08                4268
migration82.other-changes.php                      13-Apr-2024 02:08               25757
migration82.php                                    13-Apr-2024 02:08                2648
migration82.windows-support.php                    13-Apr-2024 02:08                2291
migration83.constants.php                          13-Apr-2024 02:08               13164
migration83.deprecated.php                         13-Apr-2024 02:08                7692
migration83.incompatible.php                       13-Apr-2024 02:08               14682
migration83.new-classes.php                        13-Apr-2024 02:08                3369
migration83.new-features.php                       13-Apr-2024 02:08                7224
migration83.new-functions.php                      13-Apr-2024 02:08                7287
migration83.other-changes.php                      13-Apr-2024 02:08               31671
migration83.php                                    13-Apr-2024 02:08                2790
migration83.windows-support.php                    13-Apr-2024 02:08                1367
misc.configuration.php                             13-Apr-2024 02:08                6444
misc.constants.php                                 13-Apr-2024 02:08                2584
misc.installation.php                              13-Apr-2024 02:08                1206
misc.requirements.php                              13-Apr-2024 02:08                1150
misc.resources.php                                 13-Apr-2024 02:08                1194
misc.setup.php                                     13-Apr-2024 02:08                1528
mongodb-bson-binary.construct.php                  13-Apr-2024 02:08                7943
mongodb-bson-binary.getdata.php                    13-Apr-2024 02:08                4421
mongodb-bson-binary.gettype.php                    13-Apr-2024 02:08                4403
mongodb-bson-binary.jsonserialize.php              13-Apr-2024 02:08                5409
mongodb-bson-binary.serialize.php                  13-Apr-2024 02:08                3499
mongodb-bson-binary.tostring.php                   13-Apr-2024 02:08                4215
mongodb-bson-binary.unserialize.php                13-Apr-2024 02:08                4317
mongodb-bson-binaryinterface.getdata.php           13-Apr-2024 02:08                2842
mongodb-bson-binaryinterface.gettype.php           13-Apr-2024 02:08                2852
mongodb-bson-binaryinterface.tostring.php          13-Apr-2024 02:08                3318
mongodb-bson-dbpointer.construct.php               13-Apr-2024 02:08                2666
mongodb-bson-dbpointer.jsonserialize.php           13-Apr-2024 02:08                5478
mongodb-bson-dbpointer.serialize.php               13-Apr-2024 02:08                3574
mongodb-bson-dbpointer.tostring.php                13-Apr-2024 02:08                2684
mongodb-bson-dbpointer.unserialize.php             13-Apr-2024 02:08                3816
mongodb-bson-decimal128.construct.php              13-Apr-2024 02:08                5786
mongodb-bson-decimal128.jsonserialize.php          13-Apr-2024 02:08                5499
mongodb-bson-decimal128.serialize.php              13-Apr-2024 02:08                3599
mongodb-bson-decimal128.tostring.php               13-Apr-2024 02:08                4555
mongodb-bson-decimal128.unserialize.php            13-Apr-2024 02:08                4409
mongodb-bson-decimal128interface.tostring.php      13-Apr-2024 02:08                3005
mongodb-bson-document.construct.php                13-Apr-2024 02:08                3280
mongodb-bson-document.frombson.php                 13-Apr-2024 02:08                4046
mongodb-bson-document.fromjson.php                 13-Apr-2024 02:08                4559
mongodb-bson-document.fromphp.php                  13-Apr-2024 02:08                4281
mongodb-bson-document.get.php                      13-Apr-2024 02:08                4257
mongodb-bson-document.getiterator.php              13-Apr-2024 02:08                3525
mongodb-bson-document.has.php                      13-Apr-2024 02:08                3778
mongodb-bson-document.serialize.php                13-Apr-2024 02:08                3563
mongodb-bson-document.tocanonicalextendedjson.php  13-Apr-2024 02:08               12727
mongodb-bson-document.tophp.php                    13-Apr-2024 02:08                5435
mongodb-bson-document.torelaxedextendedjson.php    13-Apr-2024 02:08               12444
mongodb-bson-document.tostring.php                 13-Apr-2024 02:08                2758
mongodb-bson-document.unserialize.php              13-Apr-2024 02:08                4365
mongodb-bson-int64.construct.php                   13-Apr-2024 02:08                4763
mongodb-bson-int64.jsonserialize.php               13-Apr-2024 02:08                5153
mongodb-bson-int64.serialize.php                   13-Apr-2024 02:08                3476
mongodb-bson-int64.tostring.php                    13-Apr-2024 02:08                3873
mongodb-bson-int64.unserialize.php                 13-Apr-2024 02:08                4288
mongodb-bson-iterator.construct.php                13-Apr-2024 02:08                3368
mongodb-bson-iterator.current.php                  13-Apr-2024 02:08                3636
mongodb-bson-iterator.key.php                      13-Apr-2024 02:08                3631
mongodb-bson-iterator.next.php                     13-Apr-2024 02:08                2403
mongodb-bson-iterator.rewind.php                   13-Apr-2024 02:08                2439
mongodb-bson-iterator.valid.php                    13-Apr-2024 02:08                2827
mongodb-bson-javascript.construct.php              13-Apr-2024 02:08                7254
mongodb-bson-javascript.getcode.php                13-Apr-2024 02:08                4393
mongodb-bson-javascript.getscope.php               13-Apr-2024 02:08                5369
mongodb-bson-javascript.jsonserialize.php          13-Apr-2024 02:08                5495
mongodb-bson-javascript.serialize.php              13-Apr-2024 02:08                3599
mongodb-bson-javascript.tostring.php               13-Apr-2024 02:08                4209
mongodb-bson-javascript.unserialize.php            13-Apr-2024 02:08                4401
mongodb-bson-javascriptinterface.getcode.php       13-Apr-2024 02:08                2936
mongodb-bson-javascriptinterface.getscope.php      13-Apr-2024 02:08                3101
mongodb-bson-javascriptinterface.tostring.php      13-Apr-2024 02:08                3416
mongodb-bson-maxkey.construct.php                  13-Apr-2024 02:08                3647
mongodb-bson-maxkey.jsonserialize.php              13-Apr-2024 02:08                5415
mongodb-bson-maxkey.serialize.php                  13-Apr-2024 02:08                3503
mongodb-bson-maxkey.unserialize.php                13-Apr-2024 02:08                3749
mongodb-bson-minkey.construct.php                  13-Apr-2024 02:08                3647
mongodb-bson-minkey.jsonserialize.php              13-Apr-2024 02:08                5415
mongodb-bson-minkey.serialize.php                  13-Apr-2024 02:08                3503
mongodb-bson-minkey.unserialize.php                13-Apr-2024 02:08                3753
mongodb-bson-objectid.construct.php                13-Apr-2024 02:08                5271
mongodb-bson-objectid.gettimestamp.php             13-Apr-2024 02:08                5503
mongodb-bson-objectid.jsonserialize.php            13-Apr-2024 02:08                5461
mongodb-bson-objectid.serialize.php                13-Apr-2024 02:08                3551
mongodb-bson-objectid.tostring.php                 13-Apr-2024 02:08                4201
mongodb-bson-objectid.unserialize.php              13-Apr-2024 02:08                4355
mongodb-bson-objectidinterface.gettimestamp.php    13-Apr-2024 02:08                3005
mongodb-bson-objectidinterface.tostring.php        13-Apr-2024 02:08                2989
mongodb-bson-packedarray.construct.php             13-Apr-2024 02:08                2900
mongodb-bson-packedarray.fromphp.php               13-Apr-2024 02:08                3962
mongodb-bson-packedarray.get.php                   13-Apr-2024 02:08                4308
mongodb-bson-packedarray.getiterator.php           13-Apr-2024 02:08                3579
mongodb-bson-packedarray.has.php                   13-Apr-2024 02:08                3832
mongodb-bson-packedarray.serialize.php             13-Apr-2024 02:08                3595
mongodb-bson-packedarray.tophp.php                 13-Apr-2024 02:08                4654
mongodb-bson-packedarray.tostring.php              13-Apr-2024 02:08                2774
mongodb-bson-packedarray.unserialize.php           13-Apr-2024 02:08                4421
mongodb-bson-persistable.bsonserialize.php         13-Apr-2024 02:08                6148
mongodb-bson-regex.construct.php                   13-Apr-2024 02:08                7020
mongodb-bson-regex.getflags.php                    13-Apr-2024 02:08                4513
mongodb-bson-regex.getpattern.php                  13-Apr-2024 02:08                4375
mongodb-bson-regex.jsonserialize.php               13-Apr-2024 02:08                5394
mongodb-bson-regex.serialize.php                   13-Apr-2024 02:08                3474
mongodb-bson-regex.tostring.php                    13-Apr-2024 02:08                3899
mongodb-bson-regex.unserialize.php                 13-Apr-2024 02:08                4292
mongodb-bson-regexinterface.getflags.php           13-Apr-2024 02:08                2841
mongodb-bson-regexinterface.getpattern.php         13-Apr-2024 02:08                2884
mongodb-bson-regexinterface.tostring.php           13-Apr-2024 02:08                2915
mongodb-bson-serializable.bsonserialize.php        13-Apr-2024 02:08               16599
mongodb-bson-symbol.construct.php                  13-Apr-2024 02:08                2606
mongodb-bson-symbol.jsonserialize.php              13-Apr-2024 02:08                5415
mongodb-bson-symbol.serialize.php                  13-Apr-2024 02:08                3499
mongodb-bson-symbol.tostring.php                   13-Apr-2024 02:08                2662
mongodb-bson-symbol.unserialize.php                13-Apr-2024 02:08                3755
mongodb-bson-timestamp.construct.php               13-Apr-2024 02:08                4820
mongodb-bson-timestamp.getincrement.php            13-Apr-2024 02:08                4312
mongodb-bson-timestamp.gettimestamp.php            13-Apr-2024 02:08                4297
mongodb-bson-timestamp.jsonserialize.php           13-Apr-2024 02:08                5482
mongodb-bson-timestamp.serialize.php               13-Apr-2024 02:08                3574
mongodb-bson-timestamp.tostring.php                13-Apr-2024 02:08                4043
mongodb-bson-timestamp.unserialize.php             13-Apr-2024 02:08                4388
mongodb-bson-timestampinterface.getincrement.php   13-Apr-2024 02:08                3368
mongodb-bson-timestampinterface.gettimestamp.php   13-Apr-2024 02:08                3383
mongodb-bson-timestampinterface.tostring.php       13-Apr-2024 02:08                3007
mongodb-bson-undefined.construct.php               13-Apr-2024 02:08                2666
mongodb-bson-undefined.jsonserialize.php           13-Apr-2024 02:08                5478
mongodb-bson-undefined.serialize.php               13-Apr-2024 02:08                3574
mongodb-bson-undefined.tostring.php                13-Apr-2024 02:08                2684
mongodb-bson-undefined.unserialize.php             13-Apr-2024 02:08                3817
mongodb-bson-unserializable.bsonunserialize.php    13-Apr-2024 02:08                7072
mongodb-bson-utcdatetime.construct.php             13-Apr-2024 02:08                8167
mongodb-bson-utcdatetime.jsonserialize.php         13-Apr-2024 02:08                5520
mongodb-bson-utcdatetime.serialize.php             13-Apr-2024 02:08                3626
mongodb-bson-utcdatetime.todatetime.php            13-Apr-2024 02:08                5844
mongodb-bson-utcdatetime.tostring.php              13-Apr-2024 02:08                3997
mongodb-bson-utcdatetime.unserialize.php           13-Apr-2024 02:08                4420
mongodb-bson-utcdatetimeinterface.todatetime.php   13-Apr-2024 02:08                3284
mongodb-bson-utcdatetimeinterface.tostring.php     13-Apr-2024 02:08                3023
mongodb-driver-bulkwrite.construct.php             13-Apr-2024 02:08               18657
mongodb-driver-bulkwrite.count.php                 13-Apr-2024 02:08                6939
mongodb-driver-bulkwrite.delete.php                13-Apr-2024 02:08               12040
mongodb-driver-bulkwrite.insert.php                13-Apr-2024 02:08                9615
mongodb-driver-bulkwrite.update.php                13-Apr-2024 02:08               15650
mongodb-driver-clientencryption.addkeyaltname.php  13-Apr-2024 02:08                5556
mongodb-driver-clientencryption.construct.php      13-Apr-2024 02:08               11441
mongodb-driver-clientencryption.createdatakey.php  13-Apr-2024 02:08               10986
mongodb-driver-clientencryption.decrypt.php        13-Apr-2024 02:08                4197
mongodb-driver-clientencryption.deletekey.php      13-Apr-2024 02:08                4293
mongodb-driver-clientencryption.encrypt.php        13-Apr-2024 02:08               12813
mongodb-driver-clientencryption.encryptexpressi..> 13-Apr-2024 02:08               14522
mongodb-driver-clientencryption.getkey.php         13-Apr-2024 02:08                4426
mongodb-driver-clientencryption.getkeybyaltname..> 13-Apr-2024 02:08                5026
mongodb-driver-clientencryption.getkeys.php        13-Apr-2024 02:08                3853
mongodb-driver-clientencryption.removekeyaltnam..> 13-Apr-2024 02:08                5621
mongodb-driver-clientencryption.rewrapmanydatak..> 13-Apr-2024 02:08               12164
mongodb-driver-command.construct.php               13-Apr-2024 02:08               14246
mongodb-driver-commandexception.getresultdocume..> 13-Apr-2024 02:08                3257
mongodb-driver-cursor.construct.php                13-Apr-2024 02:08                3340
mongodb-driver-cursor.current.php                  13-Apr-2024 02:08                3116
mongodb-driver-cursor.getid.php                    13-Apr-2024 02:08                7615
mongodb-driver-cursor.getserver.php                13-Apr-2024 02:08                7508
mongodb-driver-cursor.isdead.php                   13-Apr-2024 02:08               10630
mongodb-driver-cursor.key.php                      13-Apr-2024 02:08                2674
mongodb-driver-cursor.next.php                     13-Apr-2024 02:08                3513
mongodb-driver-cursor.rewind.php                   13-Apr-2024 02:08                3965
mongodb-driver-cursor.settypemap.php               13-Apr-2024 02:08                7970
mongodb-driver-cursor.toarray.php                  13-Apr-2024 02:08                7701
mongodb-driver-cursor.valid.php                    13-Apr-2024 02:08                2852
mongodb-driver-cursorid.construct.php              13-Apr-2024 02:08                2828
mongodb-driver-cursorid.serialize.php              13-Apr-2024 02:08                3597
mongodb-driver-cursorid.tostring.php               13-Apr-2024 02:08                6997
mongodb-driver-cursorid.unserialize.php            13-Apr-2024 02:08                4427
mongodb-driver-cursorinterface.getid.php           13-Apr-2024 02:08                4019
mongodb-driver-cursorinterface.getserver.php       13-Apr-2024 02:08                4120
mongodb-driver-cursorinterface.isdead.php          13-Apr-2024 02:08                4083
mongodb-driver-cursorinterface.settypemap.php      13-Apr-2024 02:08                4108
mongodb-driver-cursorinterface.toarray.php         13-Apr-2024 02:08                3982
mongodb-driver-manager.addsubscriber.php           13-Apr-2024 02:08                5540
mongodb-driver-manager.construct.php               13-Apr-2024 02:08               80294
mongodb-driver-manager.createclientencryption.php  13-Apr-2024 02:08               12774
mongodb-driver-manager.executebulkwrite.php        13-Apr-2024 02:08               22838
mongodb-driver-manager.executecommand.php          13-Apr-2024 02:08               24875
mongodb-driver-manager.executequery.php            13-Apr-2024 02:08               16256
mongodb-driver-manager.executereadcommand.php      13-Apr-2024 02:08               10241
mongodb-driver-manager.executereadwritecommand.php 13-Apr-2024 02:08               11217
mongodb-driver-manager.executewritecommand.php     13-Apr-2024 02:08               11297
mongodb-driver-manager.getencryptedfieldsmap.php   13-Apr-2024 02:08                3917
mongodb-driver-manager.getreadconcern.php          13-Apr-2024 02:08                5912
mongodb-driver-manager.getreadpreference.php       13-Apr-2024 02:08                6507
mongodb-driver-manager.getservers.php              13-Apr-2024 02:08                7953
mongodb-driver-manager.getwriteconcern.php         13-Apr-2024 02:08                5965
mongodb-driver-manager.removesubscriber.php        13-Apr-2024 02:08                4932
mongodb-driver-manager.selectserver.php            13-Apr-2024 02:08                7209
mongodb-driver-manager.startsession.php            13-Apr-2024 02:08               12602
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:08                3721
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:08                3814
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:08                3645
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:08                4848
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:08                4036
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:08                4272
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:08                4198
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:08                4034
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:08                3818
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:08                4043
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:08                3753
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:08                3655
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:08                5157
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:08                4733
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:08                4489
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:08                4054
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:08                3838
mongodb-driver-monitoring-commandsubscriber.com..> 13-Apr-2024 02:08                4909
mongodb-driver-monitoring-commandsubscriber.com..> 13-Apr-2024 02:08                4959
mongodb-driver-monitoring-commandsubscriber.com..> 13-Apr-2024 02:08                4972
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:08                3778
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:08                3883
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:08                4935
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:08                4093
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:08                4335
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:08                4703
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:08                4094
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:08                3864
mongodb-driver-monitoring-logsubscriber.log.php    13-Apr-2024 02:08                4639
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:08                4792
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:08                4762
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:08                5329
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:08                5374
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:08                5405
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:08                4792
mongodb-driver-monitoring-sdamsubscriber.topolo..> 13-Apr-2024 02:08                4867
mongodb-driver-monitoring-sdamsubscriber.topolo..> 13-Apr-2024 02:08                4804
mongodb-driver-monitoring-sdamsubscriber.topolo..> 13-Apr-2024 02:08                4787
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:08                3183
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:08                3499
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:08                3251
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:08                3576
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:08                3299
mongodb-driver-monitoring-serverclosedevent.get..> 13-Apr-2024 02:08                3145
mongodb-driver-monitoring-serverclosedevent.get..> 13-Apr-2024 02:08                3195
mongodb-driver-monitoring-serverclosedevent.get..> 13-Apr-2024 02:08                3255
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:08                3631
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:08                3483
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:08                3320
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:08                3349
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:08                3705
mongodb-driver-monitoring-serverheartbeatstarte..> 13-Apr-2024 02:08                3325
mongodb-driver-monitoring-serverheartbeatstarte..> 13-Apr-2024 02:08                3367
mongodb-driver-monitoring-serverheartbeatstarte..> 13-Apr-2024 02:08                3725
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:08                3683
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:08                3392
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:08                3401
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:08                4230
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:08                3741
mongodb-driver-monitoring-serveropeningevent.ge..> 13-Apr-2024 02:08                3163
mongodb-driver-monitoring-serveropeningevent.ge..> 13-Apr-2024 02:08                3213
mongodb-driver-monitoring-serveropeningevent.ge..> 13-Apr-2024 02:08                3287
mongodb-driver-monitoring-topologychangedevent...> 13-Apr-2024 02:08                3568
mongodb-driver-monitoring-topologychangedevent...> 13-Apr-2024 02:08                3646
mongodb-driver-monitoring-topologychangedevent...> 13-Apr-2024 02:08                3307
mongodb-driver-monitoring-topologyclosedevent.g..> 13-Apr-2024 02:08                3252
mongodb-driver-monitoring-topologyopeningevent...> 13-Apr-2024 02:08                3262
mongodb-driver-query.construct.php                 13-Apr-2024 02:08               32845
mongodb-driver-readconcern.bsonserialize.php       13-Apr-2024 02:08                6791
mongodb-driver-readconcern.construct.php           13-Apr-2024 02:08                5717
mongodb-driver-readconcern.getlevel.php            13-Apr-2024 02:08                5798
mongodb-driver-readconcern.isdefault.php           13-Apr-2024 02:08                8072
mongodb-driver-readconcern.serialize.php           13-Apr-2024 02:08                3674
mongodb-driver-readconcern.unserialize.php         13-Apr-2024 02:08                4478
mongodb-driver-readpreference.bsonserialize.php    13-Apr-2024 02:08               10431
mongodb-driver-readpreference.construct.php        13-Apr-2024 02:08               18440
mongodb-driver-readpreference.gethedge.php         13-Apr-2024 02:08                3429
mongodb-driver-readpreference.getmaxstalenessse..> 13-Apr-2024 02:08                8170
mongodb-driver-readpreference.getmode.php          13-Apr-2024 02:08                7494
mongodb-driver-readpreference.getmodestring.php    13-Apr-2024 02:08                7700
mongodb-driver-readpreference.gettagsets.php       13-Apr-2024 02:08                8055
mongodb-driver-readpreference.serialize.php        13-Apr-2024 02:08                3751
mongodb-driver-readpreference.unserialize.php      13-Apr-2024 02:08                4557
mongodb-driver-runtimeexception.haserrorlabel.php  13-Apr-2024 02:08                4272
mongodb-driver-server.construct.php                13-Apr-2024 02:08                3372
mongodb-driver-server.executebulkwrite.php         13-Apr-2024 02:08               11127
mongodb-driver-server.executecommand.php           13-Apr-2024 02:08               13169
mongodb-driver-server.executequery.php             13-Apr-2024 02:08                8483
mongodb-driver-server.executereadcommand.php       13-Apr-2024 02:08               10568
mongodb-driver-server.executereadwritecommand.php  13-Apr-2024 02:08               11734
mongodb-driver-server.executewritecommand.php      13-Apr-2024 02:08               11780
mongodb-driver-server.gethost.php                  13-Apr-2024 02:08                5461
mongodb-driver-server.getinfo.php                  13-Apr-2024 02:08               10624
mongodb-driver-server.getlatency.php               13-Apr-2024 02:08                7134
mongodb-driver-server.getport.php                  13-Apr-2024 02:08                5503
mongodb-driver-server.getserverdescription.php     13-Apr-2024 02:08                3423
mongodb-driver-server.gettags.php                  13-Apr-2024 02:08                3790
mongodb-driver-server.gettype.php                  13-Apr-2024 02:08                3826
mongodb-driver-server.isarbiter.php                13-Apr-2024 02:08                3643
mongodb-driver-server.ishidden.php                 13-Apr-2024 02:08                3637
mongodb-driver-server.ispassive.php                13-Apr-2024 02:08                3705
mongodb-driver-server.isprimary.php                13-Apr-2024 02:08                3650
mongodb-driver-server.issecondary.php              13-Apr-2024 02:08                3685
mongodb-driver-serverapi.bsonserialize.php         13-Apr-2024 02:08                3312
mongodb-driver-serverapi.construct.php             13-Apr-2024 02:08                5202
mongodb-driver-serverapi.serialize.php             13-Apr-2024 02:08                3627
mongodb-driver-serverapi.unserialize.php           13-Apr-2024 02:08                4445
mongodb-driver-serverdescription.gethellorespon..> 13-Apr-2024 02:08                5206
mongodb-driver-serverdescription.gethost.php       13-Apr-2024 02:08                3452
mongodb-driver-serverdescription.getlastupdatet..> 13-Apr-2024 02:08                3603
mongodb-driver-serverdescription.getport.php       13-Apr-2024 02:08                3507
mongodb-driver-serverdescription.getroundtripti..> 13-Apr-2024 02:08                3906
mongodb-driver-serverdescription.gettype.php       13-Apr-2024 02:08                3842
mongodb-driver-session.aborttransaction.php        13-Apr-2024 02:08                4206
mongodb-driver-session.advanceclustertime.php      13-Apr-2024 02:08                4876
mongodb-driver-session.advanceoperationtime.php    13-Apr-2024 02:08                4816
mongodb-driver-session.committransaction.php       13-Apr-2024 02:08                5562
mongodb-driver-session.construct.php               13-Apr-2024 02:08                2895
mongodb-driver-session.endsession.php              13-Apr-2024 02:08                4343
mongodb-driver-session.getclustertime.php          13-Apr-2024 02:08                3980
mongodb-driver-session.getlogicalsessionid.php     13-Apr-2024 02:08                3133
mongodb-driver-session.getoperationtime.php        13-Apr-2024 02:08                4060
mongodb-driver-session.getserver.php               13-Apr-2024 02:08                3948
mongodb-driver-session.gettransactionoptions.php   13-Apr-2024 02:08                3835
mongodb-driver-session.gettransactionstate.php     13-Apr-2024 02:08                3739
mongodb-driver-session.isdirty.php                 13-Apr-2024 02:08                3018
mongodb-driver-session.isintransaction.php         13-Apr-2024 02:08                3801
mongodb-driver-session.starttransaction.php        13-Apr-2024 02:08                9078
mongodb-driver-topologydescription.getservers.php  13-Apr-2024 02:08                3460
mongodb-driver-topologydescription.gettype.php     13-Apr-2024 02:08                3508
mongodb-driver-topologydescription.hasreadables..> 13-Apr-2024 02:08                3947
mongodb-driver-topologydescription.haswritables..> 13-Apr-2024 02:08                3228
mongodb-driver-writeconcern.bsonserialize.php      13-Apr-2024 02:08                7236
mongodb-driver-writeconcern.construct.php          13-Apr-2024 02:08               10520
mongodb-driver-writeconcern.getjournal.php         13-Apr-2024 02:08                5984
mongodb-driver-writeconcern.getw.php               13-Apr-2024 02:08                5274
mongodb-driver-writeconcern.getwtimeout.php        13-Apr-2024 02:08                5902
mongodb-driver-writeconcern.isdefault.php          13-Apr-2024 02:08                7859
mongodb-driver-writeconcern.serialize.php          13-Apr-2024 02:08                3699
mongodb-driver-writeconcern.unserialize.php        13-Apr-2024 02:08                4517
mongodb-driver-writeconcernerror.getcode.php       13-Apr-2024 02:08                6322
mongodb-driver-writeconcernerror.getinfo.php       13-Apr-2024 02:08                6648
mongodb-driver-writeconcernerror.getmessage.php    13-Apr-2024 02:08                6413
mongodb-driver-writeerror.getcode.php              13-Apr-2024 02:08                5660
mongodb-driver-writeerror.getindex.php             13-Apr-2024 02:08                6193
mongodb-driver-writeerror.getinfo.php              13-Apr-2024 02:08                3130
mongodb-driver-writeerror.getmessage.php           13-Apr-2024 02:08                5796
mongodb-driver-writeexception.getwriteresult.php   13-Apr-2024 02:08                7922
mongodb-driver-writeresult.getdeletedcount.php     13-Apr-2024 02:08                8153
mongodb-driver-writeresult.getinsertedcount.php    13-Apr-2024 02:08                8235
mongodb-driver-writeresult.getmatchedcount.php     13-Apr-2024 02:08                8798
mongodb-driver-writeresult.getmodifiedcount.php    13-Apr-2024 02:08                9096
mongodb-driver-writeresult.getserver.php           13-Apr-2024 02:08                6528
mongodb-driver-writeresult.getupsertedcount.php    13-Apr-2024 02:08                8324
mongodb-driver-writeresult.getupsertedids.php      13-Apr-2024 02:08                8810
mongodb-driver-writeresult.getwriteconcernerror..> 13-Apr-2024 02:08                7200
mongodb-driver-writeresult.getwriteerrors.php      13-Apr-2024 02:08               13019
mongodb-driver-writeresult.isacknowledged.php      13-Apr-2024 02:08                8175
mongodb.architecture.php                           13-Apr-2024 02:08                1922
mongodb.configuration.php                          13-Apr-2024 02:08                4052
mongodb.connection-handling.php                    13-Apr-2024 02:08                8672
mongodb.constants.php                              13-Apr-2024 02:08                2115
mongodb.exceptions.php                             13-Apr-2024 02:08                5149
mongodb.exceptions.tree.php                        13-Apr-2024 02:08                5559
mongodb.installation.homebrew.php                  13-Apr-2024 02:08                1970
mongodb.installation.manual.php                    13-Apr-2024 02:08                6120
mongodb.installation.pecl.php                      13-Apr-2024 02:08                4895
mongodb.installation.php                           13-Apr-2024 02:08                1755
mongodb.installation.windows.php                   13-Apr-2024 02:08                4376
mongodb.monitoring.php                             13-Apr-2024 02:08               18968
mongodb.overview.php                               13-Apr-2024 02:08                4599
mongodb.persistence.deserialization.php            13-Apr-2024 02:08               21783
mongodb.persistence.php                            13-Apr-2024 02:08                1804
mongodb.persistence.serialization.php              13-Apr-2024 02:08               20074
mongodb.requirements.php                           13-Apr-2024 02:08                3108
mongodb.security.php                               13-Apr-2024 02:08                1484
mongodb.security.request_injection.php             13-Apr-2024 02:08                2970
mongodb.security.script_injection.php              13-Apr-2024 02:08                9159
mongodb.setup.php                                  13-Apr-2024 02:08                2028
mongodb.tutorial.apm.php                           13-Apr-2024 02:08               18727
mongodb.tutorial.library.php                       13-Apr-2024 02:08               10666
mongodb.tutorial.php                               13-Apr-2024 02:08                1699
mqseries.configure.php                             13-Apr-2024 02:08                2742
mqseries.constants.php