Index of /php/manual/ru/

feeds/                                             18-Jun-2024 14:07                   -
images/                                            18-Jun-2024 14:06                   -
styles/                                            18-Jun-2024 14:06                   -
toc/                                               18-Jun-2024 14:07                   -
about.formats.php                                  18-Jun-2024 14:07                6191
about.generate.php                                 18-Jun-2024 14:07                3503
about.howtohelp.php                                18-Jun-2024 14:07                4897
about.more.php                                     18-Jun-2024 14:07                2697
about.notes.php                                    18-Jun-2024 14:07                3386
about.php                                          18-Jun-2024 14:07                2141
about.phpversions.php                              18-Jun-2024 14:07                5124
about.prototypes.php                               18-Jun-2024 14:07                9490
about.translations.php                             18-Jun-2024 14:07                4296
aliases.php                                        18-Jun-2024 14:07               30414
allowdynamicproperties.construct.php               18-Jun-2024 14:06                2360
apache.configuration.php                           18-Jun-2024 14:06                6227
apache.constants.php                               18-Jun-2024 14:06                1314
apache.installation.php                            18-Jun-2024 14:06                1411
apache.requirements.php                            18-Jun-2024 14:06                1317
apache.resources.php                               18-Jun-2024 14:06                1378
apache.setup.php                                   18-Jun-2024 14:06                1737
apcu.configuration.php                             18-Jun-2024 14:06               21296
apcu.constants.php                                 18-Jun-2024 14:06                7650
apcu.installation.php                              18-Jun-2024 14:06                4114
apcu.requirements.php                              18-Jun-2024 14:06                1303
apcu.resources.php                                 18-Jun-2024 14:06                1364
apcu.setup.php                                     18-Jun-2024 14:06                1695
apcuiterator.construct.php                         18-Jun-2024 14:06                7467
apcuiterator.current.php                           18-Jun-2024 14:06                3350
apcuiterator.gettotalcount.php                     18-Jun-2024 14:06                3599
apcuiterator.gettotalhits.php                      18-Jun-2024 14:06                3816
apcuiterator.gettotalsize.php                      18-Jun-2024 14:06                3395
apcuiterator.key.php                               18-Jun-2024 14:06                3118                              18-Jun-2024 14:06                3423
apcuiterator.rewind.php                            18-Jun-2024 14:06                3040
apcuiterator.valid.php                             18-Jun-2024 14:06                3255
appendices.php                                     18-Jun-2024 14:07               15464
appenditerator.append.php                          18-Jun-2024 14:06                5769
appenditerator.construct.php                       18-Jun-2024 14:06               10772
appenditerator.current.php                         18-Jun-2024 14:06                3838
appenditerator.getarrayiterator.php                18-Jun-2024 14:06                3416
appenditerator.getiteratorindex.php                18-Jun-2024 14:06                7128
appenditerator.key.php                             18-Jun-2024 14:06                8413                            18-Jun-2024 14:06                3793
appenditerator.rewind.php                          18-Jun-2024 14:06                3751
appenditerator.valid.php                           18-Jun-2024 14:06                3705
array.configuration.php                            18-Jun-2024 14:06                1425
array.constants.php                                18-Jun-2024 14:06               12931
array.installation.php                             18-Jun-2024 14:06                1427
array.requirements.php                             18-Jun-2024 14:06                1310
array.resources.php                                18-Jun-2024 14:06                1371
array.setup.php                                    18-Jun-2024 14:06                1712
array.sorting.php                                  18-Jun-2024 14:06                8322
arrayaccess.offsetexists.php                       18-Jun-2024 14:06               10055
arrayaccess.offsetget.php                          18-Jun-2024 14:06                6091
arrayaccess.offsetset.php                          18-Jun-2024 14:06                6020
arrayaccess.offsetunset.php                        18-Jun-2024 14:06                3063
arrayiterator.append.php                           18-Jun-2024 14:06                4035
arrayiterator.asort.php                            18-Jun-2024 14:06                8427
arrayiterator.construct.php                        18-Jun-2024 14:06                4055
arrayiterator.count.php                            18-Jun-2024 14:06                3682
arrayiterator.current.php                          18-Jun-2024 14:06                5532
arrayiterator.getarraycopy.php                     18-Jun-2024 14:06                3432
arrayiterator.getflags.php                         18-Jun-2024 14:06                3404
arrayiterator.key.php                              18-Jun-2024 14:06                4307
arrayiterator.ksort.php                            18-Jun-2024 14:06                8377
arrayiterator.natcasesort.php                      18-Jun-2024 14:06                5580
arrayiterator.natsort.php                          18-Jun-2024 14:06                5488                             18-Jun-2024 14:06                5010
arrayiterator.offsetexists.php                     18-Jun-2024 14:06                3687
arrayiterator.offsetget.php                        18-Jun-2024 14:06                3761
arrayiterator.offsetset.php                        18-Jun-2024 14:06                4083
arrayiterator.offsetunset.php                      18-Jun-2024 14:06                4275
arrayiterator.rewind.php                           18-Jun-2024 14:06                4970                             18-Jun-2024 14:06                2955
arrayiterator.serialize.php                        18-Jun-2024 14:06                3153
arrayiterator.setflags.php                         18-Jun-2024 14:06                4759
arrayiterator.uasort.php                           18-Jun-2024 14:06                7599
arrayiterator.uksort.php                           18-Jun-2024 14:06                7497
arrayiterator.unserialize.php                      18-Jun-2024 14:06                3494
arrayiterator.valid.php                            18-Jun-2024 14:06                5124
arrayobject.append.php                             18-Jun-2024 14:06                6013
arrayobject.asort.php                              18-Jun-2024 14:06               11776
arrayobject.construct.php                          18-Jun-2024 14:06                6708
arrayobject.count.php                              18-Jun-2024 14:06                5849
arrayobject.exchangearray.php                      18-Jun-2024 14:06                6945
arrayobject.getarraycopy.php                       18-Jun-2024 14:06                5612
arrayobject.getflags.php                           18-Jun-2024 14:06                6578
arrayobject.getiterator.php                        18-Jun-2024 14:06                5535
arrayobject.getiteratorclass.php                   18-Jun-2024 14:06                7177
arrayobject.ksort.php                              18-Jun-2024 14:06               11285
arrayobject.natcasesort.php                        18-Jun-2024 14:06                9693
arrayobject.natsort.php                            18-Jun-2024 14:06                9403
arrayobject.offsetexists.php                       18-Jun-2024 14:06                5268
arrayobject.offsetget.php                          18-Jun-2024 14:06                5473
arrayobject.offsetset.php                          18-Jun-2024 14:06                7207
arrayobject.offsetunset.php                        18-Jun-2024 14:06                4626
arrayobject.serialize.php                          18-Jun-2024 14:06                5528
arrayobject.setflags.php                           18-Jun-2024 14:06                7508
arrayobject.setiteratorclass.php                   18-Jun-2024 14:06                6415
arrayobject.uasort.php                             18-Jun-2024 14:06               12410
arrayobject.uksort.php                             18-Jun-2024 14:06               11737
arrayobject.unserialize.php                        18-Jun-2024 14:06                3945
attribute.construct.php                            18-Jun-2024 14:06                2423
backedenum.from.php                                18-Jun-2024 14:06                6801
backedenum.tryfrom.php                             18-Jun-2024 14:06                7216
bc.configuration.php                               18-Jun-2024 14:06                2882
bc.constants.php                                   18-Jun-2024 14:06                1288
bc.installation.php                                18-Jun-2024 14:06                1684
bc.requirements.php                                18-Jun-2024 14:06                1289
bc.resources.php                                   18-Jun-2024 14:06                1350
bc.setup.php                                       18-Jun-2024 14:06                1695
book.apache.php                                    18-Jun-2024 14:06                3879
book.apcu.php                                      18-Jun-2024 14:06                5318
book.array.php                                     18-Jun-2024 14:06               16319
book.bc.php                                        18-Jun-2024 14:06                3763
book.bson.php                                      18-Jun-2024 14:06               29190
book.bzip2.php                                     18-Jun-2024 14:06                3414
book.calendar.php                                  18-Jun-2024 14:06                5637
book.classobj.php                                  18-Jun-2024 14:06                5420
book.cmark.php                                     18-Jun-2024 14:06                9914                                       18-Jun-2024 14:06                9446
book.componere.php                                 18-Jun-2024 14:06                6866
book.ctype.php                                     18-Jun-2024 14:06                3640
book.cubrid.php                                    18-Jun-2024 14:06               18225
book.curl.php                                      18-Jun-2024 14:06                8638
book.datetime.php                                  18-Jun-2024 14:06               21137
book.dba.php                                       18-Jun-2024 14:06                4154
book.dbase.php                                     18-Jun-2024 14:06                3835
book.dio.php                                       18-Jun-2024 14:06                3750
book.dir.php                                       18-Jun-2024 14:06                3740
book.dom.php                                       18-Jun-2024 14:06               26135
book.ds.php                                        18-Jun-2024 14:06               34084
book.eio.php                                       18-Jun-2024 14:06               10847
book.enchant.php                                   18-Jun-2024 14:06                6336
book.errorfunc.php                                 18-Jun-2024 14:06                4071
book.ev.php                                        18-Jun-2024 14:06               17254
book.event.php                                     18-Jun-2024 14:06               29769
book.exec.php                                      18-Jun-2024 14:06                4056
book.exif.php                                      18-Jun-2024 14:06                2822
book.expect.php                                    18-Jun-2024 14:06                2872
book.fann.php                                      18-Jun-2024 14:06               30739
book.fdf.php                                       18-Jun-2024 14:06                6930
book.ffi.php                                       18-Jun-2024 14:06                6711
book.fileinfo.php                                  18-Jun-2024 14:06                3438
book.filesystem.php                                18-Jun-2024 14:06               13108
book.filter.php                                    18-Jun-2024 14:06                4197
book.fpm.php                                       18-Jun-2024 14:06                2176
book.ftp.php                                       18-Jun-2024 14:06                7414
book.funchand.php                                  18-Jun-2024 14:06                4504
book.gearman.php                                   18-Jun-2024 14:06               20456
book.gender.php                                    18-Jun-2024 14:06                2848
book.geoip.php                                     18-Jun-2024 14:06                5245
book.gettext.php                                   18-Jun-2024 14:06                3491
book.gmagick.php                                   18-Jun-2024 14:06               30280
book.gmp.php                                       18-Jun-2024 14:06                8450
book.gnupg.php                                     18-Jun-2024 14:06                6195
book.hash.php                                      18-Jun-2024 14:06                5229
book.hrtime.php                                    18-Jun-2024 14:06                4090
book.ibase.php                                     18-Jun-2024 14:06               14844                                   18-Jun-2024 14:06               12191
book.iconv.php                                     18-Jun-2024 14:06                3831
book.igbinary.php                                  18-Jun-2024 14:06                2352
book.image.php                                     18-Jun-2024 14:06               20807
book.imagick.php                                   18-Jun-2024 14:06               86244
book.imap.php                                      18-Jun-2024 14:06               13285                                      18-Jun-2024 14:06               10552
book.inotify.php                                   18-Jun-2024 14:06                2868
book.intl.php                                      18-Jun-2024 14:06               60166
book.json.php                                      18-Jun-2024 14:06                3299
book.ldap.php                                      18-Jun-2024 14:06               11765
book.libxml.php                                    18-Jun-2024 14:06                3849
book.lua.php                                       18-Jun-2024 14:06                2917
book.luasandbox.php                                18-Jun-2024 14:06                6416
book.lzf.php                                       18-Jun-2024 14:06                2360
book.mail.php                                      18-Jun-2024 14:06                2288
book.mailparse.php                                 18-Jun-2024 14:06                4620
book.math.php                                      18-Jun-2024 14:06                7713
book.mbstring.php                                  18-Jun-2024 14:06               13935
book.mcrypt.php                                    18-Jun-2024 14:06                7889
book.memcache.php                                  18-Jun-2024 14:06                5078
book.memcached.php                                 18-Jun-2024 14:06               10534
book.mhash.php                                     18-Jun-2024 14:06                2757
book.misc.php                                      18-Jun-2024 14:06                6668
book.mongodb.php                                   18-Jun-2024 14:06               31989
book.mqseries.php                                  18-Jun-2024 14:06                3348
book.mysql-xdevapi.php                             18-Jun-2024 14:06               35582
book.mysql.php                                     18-Jun-2024 14:06               10243
book.mysqli.php                                    18-Jun-2024 14:06               24203
book.mysqlnd.php                                   18-Jun-2024 14:06                2736                                   18-Jun-2024 14:06                7129
book.oauth.php                                     18-Jun-2024 14:06                8445
book.oci8.php                                      18-Jun-2024 14:06               21708
book.opcache.php                                   18-Jun-2024 14:06                2971
book.openal.php                                    18-Jun-2024 14:06                5295
book.openssl.php                                   18-Jun-2024 14:06               13613
book.outcontrol.php                                18-Jun-2024 14:06                6562
book.parallel.php                                  18-Jun-2024 14:06                6285
book.parle.php                                     18-Jun-2024 14:06               10929
book.password.php                                  18-Jun-2024 14:06                2976
book.pcntl.php                                     18-Jun-2024 14:06                6416
book.pcre.php                                      18-Jun-2024 14:06                4860
book.pdo.php                                       18-Jun-2024 14:06               10173
book.pgsql.php                                     18-Jun-2024 14:06               17159
book.phar.php                                      18-Jun-2024 14:06               19052
book.phpdbg.php                                    18-Jun-2024 14:06                3369
book.posix.php                                     18-Jun-2024 14:06                9272                                        18-Jun-2024 14:06               11962
book.pspell.php                                    18-Jun-2024 14:06                5418
book.pthreads.php                                  18-Jun-2024 14:06                6251
book.quickhash.php                                 18-Jun-2024 14:06               10255
book.radius.php                                    18-Jun-2024 14:06                6883
book.random.php                                    18-Jun-2024 14:06               11148
book.rar.php                                       18-Jun-2024 14:06                6453
book.readline.php                                  18-Jun-2024 14:06                4391
book.recode.php                                    18-Jun-2024 14:06                2568
book.reflection.php                                18-Jun-2024 14:06               46672
book.rnp.php                                       18-Jun-2024 14:06                8012
book.rpminfo.php                                   18-Jun-2024 14:06                2900
book.rrd.php                                       18-Jun-2024 14:06                6281
book.runkit7.php                                   18-Jun-2024 14:06                5146
book.scoutapm.php                                  18-Jun-2024 14:06                2389
book.seaslog.php                                   18-Jun-2024 14:06                6609
book.sem.php                                       18-Jun-2024 14:06                5123
book.session.php                                   18-Jun-2024 14:06                9708
book.shmop.php                                     18-Jun-2024 14:06                3379
book.simdjson.php                                  18-Jun-2024 14:06                2982
book.simplexml.php                                 18-Jun-2024 14:06                6563
book.snmp.php                                      18-Jun-2024 14:06                7206
book.soap.php                                      18-Jun-2024 14:06                7159
book.sockets.php                                   18-Jun-2024 14:06                8927
book.sodium.php                                    18-Jun-2024 14:06               21860
book.solr.php                                      18-Jun-2024 14:06               69170
book.spl.php                                       18-Jun-2024 14:06               11208
book.sqlite3.php                                   18-Jun-2024 14:06                9299
book.sqlsrv.php                                    18-Jun-2024 14:06                6692
book.ssdeep.php                                    18-Jun-2024 14:06                2559
book.ssh2.php                                      18-Jun-2024 14:06                6783
book.stats.php                                     18-Jun-2024 14:06               15341
book.stomp.php                                     18-Jun-2024 14:06                4934                                    18-Jun-2024 14:06               15080
book.strings.php                                   18-Jun-2024 14:06               17496
book.svm.php                                       18-Jun-2024 14:06                4437
book.svn.php                                       18-Jun-2024 14:06                9910
book.swoole.php                                    18-Jun-2024 14:06               45882
book.sync.php                                      18-Jun-2024 14:06                5558
book.taint.php                                     18-Jun-2024 14:06                2917
book.tcpwrap.php                                   18-Jun-2024 14:06                2192
book.tidy.php                                      18-Jun-2024 14:06                8610
book.tokenizer.php                                 18-Jun-2024 14:06                3597
book.trader.php                                    18-Jun-2024 14:06               29631
book.ui.php                                        18-Jun-2024 14:06               34856
book.uodbc.php                                     18-Jun-2024 14:06                8949
book.uopz.php                                      18-Jun-2024 14:06                6669
book.url.php                                       18-Jun-2024 14:06                3411
book.v8js.php                                      18-Jun-2024 14:06                3435
book.var.php                                       18-Jun-2024 14:06                7569
book.var_representation.php                        18-Jun-2024 14:06                2307
book.varnish.php                                   18-Jun-2024 14:06                6568
book.wddx.php                                      18-Jun-2024 14:06                3149
book.win32service.php                              18-Jun-2024 14:06                4735
book.wincache.php                                  18-Jun-2024 14:06                7109
book.wkhtmltox.php                                 18-Jun-2024 14:06                3658
book.xattr.php                                     18-Jun-2024 14:06                2798
book.xdiff.php                                     18-Jun-2024 14:06                4940
book.xhprof.php                                    18-Jun-2024 14:06                2758
book.xlswriter.php                                 18-Jun-2024 14:06                4891
book.xml.php                                       18-Jun-2024 14:06                6728
book.xmldiff.php                                   18-Jun-2024 14:06                3667
book.xmlreader.php                                 18-Jun-2024 14:06                6072
book.xmlrpc.php                                    18-Jun-2024 14:06                4341
book.xmlwriter.php                                 18-Jun-2024 14:06                8177
book.xsl.php                                       18-Jun-2024 14:06                4371
book.yac.php                                       18-Jun-2024 14:06                2841
book.yaconf.php                                    18-Jun-2024 14:06                2312
book.yaf.php                                       18-Jun-2024 14:06               40190
book.yaml.php                                      18-Jun-2024 14:06                3088
book.yar.php                                       18-Jun-2024 14:06                4084
book.yaz.php                                       18-Jun-2024 14:06                5329                                       18-Jun-2024 14:06               12949
book.zlib.php                                      18-Jun-2024 14:06                6390
book.zmq.php                                       18-Jun-2024 14:06                6613
book.zookeeper.php                                 18-Jun-2024 14:06                8085
bzip2.configuration.php                            18-Jun-2024 14:06                1425
bzip2.constants.php                                18-Jun-2024 14:06                1304
bzip2.examples.php                                 18-Jun-2024 14:06                4375
bzip2.installation.php                             18-Jun-2024 14:06                1523
bzip2.requirements.php                             18-Jun-2024 14:06                1473
bzip2.resources.php                                18-Jun-2024 14:06                1438
bzip2.setup.php                                    18-Jun-2024 14:06                1724
cachingiterator.construct.php                      18-Jun-2024 14:06                3008
cachingiterator.count.php                          18-Jun-2024 14:06                2764
cachingiterator.current.php                        18-Jun-2024 14:06                3066
cachingiterator.getcache.php                       18-Jun-2024 14:06                6194
cachingiterator.getflags.php                       18-Jun-2024 14:06                2783
cachingiterator.hasnext.php                        18-Jun-2024 14:06                2956
cachingiterator.key.php                            18-Jun-2024 14:06                2422                           18-Jun-2024 14:06                2767
cachingiterator.offsetexists.php                   18-Jun-2024 14:06                3245
cachingiterator.offsetget.php                      18-Jun-2024 14:06                2878
cachingiterator.offsetset.php                      18-Jun-2024 14:06                3347
cachingiterator.offsetunset.php                    18-Jun-2024 14:06                3007
cachingiterator.rewind.php                         18-Jun-2024 14:06                2745
cachingiterator.setflags.php                       18-Jun-2024 14:06                3120
cachingiterator.tostring.php                       18-Jun-2024 14:06                2939
cachingiterator.valid.php                          18-Jun-2024 14:06                3032
calendar.configuration.php                         18-Jun-2024 14:06                1446
calendar.constants.php                             18-Jun-2024 14:06               14324
calendar.installation.php                          18-Jun-2024 14:06                1696
calendar.requirements.php                          18-Jun-2024 14:06                1331
calendar.resources.php                             18-Jun-2024 14:06                1392
calendar.setup.php                                 18-Jun-2024 14:06                1772
callbackfilteriterator.accept.php                  18-Jun-2024 14:06                4169
callbackfilteriterator.construct.php               18-Jun-2024 14:06                4485
cc.license.php                                     18-Jun-2024 14:07               20797
changelog.misc.php                                 18-Jun-2024 14:06                1432
changelog.mysql.php                                18-Jun-2024 14:06                2941
changelog.mysql_xdevapi.php                        18-Jun-2024 14:06                2669
changelog.mysqli.php                               18-Jun-2024 14:06                1474
changelog.strings.php                              18-Jun-2024 14:06                1533
class.addressinfo.php                              18-Jun-2024 14:06                1833
class.allowdynamicproperties.php                   18-Jun-2024 14:06                5422
class.apcuiterator.php                             18-Jun-2024 14:06                8069
class.appenditerator.php                           18-Jun-2024 14:06                8283
class.argumentcounterror.php                       18-Jun-2024 14:06                8968
class.arithmeticerror.php                          18-Jun-2024 14:06                9185
class.arrayaccess.php                              18-Jun-2024 14:06               12091
class.arrayiterator.php                            18-Jun-2024 14:06               18439
class.arrayobject.php                              18-Jun-2024 14:06               17687
class.assertionerror.php                           18-Jun-2024 14:06                8717
class.attribute.php                                18-Jun-2024 14:06                9088
class.backedenum.php                               18-Jun-2024 14:06                4744
class.badfunctioncallexception.php                 18-Jun-2024 14:06                8818
class.badmethodcallexception.php                   18-Jun-2024 14:06                8824
class.cachingiterator.php                          18-Jun-2024 14:06               18365
class.callbackfilteriterator.php                   18-Jun-2024 14:06               12264
class.closedgeneratorexception.php                 18-Jun-2024 14:06                8983
class.closure.php                                  18-Jun-2024 14:06                7630
class.collator.php                                 18-Jun-2024 14:06               40830
class.collectable.php                              18-Jun-2024 14:06                2700                            18-Jun-2024 14:06                8487                      18-Jun-2024 14:06                2078                                      18-Jun-2024 14:06               13432
class.commonmark-cql.php                           18-Jun-2024 14:06                8955
class.commonmark-interfaces-ivisitable.php         18-Jun-2024 14:06                3028
class.commonmark-interfaces-ivisitor.php           18-Jun-2024 14:06                4673
class.commonmark-node-blockquote.php               18-Jun-2024 14:06                8521
class.commonmark-node-bulletlist.php               18-Jun-2024 14:06               10743
class.commonmark-node-code.php                     18-Jun-2024 14:06                9516
class.commonmark-node-codeblock.php                18-Jun-2024 14:06               10929
class.commonmark-node-customblock.php              18-Jun-2024 14:06                9261
class.commonmark-node-custominline.php             18-Jun-2024 14:06                9237
class.commonmark-node-document.php                 18-Jun-2024 14:06                8495
class.commonmark-node-heading.php                  18-Jun-2024 14:06                9918
class.commonmark-node-htmlblock.php                18-Jun-2024 14:06                9570
class.commonmark-node-htmlinline.php               18-Jun-2024 14:06                9546
class.commonmark-node-image.php                    18-Jun-2024 14:06               10814
class.commonmark-node-item.php                     18-Jun-2024 14:06                8474
class.commonmark-node-linebreak.php                18-Jun-2024 14:06                8488
class.commonmark-node-link.php                     18-Jun-2024 14:06               10821
class.commonmark-node-orderedlist.php              18-Jun-2024 14:06               11705
class.commonmark-node-paragraph.php                18-Jun-2024 14:06                8527
class.commonmark-node-softbreak.php                18-Jun-2024 14:06                8520
class.commonmark-node-text-emphasis.php            18-Jun-2024 14:06                8549
class.commonmark-node-text-strong.php              18-Jun-2024 14:06                8538
class.commonmark-node-text.php                     18-Jun-2024 14:06                9958
class.commonmark-node-thematicbreak.php            18-Jun-2024 14:06                8549
class.commonmark-node.php                          18-Jun-2024 14:06               10014
class.commonmark-parser.php                        18-Jun-2024 14:06                4050
class.compersisthelper.php                         18-Jun-2024 14:06                7739
class.compileerror.php                             18-Jun-2024 14:06                8640
class.componere-abstract-definition.php            18-Jun-2024 14:06                4987
class.componere-definition.php                     18-Jun-2024 14:06               10642
class.componere-method.php                         18-Jun-2024 14:06                4507
class.componere-patch.php                          18-Jun-2024 14:06                8749
class.componere-value.php                          18-Jun-2024 14:06                5734
class.countable.php                                18-Jun-2024 14:06                2749
class.curlfile.php                                 18-Jun-2024 14:06                8782
class.curlhandle.php                               18-Jun-2024 14:06                1836
class.curlmultihandle.php                          18-Jun-2024 14:06                1875
class.curlsharehandle.php                          18-Jun-2024 14:06                1871
class.curlstringfile.php                           18-Jun-2024 14:06                5995
class.dateerror.php                                18-Jun-2024 14:06                9397
class.dateexception.php                            18-Jun-2024 14:06               10009
class.dateinterval.php                             18-Jun-2024 14:06               15298
class.dateinvalidoperationexception.php            18-Jun-2024 14:06                9636
class.dateinvalidtimezoneexception.php             18-Jun-2024 14:06                8870
class.datemalformedintervalstringexception.php     18-Jun-2024 14:06                8997
class.datemalformedperiodstringexception.php       18-Jun-2024 14:06                8979
class.datemalformedstringexception.php             18-Jun-2024 14:06                9384
class.dateobjecterror.php                          18-Jun-2024 14:06                9200
class.dateperiod.php                               18-Jun-2024 14:06               23649
class.daterangeerror.php                           18-Jun-2024 14:06                9284
class.datetime.php                                 18-Jun-2024 14:06               24431
class.datetimeimmutable.php                        18-Jun-2024 14:06               24385
class.datetimeinterface.php                        18-Jun-2024 14:06               19933
class.datetimezone.php                             18-Jun-2024 14:06               16422
class.deflatecontext.php                           18-Jun-2024 14:06                1894                                18-Jun-2024 14:06                6001
class.directoryiterator.php                        18-Jun-2024 14:06               20597
class.divisionbyzeroerror.php                      18-Jun-2024 14:06                8662
class.domainexception.php                          18-Jun-2024 14:06                8724
class.domattr.php                                  18-Jun-2024 14:06               28947
class.domcdatasection.php                          18-Jun-2024 14:06               32287
class.domcharacterdata.php                         18-Jun-2024 14:06               34120
class.domchildnode.php                             18-Jun-2024 14:06                4351
class.domcomment.php                               18-Jun-2024 14:06               30986
class.domdocument.php                              18-Jun-2024 14:06               72906
class.domdocumentfragment.php                      18-Jun-2024 14:06               29573
class.domdocumenttype.php                          18-Jun-2024 14:06               27827
class.domelement.php                               18-Jun-2024 14:06               54669
class.domentity.php                                18-Jun-2024 14:06               28673
class.domentityreference.php                       18-Jun-2024 14:06               23470
class.domexception.php                             18-Jun-2024 14:06                9636
class.domimplementation.php                        18-Jun-2024 14:06                6325
class.domnamednodemap.php                          18-Jun-2024 14:06                7822
class.domnamespacenode.php                         18-Jun-2024 14:06                9969
class.domnode.php                                  18-Jun-2024 14:06               34475
class.domnodelist.php                              18-Jun-2024 14:06                6435
class.domnotation.php                              18-Jun-2024 14:06               23723
class.domparentnode.php                            18-Jun-2024 14:06                4055
class.domprocessinginstruction.php                 18-Jun-2024 14:06               25020
class.domtext.php                                  18-Jun-2024 14:06               34160
class.domxpath.php                                 18-Jun-2024 14:06                9083
class.dotnet.php                                   18-Jun-2024 14:06                8167
class.ds-collection.php                            18-Jun-2024 14:06                6504
class.ds-deque.php                                 18-Jun-2024 14:06               24643
class.ds-hashable.php                              18-Jun-2024 14:06                4929
class.ds-map.php                                   18-Jun-2024 14:06               25543
class.ds-pair.php                                  18-Jun-2024 14:06                4861
class.ds-priorityqueue.php                         18-Jun-2024 14:06                9196
class.ds-queue.php                                 18-Jun-2024 14:06                8586
class.ds-sequence.php                              18-Jun-2024 14:06               25366
class.ds-set.php                                   18-Jun-2024 14:06               20422
class.ds-stack.php                                 18-Jun-2024 14:06                7942
class.ds-vector.php                                18-Jun-2024 14:06               23474
class.emptyiterator.php                            18-Jun-2024 14:06                4192
class.enchantbroker.php                            18-Jun-2024 14:06                1905
class.enchantdictionary.php                        18-Jun-2024 14:06                1895
class.error.php                                    18-Jun-2024 14:06               11425
class.errorexception.php                           18-Jun-2024 14:06               15071
class.ev.php                                       18-Jun-2024 14:06               48689
class.evcheck.php                                  18-Jun-2024 14:06               12092
class.evchild.php                                  18-Jun-2024 14:06               13687
class.evembed.php                                  18-Jun-2024 14:06               10310
class.event.php                                    18-Jun-2024 14:06               20945
class.eventbase.php                                18-Jun-2024 14:06               17227
class.eventbuffer.php                              18-Jun-2024 14:06               25582
class.eventbufferevent.php                         18-Jun-2024 14:06               42038
class.eventconfig.php                              18-Jun-2024 14:06                8622
class.eventdnsbase.php                             18-Jun-2024 14:06               15238
class.eventexception.php                           18-Jun-2024 14:06                8846
class.eventhttp.php                                18-Jun-2024 14:06               10452
class.eventhttpconnection.php                      18-Jun-2024 14:06               11159
class.eventhttprequest.php                         18-Jun-2024 14:06               23916
class.eventlistener.php                            18-Jun-2024 14:06               13982
class.eventsslcontext.php                          18-Jun-2024 14:06               20474
class.eventutil.php                                18-Jun-2024 14:06               27815
class.evfork.php                                   18-Jun-2024 14:06                9512
class.evidle.php                                   18-Jun-2024 14:06               11012
class.evio.php                                     18-Jun-2024 14:06               14079
class.evloop.php                                   18-Jun-2024 14:06               34560
class.evperiodic.php                               18-Jun-2024 14:06               16713
class.evprepare.php                                18-Jun-2024 14:06               12238
class.evsignal.php                                 18-Jun-2024 14:06               12888
class.evstat.php                                   18-Jun-2024 14:06               16294
class.evtimer.php                                  18-Jun-2024 14:06               16345
class.evwatcher.php                                18-Jun-2024 14:06               11194
class.exception.php                                18-Jun-2024 14:06               11817
class.fannconnection.php                           18-Jun-2024 14:06                6796
class.ffi-cdata.php                                18-Jun-2024 14:06                7133
class.ffi-ctype.php                                18-Jun-2024 14:06               31462
class.ffi-exception.php                            18-Jun-2024 14:06                8300
class.ffi-parserexception.php                      18-Jun-2024 14:06                8363
class.ffi.php                                      18-Jun-2024 14:06               19953
class.fiber.php                                    18-Jun-2024 14:06                8354
class.fibererror.php                               18-Jun-2024 14:06                7841
class.filesystemiterator.php                       18-Jun-2024 14:06               32639
class.filteriterator.php                           18-Jun-2024 14:06                7821
class.finfo.php                                    18-Jun-2024 14:06                6397
class.ftp-connection.php                           18-Jun-2024 14:06                1887
class.gdfont.php                                   18-Jun-2024 14:06                1790
class.gdimage.php                                  18-Jun-2024 14:06                1788
class.gearmanclient.php                            18-Jun-2024 14:06               41141
class.gearmanexception.php                         18-Jun-2024 14:06                7287
class.gearmanjob.php                               18-Jun-2024 14:06               10132
class.gearmantask.php                              18-Jun-2024 14:06                9631
class.gearmanworker.php                            18-Jun-2024 14:06               14416
class.gender.php                                   18-Jun-2024 14:06               42522
class.generator.php                                18-Jun-2024 14:06                7092
class.globiterator.php                             18-Jun-2024 14:06               26766
class.gmagick.php                                  18-Jun-2024 14:06               93006
class.gmagickdraw.php                              18-Jun-2024 14:06               25933
class.gmagickpixel.php                             18-Jun-2024 14:06                6218
class.gmp.php                                      18-Jun-2024 14:06                4599
class.hashcontext.php                              18-Jun-2024 14:06                3533
class.hrtime-performancecounter.php                18-Jun-2024 14:06                4029
class.hrtime-stopwatch.php                         18-Jun-2024 14:06                7449
class.hrtime-unit.php                              18-Jun-2024 14:06                4556
class.imagick.php                                  18-Jun-2024 14:06              302576
class.imagickdraw.php                              18-Jun-2024 14:06               88576
class.imagickkernel.php                            18-Jun-2024 14:06                6839
class.imagickpixel.php                             18-Jun-2024 14:06               14682
class.imagickpixeliterator.php                     18-Jun-2024 14:06               10128
class.imap-connection.php                          18-Jun-2024 14:06                1868
class.infiniteiterator.php                         18-Jun-2024 14:06                5584
class.inflatecontext.php                           18-Jun-2024 14:06                1903
class.internaliterator.php                         18-Jun-2024 14:06                5123
class.intlbreakiterator.php                        18-Jun-2024 14:06               32387
class.intlcalendar.php                             18-Jun-2024 14:06               78729
class.intlchar.php                                 18-Jun-2024 14:06              480111
class.intlcodepointbreakiterator.php               18-Jun-2024 14:06               21764
class.intldateformatter.php                        18-Jun-2024 14:06               34507
class.intldatepatterngenerator.php                 18-Jun-2024 14:06                4969
class.intlexception.php                            18-Jun-2024 14:06                8887
class.intlgregoriancalendar.php                    18-Jun-2024 14:06               53636
class.intliterator.php                             18-Jun-2024 14:06                5843
class.intlpartsiterator.php                        18-Jun-2024 14:06                7578
class.intlrulebasedbreakiterator.php               18-Jun-2024 14:06               25070
class.intltimezone.php                             18-Jun-2024 14:06               30457
class.invalidargumentexception.php                 18-Jun-2024 14:06                8711
class.iterator.php                                 18-Jun-2024 14:06               12060
class.iteratoraggregate.php                        18-Jun-2024 14:06                6756
class.iteratoriterator.php                         18-Jun-2024 14:06                7004
class.jsonexception.php                            18-Jun-2024 14:06                9197
class.jsonserializable.php                         18-Jun-2024 14:06                2999
class.ldap-connection.php                          18-Jun-2024 14:06                1887
class.ldap-result-entry.php                        18-Jun-2024 14:06                1903
class.ldap-result.php                              18-Jun-2024 14:06                1839
class.lengthexception.php                          18-Jun-2024 14:06                8611
class.libxmlerror.php                              18-Jun-2024 14:06                6051
class.limititerator.php                            18-Jun-2024 14:06               11886
class.locale.php                                   18-Jun-2024 14:06               31452
class.logicexception.php                           18-Jun-2024 14:06                8767
class.lua.php                                      18-Jun-2024 14:06                8018
class.luaclosure.php                               18-Jun-2024 14:06                2820
class.luasandbox.php                               18-Jun-2024 14:06               15117
class.luasandboxerror.php                          18-Jun-2024 14:06               10245
class.luasandboxerrorerror.php                     18-Jun-2024 14:06                7786
class.luasandboxfatalerror.php                     18-Jun-2024 14:06                7899
class.luasandboxfunction.php                       18-Jun-2024 14:06                4198
class.luasandboxmemoryerror.php                    18-Jun-2024 14:06                8104
class.luasandboxruntimeerror.php                   18-Jun-2024 14:06                7950
class.luasandboxsyntaxerror.php                    18-Jun-2024 14:06                7790
class.luasandboxtimeouterror.php                   18-Jun-2024 14:06                8136
class.memcache.php                                 18-Jun-2024 14:06               19907
class.memcached.php                                18-Jun-2024 14:06               49836
class.memcachedexception.php                       18-Jun-2024 14:06                7601
class.messageformatter.php                         18-Jun-2024 14:06               14049
class.mongodb-bson-binary.php                      18-Jun-2024 14:06               18805
class.mongodb-bson-binaryinterface.php             18-Jun-2024 14:06                5273
class.mongodb-bson-dbpointer.php                   18-Jun-2024 14:06                6402
class.mongodb-bson-decimal128.php                  18-Jun-2024 14:06                8482
class.mongodb-bson-decimal128interface.php         18-Jun-2024 14:06                4389
class.mongodb-bson-document.php                    18-Jun-2024 14:06               14827
class.mongodb-bson-int64.php                       18-Jun-2024 14:06                8657
class.mongodb-bson-iterator.php                    18-Jun-2024 14:06                5351
class.mongodb-bson-javascript.php                  18-Jun-2024 14:06                9437
class.mongodb-bson-javascriptinterface.php         18-Jun-2024 14:06                5527
class.mongodb-bson-maxkey.php                      18-Jun-2024 14:06                6228
class.mongodb-bson-maxkeyinterface.php             18-Jun-2024 14:06                2500
class.mongodb-bson-minkey.php                      18-Jun-2024 14:06                6238
class.mongodb-bson-minkeyinterface.php             18-Jun-2024 14:06                2481
class.mongodb-bson-objectid.php                    18-Jun-2024 14:06               10216
class.mongodb-bson-objectidinterface.php           18-Jun-2024 14:06                4946
class.mongodb-bson-packedarray.php                 18-Jun-2024 14:06               12635
class.mongodb-bson-persistable.php                 18-Jun-2024 14:06                6884
class.mongodb-bson-regex.php                       18-Jun-2024 14:06                8687
class.mongodb-bson-regexinterface.php              18-Jun-2024 14:06                5246
class.mongodb-bson-serializable.php                18-Jun-2024 14:06                4755
class.mongodb-bson-symbol.php                      18-Jun-2024 14:06                6297
class.mongodb-bson-timestamp.php                   18-Jun-2024 14:06                9022
class.mongodb-bson-timestampinterface.php          18-Jun-2024 14:06                5509
class.mongodb-bson-type.php                        18-Jun-2024 14:06                2274
class.mongodb-bson-undefined.php                   18-Jun-2024 14:06                6420
class.mongodb-bson-unserializable.php              18-Jun-2024 14:06                4473
class.mongodb-bson-utcdatetime.php                 18-Jun-2024 14:06                8535
class.mongodb-bson-utcdatetimeinterface.php        18-Jun-2024 14:06                4992
class.mongodb-driver-bulkwrite.php                 18-Jun-2024 14:06               25999
class.mongodb-driver-clientencryption.php          18-Jun-2024 14:06               25666
class.mongodb-driver-command.php                   18-Jun-2024 14:06               14588
class.mongodb-driver-cursor.php                    18-Jun-2024 14:06               29330
class.mongodb-driver-cursorid.php                  18-Jun-2024 14:06                5917
class.mongodb-driver-cursorinterface.php           18-Jun-2024 14:06                6930
class.mongodb-driver-exception-authenticationex..> 18-Jun-2024 14:06                9345
class.mongodb-driver-exception-bulkwriteexcepti..> 18-Jun-2024 14:06               10190
class.mongodb-driver-exception-commandexception..> 18-Jun-2024 14:06               11242
class.mongodb-driver-exception-connectionexcept..> 18-Jun-2024 14:06                9463
class.mongodb-driver-exception-connectiontimeou..> 18-Jun-2024 14:06                9877
class.mongodb-driver-exception-encryptionexcept..> 18-Jun-2024 14:06                9379
class.mongodb-driver-exception-exception.php       18-Jun-2024 14:06                2522
class.mongodb-driver-exception-executiontimeout..> 18-Jun-2024 14:06               10617
class.mongodb-driver-exception-invalidargumente..> 18-Jun-2024 14:06                8410
class.mongodb-driver-exception-logicexception.php  18-Jun-2024 14:06                8286
class.mongodb-driver-exception-runtimeexception..> 18-Jun-2024 14:06               12171
class.mongodb-driver-exception-serverexception.php 18-Jun-2024 14:06                9460
class.mongodb-driver-exception-sslconnectionexc..> 18-Jun-2024 14:06                9860
class.mongodb-driver-exception-unexpectedvaluee..> 18-Jun-2024 14:06                8435
class.mongodb-driver-exception-writeexception.php  18-Jun-2024 14:06               12612
class.mongodb-driver-manager.php                   18-Jun-2024 14:06               23290
class.mongodb-driver-monitoring-commandfailedev..> 18-Jun-2024 14:06                9168
class.mongodb-driver-monitoring-commandstartede..> 18-Jun-2024 14:06                8001
class.mongodb-driver-monitoring-commandsubscrib..> 18-Jun-2024 14:06                6948
class.mongodb-driver-monitoring-commandsucceede..> 18-Jun-2024 14:06                8711
class.mongodb-driver-monitoring-logsubscriber.php  18-Jun-2024 14:06               11423
class.mongodb-driver-monitoring-sdamsubscriber.php 18-Jun-2024 14:06               12458
class.mongodb-driver-monitoring-serverchangedev..> 18-Jun-2024 14:06                6041
class.mongodb-driver-monitoring-serverclosedeve..> 18-Jun-2024 14:06                4637
class.mongodb-driver-monitoring-serverheartbeat..> 18-Jun-2024 14:06                6103
class.mongodb-driver-monitoring-serverheartbeat..> 18-Jun-2024 14:06                4832
class.mongodb-driver-monitoring-serverheartbeat..> 18-Jun-2024 14:06                6138
class.mongodb-driver-monitoring-serveropeningev..> 18-Jun-2024 14:06                4594
class.mongodb-driver-monitoring-subscriber.php     18-Jun-2024 14:06                2924
class.mongodb-driver-monitoring-topologychanged..> 18-Jun-2024 14:06                4966
class.mongodb-driver-monitoring-topologyclosede..> 18-Jun-2024 14:06                3520
class.mongodb-driver-monitoring-topologyopening..> 18-Jun-2024 14:06                3535
class.mongodb-driver-query.php                     18-Jun-2024 14:06                3566
class.mongodb-driver-readconcern.php               18-Jun-2024 14:06               21153
class.mongodb-driver-readpreference.php            18-Jun-2024 14:06               23595
class.mongodb-driver-server.php                    18-Jun-2024 14:06               29276
class.mongodb-driver-serverapi.php                 18-Jun-2024 14:06               14884
class.mongodb-driver-serverdescription.php         18-Jun-2024 14:06               18695
class.mongodb-driver-session.php                   18-Jun-2024 14:06               16364
class.mongodb-driver-topologydescription.php       18-Jun-2024 14:06               12425
class.mongodb-driver-writeconcern.php              18-Jun-2024 14:06               10964
class.mongodb-driver-writeconcernerror.php         18-Jun-2024 14:06                4582
class.mongodb-driver-writeerror.php                18-Jun-2024 14:06                4957
class.mongodb-driver-writeresult.php               18-Jun-2024 14:06                9339
class.multipleiterator.php                         18-Jun-2024 14:06               12354
class.mysql-xdevapi-baseresult.php                 18-Jun-2024 14:06                3237
class.mysql-xdevapi-client.php                     18-Jun-2024 14:06                3303
class.mysql-xdevapi-collection.php                 18-Jun-2024 14:06               11361
class.mysql-xdevapi-collectionadd.php              18-Jun-2024 14:06                3063
class.mysql-xdevapi-collectionfind.php             18-Jun-2024 14:06                9317
class.mysql-xdevapi-collectionmodify.php           18-Jun-2024 14:06               10750
class.mysql-xdevapi-collectionremove.php           18-Jun-2024 14:06                5479
class.mysql-xdevapi-columnresult.php               18-Jun-2024 14:06                7223
class.mysql-xdevapi-crudoperationbindable.php      18-Jun-2024 14:06                3104
class.mysql-xdevapi-crudoperationlimitable.php     18-Jun-2024 14:06                3112
class.mysql-xdevapi-crudoperationskippable.php     18-Jun-2024 14:06                3114
class.mysql-xdevapi-crudoperationsortable.php      18-Jun-2024 14:06                3084
class.mysql-xdevapi-databaseobject.php             18-Jun-2024 14:06                3720
class.mysql-xdevapi-docresult.php                  18-Jun-2024 14:06                4301
class.mysql-xdevapi-exception.php                  18-Jun-2024 14:06                2264
class.mysql-xdevapi-executable.php                 18-Jun-2024 14:06                2730
class.mysql-xdevapi-executionstatus.php            18-Jun-2024 14:06                4969
class.mysql-xdevapi-expression.php                 18-Jun-2024 14:06                3374
class.mysql-xdevapi-result.php                     18-Jun-2024 14:06                4786
class.mysql-xdevapi-rowresult.php                  18-Jun-2024 14:06                5530
class.mysql-xdevapi-schema.php                     18-Jun-2024 14:06                8243
class.mysql-xdevapi-schemaobject.php               18-Jun-2024 14:06                2909
class.mysql-xdevapi-session.php                    18-Jun-2024 14:06               10233
class.mysql-xdevapi-sqlstatement.php               18-Jun-2024 14:06                6968
class.mysql-xdevapi-sqlstatementresult.php         18-Jun-2024 14:06                7938
class.mysql-xdevapi-statement.php                  18-Jun-2024 14:06                5270
class.mysql-xdevapi-table.php                      18-Jun-2024 14:06                7903
class.mysql-xdevapi-tabledelete.php                18-Jun-2024 14:06                5549
class.mysql-xdevapi-tableinsert.php                18-Jun-2024 14:06                3711
class.mysql-xdevapi-tableselect.php                18-Jun-2024 14:06                8814
class.mysql-xdevapi-tableupdate.php                18-Jun-2024 14:06                6531
class.mysql-xdevapi-warning.php                    18-Jun-2024 14:06                3870
class.mysqli-driver.php                            18-Jun-2024 14:06                8880
class.mysqli-result.php                            18-Jun-2024 14:06               17567
class.mysqli-sql-exception.php                     18-Jun-2024 14:06               10214
class.mysqli-stmt.php                              18-Jun-2024 14:06               20444
class.mysqli-warning.php                           18-Jun-2024 14:06                4647
class.mysqli.php                                   18-Jun-2024 14:06               48089
class.norewinditerator.php                         18-Jun-2024 14:06                7101
class.normalizer.php                               18-Jun-2024 14:06               14686
class.numberformatter.php                          18-Jun-2024 14:06               80291
class.oauth.php                                    18-Jun-2024 14:06               20948
class.oauthexception.php                           18-Jun-2024 14:06                8818
class.oauthprovider.php                            18-Jun-2024 14:06               13564
class.ocicollection.php                            18-Jun-2024 14:06                7575
class.ocilob.php                                   18-Jun-2024 14:06               16274
class.opensslasymmetrickey.php                     18-Jun-2024 14:06                1989
class.opensslcertificate.php                       18-Jun-2024 14:06                1972
class.opensslcertificatesigningrequest.php         18-Jun-2024 14:06                2059
class.outeriterator.php                            18-Jun-2024 14:06                4561
class.outofboundsexception.php                     18-Jun-2024 14:06                8843
class.outofrangeexception.php                      18-Jun-2024 14:06                8828
class.overflowexception.php                        18-Jun-2024 14:06                8657
class.override.php                                 18-Jun-2024 14:06                4216
class.parallel-channel.php                         18-Jun-2024 14:06                9873
class.parallel-events-event-type.php               18-Jun-2024 14:06                3563
class.parallel-events-event.php                    18-Jun-2024 14:06                3861
class.parallel-events-input.php                    18-Jun-2024 14:06                5188
class.parallel-events.php                          18-Jun-2024 14:06                7448
class.parallel-future.php                          18-Jun-2024 14:06                8610
class.parallel-runtime.php                         18-Jun-2024 14:06                7931
class.parallel-sync.php                            18-Jun-2024 14:06                5748
class.parentiterator.php                           18-Jun-2024 14:06               10115
class.parle-errorinfo.php                          18-Jun-2024 14:06                4079
class.parle-lexer.php                              18-Jun-2024 14:06               14381
class.parle-lexerexception.php                     18-Jun-2024 14:06                7838
class.parle-parser.php                             18-Jun-2024 14:06               19276
class.parle-parserexception.php                    18-Jun-2024 14:06                7820
class.parle-rlexer.php                             18-Jun-2024 14:06               16414
class.parle-rparser.php                            18-Jun-2024 14:06               19438
class.parle-stack.php                              18-Jun-2024 14:06                5081
class.parle-token.php                              18-Jun-2024 14:06                5274
class.parseerror.php                               18-Jun-2024 14:06                9261
class.pdo.php                                      18-Jun-2024 14:06               43592
class.pdoexception.php                             18-Jun-2024 14:06               10712
class.pdorow.php                                   18-Jun-2024 14:06                4777
class.pdostatement.php                             18-Jun-2024 14:06               24443
class.pgsql-connection.php                         18-Jun-2024 14:06                1910
class.pgsql-lob.php                                18-Jun-2024 14:06                1852
class.pgsql-result.php                             18-Jun-2024 14:06                1884
class.phar.php                                     18-Jun-2024 14:06               76365
class.phardata.php                                 18-Jun-2024 14:06               50581
class.pharexception.php                            18-Jun-2024 14:06                8585
class.pharfileinfo.php                             18-Jun-2024 14:06               22090
class.php-user-filter.php                          18-Jun-2024 14:06                6892
class.phptoken.php                                 18-Jun-2024 14:06                9473
class.pool.php                                     18-Jun-2024 14:06                8338
class.pspell-config.php                            18-Jun-2024 14:06                1886
class.pspell-dictionary.php                        18-Jun-2024 14:06                1923
class.quickhashinthash.php                         18-Jun-2024 14:06               16282
class.quickhashintset.php                          18-Jun-2024 14:06               14007
class.quickhashintstringhash.php                   18-Jun-2024 14:06               17158
class.quickhashstringinthash.php                   18-Jun-2024 14:06               14679
class.random-brokenrandomengineerror.php           18-Jun-2024 14:06                8713
class.random-cryptosafeengine.php                  18-Jun-2024 14:06                2672
class.random-engine-mt19937.php                    18-Jun-2024 14:06                5617
class.random-engine-pcgoneseq128xslrr64.php        18-Jun-2024 14:06                6551
class.random-engine-secure.php                     18-Jun-2024 14:06                3981
class.random-engine-xoshiro256starstar.php         18-Jun-2024 14:06                6700
class.random-engine.php                            18-Jun-2024 14:06                4935
class.random-randomerror.php                       18-Jun-2024 14:06                8675
class.random-randomexception.php                   18-Jun-2024 14:06                8812
class.random-randomizer.php                        18-Jun-2024 14:06               11356
class.rangeexception.php                           18-Jun-2024 14:06                9102
class.rararchive.php                               18-Jun-2024 14:06                8397
class.rarentry.php                                 18-Jun-2024 14:06               53603
class.rarexception.php                             18-Jun-2024 14:06                8995
class.recursivearrayiterator.php                   18-Jun-2024 14:06               16430
class.recursivecachingiterator.php                 18-Jun-2024 14:06               14392
class.recursivecallbackfilteriterator.php          18-Jun-2024 14:06               14283
class.recursivedirectoryiterator.php               18-Jun-2024 14:06               30362
class.recursivefilteriterator.php                  18-Jun-2024 14:06                8745
class.recursiveiterator.php                        18-Jun-2024 14:06                5144
class.recursiveiteratoriterator.php                18-Jun-2024 14:06               15629
class.recursiveregexiterator.php                   18-Jun-2024 14:06               15111
class.recursivetreeiterator.php                    18-Jun-2024 14:06               26556
class.reflection.php                               18-Jun-2024 14:06                3575
class.reflectionattribute.php                      18-Jun-2024 14:06                7055
class.reflectionclass.php                          18-Jun-2024 14:06               40380
class.reflectionclassconstant.php                  18-Jun-2024 14:06               17605
class.reflectionenum.php                           18-Jun-2024 14:06               31911
class.reflectionenumbackedcase.php                 18-Jun-2024 14:06               13263
class.reflectionenumunitcase.php                   18-Jun-2024 14:06               12940
class.reflectionexception.php                      18-Jun-2024 14:06                8535
class.reflectionextension.php                      18-Jun-2024 14:06               11190
class.reflectionfiber.php                          18-Jun-2024 14:06                5505
class.reflectionfunction.php                       18-Jun-2024 14:06               21767
class.reflectionfunctionabstract.php               18-Jun-2024 14:06               21725
class.reflectiongenerator.php                      18-Jun-2024 14:06                6726
class.reflectionintersectiontype.php               18-Jun-2024 14:06                3532
class.reflectionmethod.php                         18-Jun-2024 14:06               34221
class.reflectionnamedtype.php                      18-Jun-2024 14:06                3896
class.reflectionobject.php                         18-Jun-2024 14:06               29511
class.reflectionparameter.php                      18-Jun-2024 14:06               17866
class.reflectionproperty.php                       18-Jun-2024 14:06               24017
class.reflectionreference.php                      18-Jun-2024 14:06                4366
class.reflectiontype.php                           18-Jun-2024 14:06                4814
class.reflectionuniontype.php                      18-Jun-2024 14:06                3431
class.reflectionzendextension.php                  18-Jun-2024 14:06                8288
class.reflector.php                                18-Jun-2024 14:06                4128
class.regexiterator.php                            18-Jun-2024 14:06               18592
class.resourcebundle.php                           18-Jun-2024 14:06               11849
class.returntypewillchange.php                     18-Jun-2024 14:06                3739
class.rnpffi.php                                   18-Jun-2024 14:06                1721
class.rrdcreator.php                               18-Jun-2024 14:06                4782
class.rrdgraph.php                                 18-Jun-2024 14:06                4273
class.rrdupdater.php                               18-Jun-2024 14:06                3460
class.runtimeexception.php                         18-Jun-2024 14:06                8692
class.seaslog.php                                  18-Jun-2024 14:06               23235
class.seekableiterator.php                         18-Jun-2024 14:06               11906
class.sensitiveparameter.php                       18-Jun-2024 14:06                6625
class.sensitiveparametervalue.php                  18-Jun-2024 14:06                5390
class.serializable.php                             18-Jun-2024 14:06                9014
class.sessionhandler.php                           18-Jun-2024 14:06               28569
class.sessionhandlerinterface.php                  18-Jun-2024 14:06               17193
class.sessionidinterface.php                       18-Jun-2024 14:06                3609
class.sessionupdatetimestamphandlerinterface.php   18-Jun-2024 14:06                4873
class.shmop.php                                    18-Jun-2024 14:06                1832
class.simdjsonexception.php                        18-Jun-2024 14:06                5233
class.simdjsonvalueerror.php                       18-Jun-2024 14:06                8670
class.simplexmlelement.php                         18-Jun-2024 14:06               19668
class.simplexmliterator.php                        18-Jun-2024 14:06               16850
class.snmp.php                                     18-Jun-2024 14:06               31313
class.snmpexception.php                            18-Jun-2024 14:06                9442
class.soapclient.php                               18-Jun-2024 14:06               34843
class.soapfault.php                                18-Jun-2024 14:06               14491
class.soapheader.php                               18-Jun-2024 14:06                6145
class.soapparam.php                                18-Jun-2024 14:06                3833
class.soapserver.php                               18-Jun-2024 14:06               10421
class.soapvar.php                                  18-Jun-2024 14:06                8008
class.socket.php                                   18-Jun-2024 14:06                1856
class.sodiumexception.php                          18-Jun-2024 14:06                8562
class.solrclient.php                               18-Jun-2024 14:06               26428
class.solrclientexception.php                      18-Jun-2024 14:06                9949
class.solrcollapsefunction.php                     18-Jun-2024 14:06               12538
class.solrdismaxquery.php                          18-Jun-2024 14:06              113916
class.solrdocument.php                             18-Jun-2024 14:06               24596
class.solrdocumentfield.php                        18-Jun-2024 14:06                4849
class.solrexception.php                            18-Jun-2024 14:06               10440
class.solrgenericresponse.php                      18-Jun-2024 14:06               12915
class.solrillegalargumentexception.php             18-Jun-2024 14:06               10046
class.solrillegaloperationexception.php            18-Jun-2024 14:06               10110
class.solrinputdocument.php                        18-Jun-2024 14:06               20526
class.solrmissingmandatoryparameterexception.php   18-Jun-2024 14:06                9103
class.solrmodifiableparams.php                     18-Jun-2024 14:06                9126
class.solrobject.php                               18-Jun-2024 14:06                6152
class.solrparams.php                               18-Jun-2024 14:06                9654
class.solrpingresponse.php                         18-Jun-2024 14:06               11680
class.solrquery.php                                18-Jun-2024 14:06              128807
class.solrqueryresponse.php                        18-Jun-2024 14:06               12839
class.solrresponse.php                             18-Jun-2024 14:06               15302
class.solrserverexception.php                      18-Jun-2024 14:06                9924
class.solrupdateresponse.php                       18-Jun-2024 14:06               12899
class.solrutils.php                                18-Jun-2024 14:06                5267
class.spldoublylinkedlist.php                      18-Jun-2024 14:06               18837
class.splfileinfo.php                              18-Jun-2024 14:06               19370
class.splfileobject.php                            18-Jun-2024 14:06               38972
class.splfixedarray.php                            18-Jun-2024 14:06               21472
class.splheap.php                                  18-Jun-2024 14:06                8325
class.splmaxheap.php                               18-Jun-2024 14:06                7441
class.splminheap.php                               18-Jun-2024 14:06                7448
class.splobjectstorage.php                         18-Jun-2024 14:06               22485
class.splobserver.php                              18-Jun-2024 14:06                3019
class.splpriorityqueue.php                         18-Jun-2024 14:06               12757
class.splqueue.php                                 18-Jun-2024 14:06               17689
class.splstack.php                                 18-Jun-2024 14:06               14711
class.splsubject.php                               18-Jun-2024 14:06                3978
class.spltempfileobject.php                        18-Jun-2024 14:06               32037
class.spoofchecker.php                             18-Jun-2024 14:06               18358
class.sqlite3.php                                  18-Jun-2024 14:06               41012
class.sqlite3exception.php                         18-Jun-2024 14:06                8549
class.sqlite3result.php                            18-Jun-2024 14:06                6303
class.sqlite3stmt.php                              18-Jun-2024 14:06                8914
class.stdclass.php                                 18-Jun-2024 14:06                7586
class.stomp.php                                    18-Jun-2024 14:06               22340
class.stompexception.php                           18-Jun-2024 14:06                6087
class.stompframe.php                               18-Jun-2024 14:06                4579
class.streamwrapper.php                            18-Jun-2024 14:06               21922
class.stringable.php                               18-Jun-2024 14:06                8827
class.svm.php                                      18-Jun-2024 14:06               20255
class.svmmodel.php                                 18-Jun-2024 14:06                7511
class.swoole-async.php                             18-Jun-2024 14:06                8266
class.swoole-atomic.php                            18-Jun-2024 14:06                5341
class.swoole-buffer.php                            18-Jun-2024 14:06                7991
class.swoole-channel.php                           18-Jun-2024 14:06                4101
class.swoole-client.php                            18-Jun-2024 14:06               17273
class.swoole-connection-iterator.php               18-Jun-2024 14:06                7839
class.swoole-coroutine.php                         18-Jun-2024 14:06               18929
class.swoole-event.php                             18-Jun-2024 14:06                7680
class.swoole-exception.php                         18-Jun-2024 14:06                4616
class.swoole-http-client.php                       18-Jun-2024 14:06               15294
class.swoole-http-request.php                      18-Jun-2024 14:06                3103
class.swoole-http-response.php                     18-Jun-2024 14:06               11190
class.swoole-http-server.php                       18-Jun-2024 14:06               26537
class.swoole-lock.php                              18-Jun-2024 14:06                5062
class.swoole-mmap.php                              18-Jun-2024 14:06                3187
class.swoole-mysql-exception.php                   18-Jun-2024 14:06                4657
class.swoole-mysql.php                             18-Jun-2024 14:06                5624
class.swoole-process.php                           18-Jun-2024 14:06               14504
class.swoole-redis-server.php                      18-Jun-2024 14:06               32165
class.swoole-serialize.php                         18-Jun-2024 14:06                3674
class.swoole-server.php                            18-Jun-2024 14:06               31200
class.swoole-table.php                             18-Jun-2024 14:06               13285
class.swoole-timer.php                             18-Jun-2024 14:06                5214
class.swoole-websocket-frame.php                   18-Jun-2024 14:06                1964
class.swoole-websocket-server.php                  18-Jun-2024 14:06                8096
class.syncevent.php                                18-Jun-2024 14:06                5443
class.syncmutex.php                                18-Jun-2024 14:06                4762
class.syncreaderwriter.php                         18-Jun-2024 14:06                5705
class.syncsemaphore.php                            18-Jun-2024 14:06                5067
class.syncsharedmemory.php                         18-Jun-2024 14:06                6255
class.sysvmessagequeue.php                         18-Jun-2024 14:06                1901
class.sysvsemaphore.php                            18-Jun-2024 14:06                1886
class.sysvsharedmemory.php                         18-Jun-2024 14:06                1935
class.thread.php                                   18-Jun-2024 14:06               11946
class.threaded.php                                 18-Jun-2024 14:06                9331
class.throwable.php                                18-Jun-2024 14:06                7888
class.tidy.php                                     18-Jun-2024 14:06               19989
class.tidynode.php                                 18-Jun-2024 14:06               12493
class.transliterator.php                           18-Jun-2024 14:06               10685
class.traversable.php                              18-Jun-2024 14:06                5141
class.typeerror.php                                18-Jun-2024 14:06               10074
class.uconverter.php                               18-Jun-2024 14:06               41835
class.ui-area.php                                  18-Jun-2024 14:06               13144
class.ui-control.php                               18-Jun-2024 14:06                6087
class.ui-controls-box.php                          18-Jun-2024 14:06               10551
class.ui-controls-button.php                       18-Jun-2024 14:06                6900
class.ui-controls-check.php                        18-Jun-2024 14:06                7871
class.ui-controls-colorbutton.php                  18-Jun-2024 14:06                6825
class.ui-controls-combo.php                        18-Jun-2024 14:06                6914
class.ui-controls-editablecombo.php                18-Jun-2024 14:06                7036
class.ui-controls-entry.php                        18-Jun-2024 14:06               10145
class.ui-controls-form.php                         18-Jun-2024 14:06                8406
class.ui-controls-grid.php                         18-Jun-2024 14:06               13514
class.ui-controls-group.php                        18-Jun-2024 14:06                8712
class.ui-controls-label.php                        18-Jun-2024 14:06                6709
class.ui-controls-multilineentry.php               18-Jun-2024 14:06               10464
class.ui-controls-picker.php                       18-Jun-2024 14:06                7888
class.ui-controls-progress.php                     18-Jun-2024 14:06                6278
class.ui-controls-radio.php                        18-Jun-2024 14:06                6799
class.ui-controls-separator.php                    18-Jun-2024 14:06                7376
class.ui-controls-slider.php                       18-Jun-2024 14:06                7393
class.ui-controls-spin.php                         18-Jun-2024 14:06                7247
class.ui-controls-tab.php                          18-Jun-2024 14:06                9537
class.ui-draw-brush-gradient.php                   18-Jun-2024 14:06                7527
class.ui-draw-brush-lineargradient.php             18-Jun-2024 14:06                6668
class.ui-draw-brush-radialgradient.php             18-Jun-2024 14:06                6855
class.ui-draw-brush.php                            18-Jun-2024 14:06                4559
class.ui-draw-color.php                            18-Jun-2024 14:06                9003
class.ui-draw-line-cap.php                         18-Jun-2024 14:06                3822
class.ui-draw-line-join.php                        18-Jun-2024 14:06                3813
class.ui-draw-matrix.php                           18-Jun-2024 14:06                5851
class.ui-draw-path.php                             18-Jun-2024 14:06               11131
class.ui-draw-pen.php                              18-Jun-2024 14:06                8493
class.ui-draw-stroke.php                           18-Jun-2024 14:06                7211
class.ui-draw-text-font-descriptor.php             18-Jun-2024 14:06                6255
class.ui-draw-text-font-italic.php                 18-Jun-2024 14:06                4188
class.ui-draw-text-font-stretch.php                18-Jun-2024 14:06                8377
class.ui-draw-text-font-weight.php                 18-Jun-2024 14:06                8986
class.ui-draw-text-font.php                        18-Jun-2024 14:06                5074
class.ui-draw-text-layout.php                      18-Jun-2024 14:06                5492
class.ui-exception-invalidargumentexception.php    18-Jun-2024 14:06                7853
class.ui-exception-runtimeexception.php            18-Jun-2024 14:06                7781
class.ui-executor.php                              18-Jun-2024 14:06                5685
class.ui-key.php                                   18-Jun-2024 14:06               21426
class.ui-menu.php                                  18-Jun-2024 14:06                6629
class.ui-menuitem.php                              18-Jun-2024 14:06                3960
class.ui-point.php                                 18-Jun-2024 14:06                6723
class.ui-size.php                                  18-Jun-2024 14:06                6841
class.ui-window.php                                18-Jun-2024 14:06               13714
class.underflowexception.php                       18-Jun-2024 14:06                8858
class.unexpectedvalueexception.php                 18-Jun-2024 14:06                9176
class.unhandledmatcherror.php                      18-Jun-2024 14:06                8766
class.unitenum.php                                 18-Jun-2024 14:06                3121
class.v8js.php                                     18-Jun-2024 14:06                9457
class.v8jsexception.php                            18-Jun-2024 14:06               11528
class.valueerror.php                               18-Jun-2024 14:06                8902
class.variant.php                                  18-Jun-2024 14:06                6347
class.varnishadmin.php                             18-Jun-2024 14:06               12397
class.varnishlog.php                               18-Jun-2024 14:06               34982
class.varnishstat.php                              18-Jun-2024 14:06                3090
class.volatile.php                                 18-Jun-2024 14:06               12210
class.vtiful-kernel-excel.php                      18-Jun-2024 14:06               12399
class.vtiful-kernel-format.php                     18-Jun-2024 14:06               16319
class.weakmap.php                                  18-Jun-2024 14:06               10371
class.weakreference.php                            18-Jun-2024 14:06                6059
class.win32serviceexception.php                    18-Jun-2024 14:06                8114
class.wkhtmltox-image-converter.php                18-Jun-2024 14:06                4360
class.wkhtmltox-pdf-converter.php                  18-Jun-2024 14:06                4715
class.wkhtmltox-pdf-object.php                     18-Jun-2024 14:06                3069
class.worker.php                                   18-Jun-2024 14:06                9217
class.xmldiff-base.php                             18-Jun-2024 14:06                4382
class.xmldiff-dom.php                              18-Jun-2024 14:06                5315
class.xmldiff-file.php                             18-Jun-2024 14:06                5167
class.xmldiff-memory.php                           18-Jun-2024 14:06                5204
class.xmlparser.php                                18-Jun-2024 14:06                1886
class.xmlreader.php                                18-Jun-2024 14:06               43042
class.xmlwriter.php                                18-Jun-2024 14:06               33895
class.xsltprocessor.php                            18-Jun-2024 14:06               12052
class.yac.php                                      18-Jun-2024 14:06                9751
class.yaconf.php                                   18-Jun-2024 14:06                3743
class.yaf-action-abstract.php                      18-Jun-2024 14:06               13033
class.yaf-application.php                          18-Jun-2024 14:06               13637
class.yaf-bootstrap-abstract.php                   18-Jun-2024 14:06                6029
class.yaf-config-abstract.php                      18-Jun-2024 14:06                5362
class.yaf-config-ini.php                           18-Jun-2024 14:06               18837
class.yaf-config-simple.php                        18-Jun-2024 14:06               13434
class.yaf-controller-abstract.php                  18-Jun-2024 14:06               20551
class.yaf-dispatcher.php                           18-Jun-2024 14:06               21502
class.yaf-exception-dispatchfailed.php             18-Jun-2024 14:06                2712
class.yaf-exception-loadfailed-action.php          18-Jun-2024 14:06                2783
class.yaf-exception-loadfailed-controller.php      18-Jun-2024 14:06                2808
class.yaf-exception-loadfailed-module.php          18-Jun-2024 14:06                2772
class.yaf-exception-loadfailed-view.php            18-Jun-2024 14:06                2712
class.yaf-exception-loadfailed.php                 18-Jun-2024 14:06                2690
class.yaf-exception-routerfailed.php               18-Jun-2024 14:06                2697
class.yaf-exception-startuperror.php               18-Jun-2024 14:06                2695
class.yaf-exception-typeerror.php                  18-Jun-2024 14:06                2666
class.yaf-exception.php                            18-Jun-2024 14:06                8640
class.yaf-loader.php                               18-Jun-2024 14:06               21408
class.yaf-plugin-abstract.php                      18-Jun-2024 14:06               16891
class.yaf-registry.php                             18-Jun-2024 14:06                6424
class.yaf-request-abstract.php                     18-Jun-2024 14:06               24610
class.yaf-request-http.php                         18-Jun-2024 14:06               24115
class.yaf-request-simple.php                       18-Jun-2024 14:06               23029
class.yaf-response-abstract.php                    18-Jun-2024 14:06               12286
class.yaf-route-interface.php                      18-Jun-2024 14:06                3872
class.yaf-route-map.php                            18-Jun-2024 14:06                6796
class.yaf-route-regex.php                          18-Jun-2024 14:06                8588
class.yaf-route-rewrite.php                        18-Jun-2024 14:06                7655
class.yaf-route-simple.php                         18-Jun-2024 14:06                6988
class.yaf-route-static.php                         18-Jun-2024 14:06                5413
class.yaf-route-supervar.php                       18-Jun-2024 14:06                4827
class.yaf-router.php                               18-Jun-2024 14:06               14337
class.yaf-session.php                              18-Jun-2024 14:06               12869
class.yaf-view-interface.php                       18-Jun-2024 14:06                6369
class.yaf-view-simple.php                          18-Jun-2024 14:06               11707
class.yar-client-exception.php                     18-Jun-2024 14:06                6721
class.yar-client.php                               18-Jun-2024 14:06                5948
class.yar-concurrent-client.php                    18-Jun-2024 14:06                6843
class.yar-server-exception.php                     18-Jun-2024 14:06                7269
class.yar-server.php                               18-Jun-2024 14:06                3587
class.ziparchive.php                               18-Jun-2024 14:06               92650
class.zmq.php                                      18-Jun-2024 14:06               45344
class.zmqcontext.php                               18-Jun-2024 14:06                5783
class.zmqdevice.php                                18-Jun-2024 14:06                7427
class.zmqpoll.php                                  18-Jun-2024 14:06                5476
class.zmqsocket.php                                18-Jun-2024 14:06               11995
class.zookeeper.php                                18-Jun-2024 14:06               60887
class.zookeeperauthenticationexception.php         18-Jun-2024 14:06                7842
class.zookeeperconfig.php                          18-Jun-2024 14:06                6715
class.zookeeperconnectionexception.php             18-Jun-2024 14:06                7833
class.zookeeperexception.php                       18-Jun-2024 14:06                7670
class.zookeepermarshallingexception.php            18-Jun-2024 14:06                7896
class.zookeepernonodeexception.php                 18-Jun-2024 14:06                7832
class.zookeeperoperationtimeoutexception.php       18-Jun-2024 14:06                7915
class.zookeepersessionexception.php                18-Jun-2024 14:06                7827
classobj.configuration.php                         18-Jun-2024 14:06                1446
classobj.constants.php                             18-Jun-2024 14:06                1350
classobj.examples.php                              18-Jun-2024 14:06               14441
classobj.installation.php                          18-Jun-2024 14:06                1448
classobj.requirements.php                          18-Jun-2024 14:06                1331
classobj.resources.php                             18-Jun-2024 14:06                1392
classobj.setup.php                                 18-Jun-2024 14:06                1764
closure.bind.php                                   18-Jun-2024 14:06                8969
closure.bindto.php                                 18-Jun-2024 14:06               11690                                   18-Jun-2024 14:06                6663
closure.construct.php                              18-Jun-2024 14:06                2725
closure.fromcallable.php                           18-Jun-2024 14:06                4432
cmark.constants.php                                18-Jun-2024 14:06                4334
cmark.installation.php                             18-Jun-2024 14:06                2290
cmark.requirements.php                             18-Jun-2024 14:06                1406
cmark.setup.php                                    18-Jun-2024 14:06                1532
collator.asort.php                                 18-Jun-2024 14:06               10686                               18-Jun-2024 14:06               11566
collator.construct.php                             18-Jun-2024 14:06                7218
collator.create.php                                18-Jun-2024 14:06                6353
collator.getattribute.php                          18-Jun-2024 14:06                6596
collator.geterrorcode.php                          18-Jun-2024 14:06                5606
collator.geterrormessage.php                       18-Jun-2024 14:06                5704
collator.getlocale.php                             18-Jun-2024 14:06                7533
collator.getsortkey.php                            18-Jun-2024 14:06                7970
collator.getstrength.php                           18-Jun-2024 14:06                5270
collator.setattribute.php                          18-Jun-2024 14:06                7171
collator.setstrength.php                           18-Jun-2024 14:06               16552
collator.sort.php                                  18-Jun-2024 14:06                9223
collator.sortwithsortkeys.php                      18-Jun-2024 14:06                7242
collectable.isgarbage.php                          18-Jun-2024 14:06                3759
com.configuration.php                              18-Jun-2024 14:06               10238
com.constants.php                                  18-Jun-2024 14:06               29798
com.construct.php                                  18-Jun-2024 14:06               10932
com.error-handling.php                             18-Jun-2024 14:06                1901
com.examples.arrays.php                            18-Jun-2024 14:06                2617
com.examples.foreach.php                           18-Jun-2024 14:06                3083
com.examples.php                                   18-Jun-2024 14:06                1535
com.installation.php                               18-Jun-2024 14:06                1703
com.requirements.php                               18-Jun-2024 14:06                1420
com.resources.php                                  18-Jun-2024 14:06                1357
com.setup.php                                      18-Jun-2024 14:06                1698
commonmark-cql.construct.php                       18-Jun-2024 14:06                2288
commonmark-cql.invoke.php                          18-Jun-2024 14:06                4228
commonmark-interfaces-ivisitable.accept.php        18-Jun-2024 14:06                3211
commonmark-interfaces-ivisitor.enter.php           18-Jun-2024 14:06                4561
commonmark-interfaces-ivisitor.leave.php           18-Jun-2024 14:06                4575
commonmark-node-bulletlist.construct.php           18-Jun-2024 14:06                3370
commonmark-node-codeblock.construct.php            18-Jun-2024 14:06                2985
commonmark-node-heading.construct.php              18-Jun-2024 14:06                2811
commonmark-node-image.construct.php                18-Jun-2024 14:06                3428
commonmark-node-link.construct.php                 18-Jun-2024 14:06                3425
commonmark-node-orderedlist.construct.php          18-Jun-2024 14:06                4307
commonmark-node-text.construct.php                 18-Jun-2024 14:06                2819
commonmark-node.accept.php                         18-Jun-2024 14:06                2951
commonmark-node.appendchild.php                    18-Jun-2024 14:06                2941
commonmark-node.insertafter.php                    18-Jun-2024 14:06                2966
commonmark-node.insertbefore.php                   18-Jun-2024 14:06                2964
commonmark-node.prependchild.php                   18-Jun-2024 14:06                2968
commonmark-node.replace.php                        18-Jun-2024 14:06                2912
commonmark-node.unlink.php                         18-Jun-2024 14:06                2643
commonmark-parser.construct.php                    18-Jun-2024 14:06                3958
commonmark-parser.finish.php                       18-Jun-2024 14:06                2598
commonmark-parser.parse.php                        18-Jun-2024 14:06                2796
compersisthelper.construct.php                     18-Jun-2024 14:06                3893
compersisthelper.getcurfilename.php                18-Jun-2024 14:06                3393
compersisthelper.getmaxstreamsize.php              18-Jun-2024 14:06                3414
compersisthelper.initnew.php                       18-Jun-2024 14:06                3480
compersisthelper.loadfromfile.php                  18-Jun-2024 14:06                4867
compersisthelper.loadfromstream.php                18-Jun-2024 14:06                3818
compersisthelper.savetofile.php                    18-Jun-2024 14:06                6894
compersisthelper.savetostream.php                  18-Jun-2024 14:06                3689
componere-abstract-definition.addinterface.php     18-Jun-2024 14:06                3491
componere-abstract-definition.addmethod.php        18-Jun-2024 14:06                4359
componere-abstract-definition.addtrait.php         18-Jun-2024 14:06                3463
componere-abstract-definition.getreflector.php     18-Jun-2024 14:06                2508
componere-definition.addconstant.php               18-Jun-2024 14:06                4893
componere-definition.addproperty.php               18-Jun-2024 14:06                4081
componere-definition.construct.php                 18-Jun-2024 14:06                6521
componere-definition.getclosure.php                18-Jun-2024 14:06                3767
componere-definition.getclosures.php               18-Jun-2024 14:06                2941
componere-definition.isregistered.php              18-Jun-2024 14:06                2442
componere-definition.register.php                  18-Jun-2024 14:06                2578
componere-method.construct.php                     18-Jun-2024 14:06                2277
componere-method.getreflector.php                  18-Jun-2024 14:06                2301
componere-method.setprivate.php                    18-Jun-2024 14:06                2600
componere-method.setprotected.php                  18-Jun-2024 14:06                2615
componere-method.setstatic.php                     18-Jun-2024 14:06                2101
componere-patch.apply.php                          18-Jun-2024 14:06                1934
componere-patch.construct.php                      18-Jun-2024 14:06                3912
componere-patch.derive.php                         18-Jun-2024 14:06                3371
componere-patch.getclosure.php                     18-Jun-2024 14:06                3316
componere-patch.getclosures.php                    18-Jun-2024 14:06                2390
componere-patch.isapplied.php                      18-Jun-2024 14:06                1892
componere-patch.revert.php                         18-Jun-2024 14:06                1923
componere-value.construct.php                      18-Jun-2024 14:06                2794
componere-value.hasdefault.php                     18-Jun-2024 14:06                1953
componere-value.isprivate.php                      18-Jun-2024 14:06                1953
componere-value.isprotected.php                    18-Jun-2024 14:06                1963
componere-value.isstatic.php                       18-Jun-2024 14:06                1947
componere-value.setprivate.php                     18-Jun-2024 14:06                2630
componere-value.setprotected.php                   18-Jun-2024 14:06                2644
componere-value.setstatic.php                      18-Jun-2024 14:06                2125
componere.cast.php                                 18-Jun-2024 14:06                5452
componere.cast_by_ref.php                          18-Jun-2024 14:06                5679
componere.installation.php                         18-Jun-2024 14:06                1431
componere.requirements.php                         18-Jun-2024 14:06                1311
componere.setup.php                                18-Jun-2024 14:06                1571
configuration.changes.modes.php                    18-Jun-2024 14:06                4732
configuration.changes.php                          18-Jun-2024 14:06               11141
configuration.file.per-user.php                    18-Jun-2024 14:06                3891
configuration.file.php                             18-Jun-2024 14:06               12682
configuration.php                                  18-Jun-2024 14:06                1907
configure.about.php                                18-Jun-2024 14:07               15725
configure.php                                      18-Jun-2024 14:07                1562
context.ftp.php                                    18-Jun-2024 14:06                5063
context.http.php                                   18-Jun-2024 14:06               18384
context.params.php                                 18-Jun-2024 14:06                2885
context.phar.php                                   18-Jun-2024 14:06                3034
context.php                                        18-Jun-2024 14:06                3518
context.socket.php                                 18-Jun-2024 14:06               10629
context.ssl.php                                    18-Jun-2024 14:06               15013                                    18-Jun-2024 14:06                4561
context.zlib.php                                   18-Jun-2024 14:06                2704
control-structures.alternative-syntax.php          18-Jun-2024 14:06                7832
control-structures.break.php                       18-Jun-2024 14:06                5106
control-structures.continue.php                    18-Jun-2024 14:06                9218
control-structures.declare.php                     18-Jun-2024 14:06               11916                    18-Jun-2024 14:06                5989
control-structures.else.php                        18-Jun-2024 14:06                5645
control-structures.elseif.php                      18-Jun-2024 14:06                8917
control-structures.for.php                         18-Jun-2024 14:06               13194
control-structures.foreach.php                     18-Jun-2024 14:06               23270
control-structures.goto.php                        18-Jun-2024 14:06                7912
control-structures.if.php                          18-Jun-2024 14:06                5774
control-structures.intro.php                       18-Jun-2024 14:06                3008
control-structures.match.php                       18-Jun-2024 14:06               22896
control-structures.switch.php                      18-Jun-2024 14:06               22946
control-structures.while.php                       18-Jun-2024 14:06                5439
copyright.php                                      18-Jun-2024 14:06                2635
countable.count.php                                18-Jun-2024 14:06                5754
ctype.configuration.php                            18-Jun-2024 14:06                1425
ctype.constants.php                                18-Jun-2024 14:06                1305
ctype.installation.php                             18-Jun-2024 14:06                1716
ctype.requirements.php                             18-Jun-2024 14:06                1439
ctype.resources.php                                18-Jun-2024 14:06                1371
ctype.setup.php                                    18-Jun-2024 14:06                1708
cubrid.configuration.php                           18-Jun-2024 14:06                1367
cubrid.constants.php                               18-Jun-2024 14:06               17620
cubrid.examples.php                                18-Jun-2024 14:06               15066
cubrid.installation.php                            18-Jun-2024 14:06                2359
cubrid.requirements.php                            18-Jun-2024 14:06                1439
cubrid.resources.php                               18-Jun-2024 14:06                3590
cubrid.setup.php                                   18-Jun-2024 14:06                1721
cubridmysql.cubrid.php                             18-Jun-2024 14:06                6197
curl.configuration.php                             18-Jun-2024 14:06                2984
curl.constants.php                                 18-Jun-2024 14:06              219806
curl.examples-basic.php                            18-Jun-2024 14:06                4993
curl.examples.php                                  18-Jun-2024 14:06                1530
curl.installation.php                              18-Jun-2024 14:06                2871
curl.requirements.php                              18-Jun-2024 14:06                1682
curl.resources.php                                 18-Jun-2024 14:06                1539
curl.setup.php                                     18-Jun-2024 14:06                1716
curlfile.construct.php                             18-Jun-2024 14:06               22185
curlfile.getfilename.php                           18-Jun-2024 14:06                2307
curlfile.getmimetype.php                           18-Jun-2024 14:06                2303
curlfile.getpostfilename.php                       18-Jun-2024 14:06                2425
curlfile.setmimetype.php                           18-Jun-2024 14:06                2601
curlfile.setpostfilename.php                       18-Jun-2024 14:06                2709
curlstringfile.construct.php                       18-Jun-2024 14:06                7505
dateinterval.construct.php                         18-Jun-2024 14:06               15281
dateinterval.createfromdatestring.php              18-Jun-2024 14:06               16711
dateinterval.format.php                            18-Jun-2024 14:06               15992
dateperiod.construct.php                           18-Jun-2024 14:06               21614
dateperiod.createfromiso8601string.php             18-Jun-2024 14:06                9092
dateperiod.getdateinterval.php                     18-Jun-2024 14:06                5056
dateperiod.getenddate.php                          18-Jun-2024 14:06                8293
dateperiod.getrecurrences.php                      18-Jun-2024 14:06                9325
dateperiod.getstartdate.php                        18-Jun-2024 14:06                5459
datetime.add.php                                   18-Jun-2024 14:06                5447
datetime.configuration.php                         18-Jun-2024 14:06                7241
datetime.constants.php                             18-Jun-2024 14:06                3295
datetime.construct.php                             18-Jun-2024 14:06                7478
datetime.createfromformat.php                      18-Jun-2024 14:06                8118
datetime.createfromimmutable.php                   18-Jun-2024 14:06                5335
datetime.createfrominterface.php                   18-Jun-2024 14:06                5246
datetime.diff.php                                  18-Jun-2024 14:06               18845
datetime.error.tree.php                            18-Jun-2024 14:06                3388
datetime.examples-arithmetic.php                   18-Jun-2024 14:06               16454
datetime.examples.php                              18-Jun-2024 14:06                1562
datetime.format.php                                18-Jun-2024 14:06               31574
datetime.formats.php                               18-Jun-2024 14:06               66193
datetime.getlasterrors.php                         18-Jun-2024 14:06                1898
datetime.getoffset.php                             18-Jun-2024 14:06                8419
datetime.gettimestamp.php                          18-Jun-2024 14:06               11502
datetime.gettimezone.php                           18-Jun-2024 14:06                8409
datetime.installation.php                          18-Jun-2024 14:06                1895
datetime.modify.php                                18-Jun-2024 14:06               15759
datetime.requirements.php                          18-Jun-2024 14:06                1331
datetime.resources.php                             18-Jun-2024 14:06                1392
datetime.set-state.php                             18-Jun-2024 14:06                3070
datetime.setdate.php                               18-Jun-2024 14:06                6126
datetime.setisodate.php                            18-Jun-2024 14:06                6389
datetime.settime.php                               18-Jun-2024 14:06                7835
datetime.settimestamp.php                          18-Jun-2024 14:06                5716
datetime.settimezone.php                           18-Jun-2024 14:06               10172
datetime.setup.php                                 18-Jun-2024 14:06                1780
datetime.sub.php                                   18-Jun-2024 14:06                7166
datetime.wakeup.php                                18-Jun-2024 14:06                3164
datetimeimmutable.add.php                          18-Jun-2024 14:06               11250
datetimeimmutable.construct.php                    18-Jun-2024 14:06               20039
datetimeimmutable.createfromformat.php             18-Jun-2024 14:06               55823
datetimeimmutable.createfrominterface.php          18-Jun-2024 14:06                5561
datetimeimmutable.createfrommutable.php            18-Jun-2024 14:06                5471
datetimeimmutable.getlasterrors.php                18-Jun-2024 14:06                6330
datetimeimmutable.modify.php                       18-Jun-2024 14:06               10419
datetimeimmutable.set-state.php                    18-Jun-2024 14:06                2916
datetimeimmutable.setdate.php                      18-Jun-2024 14:06                9814
datetimeimmutable.setisodate.php                   18-Jun-2024 14:06               13531
datetimeimmutable.settime.php                      18-Jun-2024 14:06               12811
datetimeimmutable.settimestamp.php                 18-Jun-2024 14:06                6338
datetimeimmutable.settimezone.php                  18-Jun-2024 14:06                6515
datetimeimmutable.sub.php                          18-Jun-2024 14:06               13333
datetimezone.construct.php                         18-Jun-2024 14:06               11784
datetimezone.getlocation.php                       18-Jun-2024 14:06                6671
datetimezone.getname.php                           18-Jun-2024 14:06                4114
datetimezone.getoffset.php                         18-Jun-2024 14:06                7875
datetimezone.gettransitions.php                    18-Jun-2024 14:06               13122
datetimezone.listabbreviations.php                 18-Jun-2024 14:06                6956
datetimezone.listidentifiers.php                   18-Jun-2024 14:06               15728
dba.configuration.php                              18-Jun-2024 14:06                2532
dba.constants.php                                  18-Jun-2024 14:06                2535
dba.example.php                                    18-Jun-2024 14:06                6853
dba.examples.php                                   18-Jun-2024 14:06                1469
dba.installation.php                               18-Jun-2024 14:06               11979
dba.requirements.php                               18-Jun-2024 14:06                9188
dba.resources.php                                  18-Jun-2024 14:06                1707
dba.setup.php                                      18-Jun-2024 14:06                1698
dbase.configuration.php                            18-Jun-2024 14:06                1425
dbase.constants.php                                18-Jun-2024 14:06                3846
dbase.installation.php                             18-Jun-2024 14:06                1806
dbase.requirements.php                             18-Jun-2024 14:06                1310
dbase.resources.php                                18-Jun-2024 14:06                1629
dbase.setup.php                                    18-Jun-2024 14:06                1724
debugger-about.php                                 18-Jun-2024 14:07                1754
debugger.php                                       18-Jun-2024 14:07                1476
dio.configuration.php                              18-Jun-2024 14:06                1411
dio.constants.php                                  18-Jun-2024 14:06               11319
dio.installation.php                               18-Jun-2024 14:06                2284
dio.requirements.php                               18-Jun-2024 14:06                1296
dio.resources.php                                  18-Jun-2024 14:06                1517
dio.setup.php                                      18-Jun-2024 14:06                1739
dir.configuration.php                              18-Jun-2024 14:06                1411
dir.constants.php                                  18-Jun-2024 14:06                2933
dir.installation.php                               18-Jun-2024 14:06                1413
dir.requirements.php                               18-Jun-2024 14:06                1296
dir.resources.php                                  18-Jun-2024 14:06                1357
dir.setup.php                                      18-Jun-2024 14:06                1705
directory.close.php                                18-Jun-2024 14:06                2364                                 18-Jun-2024 14:06                2507
directory.rewind.php                               18-Jun-2024 14:06                2448
directoryiterator.construct.php                    18-Jun-2024 14:06                6287
directoryiterator.current.php                      18-Jun-2024 14:06                6574
directoryiterator.getbasename.php                  18-Jun-2024 14:06                6888
directoryiterator.getextension.php                 18-Jun-2024 14:06                6660
directoryiterator.getfilename.php                  18-Jun-2024 14:06                5529
directoryiterator.isdot.php                        18-Jun-2024 14:06                5731
directoryiterator.key.php                          18-Jun-2024 14:06                7143                         18-Jun-2024 14:06                5974
directoryiterator.rewind.php                       18-Jun-2024 14:06                5831                         18-Jun-2024 14:06                5802
directoryiterator.tostring.php                     18-Jun-2024 14:06                5023
directoryiterator.valid.php                        18-Jun-2024 14:06                6263
doc.changelog.php                                  18-Jun-2024 14:07                1436
dom.configuration.php                              18-Jun-2024 14:06                1411
dom.constants.php                                  18-Jun-2024 14:06               21287
dom.examples.php                                   18-Jun-2024 14:06                3202
dom.installation.php                               18-Jun-2024 14:06                1433
dom.requirements.php                               18-Jun-2024 14:06                1713
dom.resources.php                                  18-Jun-2024 14:06                1357
dom.setup.php                                      18-Jun-2024 14:06                1693
domattr.construct.php                              18-Jun-2024 14:06                6060
domattr.isid.php                                   18-Jun-2024 14:06                5809
domcdatasection.construct.php                      18-Jun-2024 14:06                5497
domcharacterdata.after.php                         18-Jun-2024 14:06                8912
domcharacterdata.appenddata.php                    18-Jun-2024 14:06                4815
domcharacterdata.before.php                        18-Jun-2024 14:06                8438
domcharacterdata.deletedata.php                    18-Jun-2024 14:06                5651
domcharacterdata.insertdata.php                    18-Jun-2024 14:06                5279
domcharacterdata.remove.php                        18-Jun-2024 14:06                5909
domcharacterdata.replacedata.php                   18-Jun-2024 14:06                6097
domcharacterdata.replacewith.php                   18-Jun-2024 14:06                8827
domcharacterdata.substringdata.php                 18-Jun-2024 14:06                5438
domchildnode.after.php                             18-Jun-2024 14:06                6681
domchildnode.before.php                            18-Jun-2024 14:06                5947
domchildnode.remove.php                            18-Jun-2024 14:06                3383
domchildnode.replacewith.php                       18-Jun-2024 14:06                6049
domcomment.construct.php                           18-Jun-2024 14:06                5391
domdocument.adoptnode.php                          18-Jun-2024 14:06                7189
domdocument.append.php                             18-Jun-2024 14:06                7826
domdocument.construct.php                          18-Jun-2024 14:06                4585
domdocument.createattribute.php                    18-Jun-2024 14:06                6625
domdocument.createattributens.php                  18-Jun-2024 14:06                9518
domdocument.createcdatasection.php                 18-Jun-2024 14:06                6173
domdocument.createcomment.php                      18-Jun-2024 14:06                6685
domdocument.createdocumentfragment.php             18-Jun-2024 14:06                6544
domdocument.createelement.php                      18-Jun-2024 14:06               12981
domdocument.createelementns.php                    18-Jun-2024 14:06               15321
domdocument.createentityreference.php              18-Jun-2024 14:06                6951
domdocument.createprocessinginstruction.php        18-Jun-2024 14:06                7301
domdocument.createtextnode.php                     18-Jun-2024 14:06                6667
domdocument.getelementbyid.php                     18-Jun-2024 14:06                8476
domdocument.getelementsbytagname.php               18-Jun-2024 14:06                6819
domdocument.getelementsbytagnamens.php             18-Jun-2024 14:06                8470
domdocument.importnode.php                         18-Jun-2024 14:06                9820
domdocument.load.php                               18-Jun-2024 14:06                7624
domdocument.loadhtml.php                           18-Jun-2024 14:06                9502
domdocument.loadhtmlfile.php                       18-Jun-2024 14:06                9630
domdocument.loadxml.php                            18-Jun-2024 14:06                7122
domdocument.normalizedocument.php                  18-Jun-2024 14:06                3266
domdocument.prepend.php                            18-Jun-2024 14:06                7897
domdocument.registernodeclass.php                  18-Jun-2024 14:06               22897
domdocument.relaxngvalidate.php                    18-Jun-2024 14:06                4590
domdocument.relaxngvalidatesource.php              18-Jun-2024 14:06                4669
domdocument.replacechildren.php                    18-Jun-2024 14:06                8183                               18-Jun-2024 14:06                8228
domdocument.savehtml.php                           18-Jun-2024 14:06                8092
domdocument.savehtmlfile.php                       18-Jun-2024 14:06                8596
domdocument.savexml.php                            18-Jun-2024 14:06               10652
domdocument.schemavalidate.php                     18-Jun-2024 14:06                5157
domdocument.schemavalidatesource.php               18-Jun-2024 14:06                5196
domdocument.validate.php                           18-Jun-2024 14:06                6893
domdocument.xinclude.php                           18-Jun-2024 14:06                7757
domdocumentfragment.append.php                     18-Jun-2024 14:06                8508
domdocumentfragment.appendxml.php                  18-Jun-2024 14:06                6172
domdocumentfragment.construct.php                  18-Jun-2024 14:06                2221
domdocumentfragment.prepend.php                    18-Jun-2024 14:06                8557
domdocumentfragment.replacechildren.php            18-Jun-2024 14:06                8919
domelement.after.php                               18-Jun-2024 14:06                8569
domelement.append.php                              18-Jun-2024 14:06                8124
domelement.before.php                              18-Jun-2024 14:06                8059
domelement.construct.php                           18-Jun-2024 14:06                7319
domelement.getattribute.php                        18-Jun-2024 14:06                3837
domelement.getattributenames.php                   18-Jun-2024 14:06                4260
domelement.getattributenode.php                    18-Jun-2024 14:06                4398
domelement.getattributenodens.php                  18-Jun-2024 14:06                4960
domelement.getattributens.php                      18-Jun-2024 14:06                4492
domelement.getelementsbytagname.php                18-Jun-2024 14:06                4105
domelement.getelementsbytagnamens.php              18-Jun-2024 14:06                5489
domelement.hasattribute.php                        18-Jun-2024 14:06                4243
domelement.hasattributens.php                      18-Jun-2024 14:06                4711
domelement.insertadjacentelement.php               18-Jun-2024 14:06                7271
domelement.insertadjacenttext.php                  18-Jun-2024 14:06                7088
domelement.prepend.php                             18-Jun-2024 14:06                8151
domelement.remove.php                              18-Jun-2024 14:06                5488
domelement.removeattribute.php                     18-Jun-2024 14:06                4419
domelement.removeattributenode.php                 18-Jun-2024 14:06                4864
domelement.removeattributens.php                   18-Jun-2024 14:06                4708
domelement.replacechildren.php                     18-Jun-2024 14:06                8724
domelement.replacewith.php                         18-Jun-2024 14:06                8797
domelement.setattribute.php                        18-Jun-2024 14:06                6644
domelement.setattributenode.php                    18-Jun-2024 14:06                5202
domelement.setattributenodens.php                  18-Jun-2024 14:06                5333
domelement.setattributens.php                      18-Jun-2024 14:06                5930
domelement.setidattribute.php                      18-Jun-2024 14:06                5563
domelement.setidattributenode.php                  18-Jun-2024 14:06                5530
domelement.setidattributens.php                    18-Jun-2024 14:06                6067
domelement.toggleattribute.php                     18-Jun-2024 14:06                6815
domentityreference.construct.php                   18-Jun-2024 14:06                5032
domimplementation.construct.php                    18-Jun-2024 14:06                2269
domimplementation.createdocument.php               18-Jun-2024 14:06                8140
domimplementation.createdocumenttype.php           18-Jun-2024 14:06               10854
domimplementation.hasfeature.php                   18-Jun-2024 14:06               10028
domnamednodemap.count.php                          18-Jun-2024 14:06                2637
domnamednodemap.getiterator.php                    18-Jun-2024 14:06                3561
domnamednodemap.getnameditem.php                   18-Jun-2024 14:06                3722
domnamednodemap.getnameditemns.php                 18-Jun-2024 14:06                4276
domnamednodemap.item.php                           18-Jun-2024 14:06                3339
domnode.appendchild.php                            18-Jun-2024 14:06                9830
domnode.c14n.php                                   18-Jun-2024 14:06                9032
domnode.c14nfile.php                               18-Jun-2024 14:06                6459
domnode.clonenode.php                              18-Jun-2024 14:06                3010
domnode.contains.php                               18-Jun-2024 14:06                5782
domnode.getlineno.php                              18-Jun-2024 14:06                5374
domnode.getnodepath.php                            18-Jun-2024 14:06                5611
domnode.getrootnode.php                            18-Jun-2024 14:06                4700
domnode.hasattributes.php                          18-Jun-2024 14:06                3329
domnode.haschildnodes.php                          18-Jun-2024 14:06                3168
domnode.insertbefore.php                           18-Jun-2024 14:06                6382
domnode.isdefaultnamespace.php                     18-Jun-2024 14:06                3271
domnode.isequalnode.php                            18-Jun-2024 14:06                4988
domnode.issamenode.php                             18-Jun-2024 14:06                3145
domnode.issupported.php                            18-Jun-2024 14:06                4275
domnode.lookupnamespaceuri.php                     18-Jun-2024 14:06                4047
domnode.lookupprefix.php                           18-Jun-2024 14:06                3638
domnode.normalize.php                              18-Jun-2024 14:06                3115
domnode.removechild.php                            18-Jun-2024 14:06                7709
domnode.replacechild.php                           18-Jun-2024 14:06                6640
domnodelist.count.php                              18-Jun-2024 14:06                2549
domnodelist.getiterator.php                        18-Jun-2024 14:06                3448
domnodelist.item.php                               18-Jun-2024 14:06                7398
domparentnode.append.php                           18-Jun-2024 14:06                5562
domparentnode.prepend.php                          18-Jun-2024 14:06                5590
domparentnode.replacechildren.php                  18-Jun-2024 14:06                7419
domprocessinginstruction.construct.php             18-Jun-2024 14:06                7175
domtext.construct.php                              18-Jun-2024 14:06                5069
domtext.iselementcontentwhitespace.php             18-Jun-2024 14:06                2876
domtext.iswhitespaceinelementcontent.php           18-Jun-2024 14:06                3178
domtext.splittext.php                              18-Jun-2024 14:06                3719
domxpath.construct.php                             18-Jun-2024 14:06                3970
domxpath.evaluate.php                              18-Jun-2024 14:06                9119
domxpath.query.php                                 18-Jun-2024 14:06               13670
domxpath.registernamespace.php                     18-Jun-2024 14:06                3581
domxpath.registerphpfunctions.php                  18-Jun-2024 14:06               14893
dotnet.construct.php                               18-Jun-2024 14:06                3197
ds-collection.clear.php                            18-Jun-2024 14:06                4167
ds-collection.copy.php                             18-Jun-2024 14:06                4494
ds-collection.isempty.php                          18-Jun-2024 14:06                4475
ds-collection.toarray.php                          18-Jun-2024 14:06                4593
ds-deque.allocate.php                              18-Jun-2024 14:06                5257
ds-deque.apply.php                                 18-Jun-2024 14:06                5276
ds-deque.capacity.php                              18-Jun-2024 14:06                4194
ds-deque.clear.php                                 18-Jun-2024 14:06                4171
ds-deque.construct.php                             18-Jun-2024 14:06                4438
ds-deque.contains.php                              18-Jun-2024 14:06                7544
ds-deque.copy.php                                  18-Jun-2024 14:06                4516
ds-deque.count.php                                 18-Jun-2024 14:06                1730
ds-deque.filter.php                                18-Jun-2024 14:06                8244
ds-deque.find.php                                  18-Jun-2024 14:06                5731
ds-deque.first.php                                 18-Jun-2024 14:06                4168
ds-deque.get.php                                   18-Jun-2024 14:06                7012
ds-deque.insert.php                                18-Jun-2024 14:06                7201
ds-deque.isempty.php                               18-Jun-2024 14:06                4469
ds-deque.join.php                                  18-Jun-2024 14:06                6158
ds-deque.jsonserialize.php                         18-Jun-2024 14:06                2016
ds-deque.last.php                                  18-Jun-2024 14:06                4194                                   18-Jun-2024 14:06                5870
ds-deque.merge.php                                 18-Jun-2024 14:06                5441
ds-deque.pop.php                                   18-Jun-2024 14:06                4593
ds-deque.push.php                                  18-Jun-2024 14:06                5012
ds-deque.reduce.php                                18-Jun-2024 14:06                8555
ds-deque.remove.php                                18-Jun-2024 14:06                5211
ds-deque.reverse.php                               18-Jun-2024 14:06                4017
ds-deque.reversed.php                              18-Jun-2024 14:06                4408
ds-deque.rotate.php                                18-Jun-2024 14:06                5571
ds-deque.set.php                                   18-Jun-2024 14:06                6562
ds-deque.shift.php                                 18-Jun-2024 14:06                4685
ds-deque.slice.php                                 18-Jun-2024 14:06                7947
ds-deque.sort.php                                  18-Jun-2024 14:06                8262
ds-deque.sorted.php                                18-Jun-2024 14:06                8425
ds-deque.sum.php                                   18-Jun-2024 14:06                5799
ds-deque.toarray.php                               18-Jun-2024 14:06                4595
ds-deque.unshift.php                               18-Jun-2024 14:06                5140
ds-hashable.equals.php                             18-Jun-2024 14:06                4214
ds-hashable.hash.php                               18-Jun-2024 14:06                9115
ds-map.allocate.php                                18-Jun-2024 14:06                5125
ds-map.apply.php                                   18-Jun-2024 14:06                5986
ds-map.capacity.php                                18-Jun-2024 14:06                3484
ds-map.clear.php                                   18-Jun-2024 14:06                4618
ds-map.construct.php                               18-Jun-2024 14:06                4938
ds-map.copy.php                                    18-Jun-2024 14:06                4328
ds-map.count.php                                   18-Jun-2024 14:06                1676
ds-map.diff.php                                    18-Jun-2024 14:06                6037
ds-map.filter.php                                  18-Jun-2024 14:06                9005
ds-map.first.php                                   18-Jun-2024 14:06                4384
ds-map.get.php                                     18-Jun-2024 14:06                9405
ds-map.haskey.php                                  18-Jun-2024 14:06                4937
ds-map.hasvalue.php                                18-Jun-2024 14:06                4998
ds-map.intersect.php                               18-Jun-2024 14:06                6571
ds-map.isempty.php                                 18-Jun-2024 14:06                4631
ds-map.jsonserialize.php                           18-Jun-2024 14:06                1975
ds-map.keys.php                                    18-Jun-2024 14:06                4243
ds-map.ksort.php                                   18-Jun-2024 14:06                9028
ds-map.ksorted.php                                 18-Jun-2024 14:06                9166
ds-map.last.php                                    18-Jun-2024 14:06                4378                                     18-Jun-2024 14:06                6689
ds-map.merge.php                                   18-Jun-2024 14:06                6376
ds-map.pairs.php                                   18-Jun-2024 14:06                4662
ds-map.put.php                                     18-Jun-2024 14:06               15232
ds-map.putall.php                                  18-Jun-2024 14:06                6105
ds-map.reduce.php                                  18-Jun-2024 14:06                9513
ds-map.remove.php                                  18-Jun-2024 14:06                7945
ds-map.reverse.php                                 18-Jun-2024 14:06                4427
ds-map.reversed.php                                18-Jun-2024 14:06                4530
ds-map.skip.php                                    18-Jun-2024 14:06                4934
ds-map.slice.php                                   18-Jun-2024 14:06                8876
ds-map.sort.php                                    18-Jun-2024 14:06                8864
ds-map.sorted.php                                  18-Jun-2024 14:06                9083
ds-map.sum.php                                     18-Jun-2024 14:06                6182
ds-map.toarray.php                                 18-Jun-2024 14:06                5835
ds-map.union.php                                   18-Jun-2024 14:06                6362
ds-map.values.php                                  18-Jun-2024 14:06                4291
ds-map.xor.php                                     18-Jun-2024 14:06                6087
ds-pair.clear.php                                  18-Jun-2024 14:06                4012
ds-pair.construct.php                              18-Jun-2024 14:06                2726
ds-pair.copy.php                                   18-Jun-2024 14:06                4303
ds-pair.isempty.php                                18-Jun-2024 14:06                4367
ds-pair.jsonserialize.php                          18-Jun-2024 14:06                1983
ds-pair.toarray.php                                18-Jun-2024 14:06                4212
ds-priorityqueue.allocate.php                      18-Jun-2024 14:06                5434
ds-priorityqueue.capacity.php                      18-Jun-2024 14:06                3693
ds-priorityqueue.clear.php                         18-Jun-2024 14:06                4769
ds-priorityqueue.construct.php                     18-Jun-2024 14:06                3066
ds-priorityqueue.copy.php                          18-Jun-2024 14:06                4753
ds-priorityqueue.count.php                         18-Jun-2024 14:06                1820
ds-priorityqueue.isempty.php                       18-Jun-2024 14:06                5306
ds-priorityqueue.jsonserialize.php                 18-Jun-2024 14:06                2116
ds-priorityqueue.peek.php                          18-Jun-2024 14:06                5047
ds-priorityqueue.pop.php                           18-Jun-2024 14:06                5914
ds-priorityqueue.push.php                          18-Jun-2024 14:06                5919
ds-priorityqueue.toarray.php                       18-Jun-2024 14:06                5690
ds-queue.allocate.php                              18-Jun-2024 14:06                5549
ds-queue.capacity.php                              18-Jun-2024 14:06                4201
ds-queue.clear.php                                 18-Jun-2024 14:06                4097
ds-queue.construct.php                             18-Jun-2024 14:06                4436
ds-queue.copy.php                                  18-Jun-2024 14:06                4586
ds-queue.count.php                                 18-Jun-2024 14:06                1704
ds-queue.isempty.php                               18-Jun-2024 14:06                4416
ds-queue.jsonserialize.php                         18-Jun-2024 14:06                2004
ds-queue.peek.php                                  18-Jun-2024 14:06                4655
ds-queue.pop.php                                   18-Jun-2024 14:06                5193
ds-queue.push.php                                  18-Jun-2024 14:06                4976
ds-queue.toarray.php                               18-Jun-2024 14:06                4739
ds-sequence.allocate.php                           18-Jun-2024 14:06                5052
ds-sequence.apply.php                              18-Jun-2024 14:06                5396
ds-sequence.capacity.php                           18-Jun-2024 14:06                4749
ds-sequence.contains.php                           18-Jun-2024 14:06                7616
ds-sequence.filter.php                             18-Jun-2024 14:06                8384
ds-sequence.find.php                               18-Jun-2024 14:06                5844
ds-sequence.first.php                              18-Jun-2024 14:06                4182
ds-sequence.get.php                                18-Jun-2024 14:06                7140
ds-sequence.insert.php                             18-Jun-2024 14:06                7294
ds-sequence.join.php                               18-Jun-2024 14:06                6252
ds-sequence.last.php                               18-Jun-2024 14:06                4190                                18-Jun-2024 14:06                5857
ds-sequence.merge.php                              18-Jun-2024 14:06                5443
ds-sequence.pop.php                                18-Jun-2024 14:06                4705
ds-sequence.push.php                               18-Jun-2024 14:06                5118
ds-sequence.reduce.php                             18-Jun-2024 14:06                8671
ds-sequence.remove.php                             18-Jun-2024 14:06                5323
ds-sequence.reverse.php                            18-Jun-2024 14:06                4078
ds-sequence.reversed.php                           18-Jun-2024 14:06                4433
ds-sequence.rotate.php                             18-Jun-2024 14:06                5686
ds-sequence.set.php                                18-Jun-2024 14:06                6686
ds-sequence.shift.php                              18-Jun-2024 14:06                4774
ds-sequence.slice.php                              18-Jun-2024 14:06                8107
ds-sequence.sort.php                               18-Jun-2024 14:06                8337
ds-sequence.sorted.php                             18-Jun-2024 14:06                8480
ds-sequence.sum.php                                18-Jun-2024 14:06                5820
ds-sequence.unshift.php                            18-Jun-2024 14:06                5268
ds-set.add.php                                     18-Jun-2024 14:06               13230
ds-set.allocate.php                                18-Jun-2024 14:06                4980
ds-set.capacity.php                                18-Jun-2024 14:06                4152
ds-set.clear.php                                   18-Jun-2024 14:06                4073
ds-set.construct.php                               18-Jun-2024 14:06                4414
ds-set.contains.php                                18-Jun-2024 14:06                7877
ds-set.copy.php                                    18-Jun-2024 14:06                4543
ds-set.count.php                                   18-Jun-2024 14:06                1675
ds-set.diff.php                                    18-Jun-2024 14:06                5231
ds-set.filter.php                                  18-Jun-2024 14:06                8097
ds-set.first.php                                   18-Jun-2024 14:06                4035
ds-set.get.php                                     18-Jun-2024 14:06                6956
ds-set.intersect.php                               18-Jun-2024 14:06                5229
ds-set.isempty.php                                 18-Jun-2024 14:06                4364
ds-set.join.php                                    18-Jun-2024 14:06                6107
ds-set.jsonserialize.php                           18-Jun-2024 14:06                1970
ds-set.last.php                                    18-Jun-2024 14:06                4061
ds-set.merge.php                                   18-Jun-2024 14:06                5237
ds-set.reduce.php                                  18-Jun-2024 14:06                8514
ds-set.remove.php                                  18-Jun-2024 14:06                5409
ds-set.reverse.php                                 18-Jun-2024 14:06                3923
ds-set.reversed.php                                18-Jun-2024 14:06                4258
ds-set.slice.php                                   18-Jun-2024 14:06                7946
ds-set.sort.php                                    18-Jun-2024 14:06                8156
ds-set.sorted.php                                  18-Jun-2024 14:06                8294
ds-set.sum.php                                     18-Jun-2024 14:06                5655
ds-set.toarray.php                                 18-Jun-2024 14:06                4521
ds-set.union.php                                   18-Jun-2024 14:06                5235
ds-set.xor.php                                     18-Jun-2024 14:06                5389
ds-stack.allocate.php                              18-Jun-2024 14:06                3262
ds-stack.capacity.php                              18-Jun-2024 14:06                2349
ds-stack.clear.php                                 18-Jun-2024 14:06                4121
ds-stack.construct.php                             18-Jun-2024 14:06                4427
ds-stack.copy.php                                  18-Jun-2024 14:06                4598
ds-stack.count.php                                 18-Jun-2024 14:06                1709
ds-stack.isempty.php                               18-Jun-2024 14:06                4419
ds-stack.jsonserialize.php                         18-Jun-2024 14:06                2004
ds-stack.peek.php                                  18-Jun-2024 14:06                4643
ds-stack.pop.php                                   18-Jun-2024 14:06                5181
ds-stack.push.php                                  18-Jun-2024 14:06                4963
ds-stack.toarray.php                               18-Jun-2024 14:06                4502
ds-vector.allocate.php                             18-Jun-2024 14:06                5018
ds-vector.apply.php                                18-Jun-2024 14:06                5292
ds-vector.capacity.php                             18-Jun-2024 14:06                4654
ds-vector.clear.php                                18-Jun-2024 14:06                4123
ds-vector.construct.php                            18-Jun-2024 14:06                4469
ds-vector.contains.php                             18-Jun-2024 14:06                7513
ds-vector.copy.php                                 18-Jun-2024 14:06                4607
ds-vector.count.php                                18-Jun-2024 14:06                1717
ds-vector.filter.php                               18-Jun-2024 14:06                8188
ds-vector.find.php                                 18-Jun-2024 14:06                5756
ds-vector.first.php                                18-Jun-2024 14:06                4079
ds-vector.get.php                                  18-Jun-2024 14:06                7043
ds-vector.insert.php                               18-Jun-2024 14:06                7199
ds-vector.isempty.php                              18-Jun-2024 14:06                4397
ds-vector.join.php                                 18-Jun-2024 14:06                6181
ds-vector.jsonserialize.php                        18-Jun-2024 14:06                2006
ds-vector.last.php                                 18-Jun-2024 14:06                4109                                  18-Jun-2024 14:06                5752
ds-vector.merge.php                                18-Jun-2024 14:06                5343
ds-vector.pop.php                                  18-Jun-2024 14:06                4614
ds-vector.push.php                                 18-Jun-2024 14:06                4985
ds-vector.reduce.php                               18-Jun-2024 14:06                8567
ds-vector.remove.php                               18-Jun-2024 14:06                5236
ds-vector.reverse.php                              18-Jun-2024 14:06                3983
ds-vector.reversed.php                             18-Jun-2024 14:06                4326
ds-vector.rotate.php                               18-Jun-2024 14:06                5510
ds-vector.set.php                                  18-Jun-2024 14:06                6593
ds-vector.shift.php                                18-Jun-2024 14:06                4679
ds-vector.slice.php                                18-Jun-2024 14:06                7886
ds-vector.sort.php                                 18-Jun-2024 14:06                8234
ds-vector.sorted.php                               18-Jun-2024 14:06                8387
ds-vector.sum.php                                  18-Jun-2024 14:06                5733
ds-vector.toarray.php                              18-Jun-2024 14:06                4594
ds-vector.unshift.php                              18-Jun-2024 14:06                5113
ds.constants.php                                   18-Jun-2024 14:06                1305
ds.examples.php                                    18-Jun-2024 14:06                4883
ds.installation.php                                18-Jun-2024 14:06                2886
ds.requirements.php                                18-Jun-2024 14:06                1313
ds.setup.php                                       18-Jun-2024 14:06                1524
eio.configuration.php                              18-Jun-2024 14:06                1409
eio.constants.php                                  18-Jun-2024 14:06               23417
eio.examples.php                                   18-Jun-2024 14:06               28422
eio.installation.php                               18-Jun-2024 14:06                1991
eio.requirements.php                               18-Jun-2024 14:06                1440
eio.resources.php                                  18-Jun-2024 14:06                1361
eio.setup.php                                      18-Jun-2024 14:06                1705
emptyiterator.current.php                          18-Jun-2024 14:06                3077
emptyiterator.key.php                              18-Jun-2024 14:06                3037                             18-Jun-2024 14:06                2661
emptyiterator.rewind.php                           18-Jun-2024 14:06                2683
emptyiterator.valid.php                            18-Jun-2024 14:06                2996
enchant.configuration.php                          18-Jun-2024 14:06                1439
enchant.constants.php                              18-Jun-2024 14:06                3119
enchant.examples.php                               18-Jun-2024 14:06                5540
enchant.installation.php                           18-Jun-2024 14:06                3956
enchant.requirements.php                           18-Jun-2024 14:06                2069
enchant.resources.php                              18-Jun-2024 14:06                1505
enchant.setup.php                                  18-Jun-2024 14:06                1750
error.clone.php                                    18-Jun-2024 14:06                3194
error.construct.php                                18-Jun-2024 14:06                3877
error.getcode.php                                  18-Jun-2024 14:06                4334
error.getfile.php                                  18-Jun-2024 14:06                4103
error.getline.php                                  18-Jun-2024 14:06                4425
error.getmessage.php                               18-Jun-2024 14:06                4179
error.getprevious.php                              18-Jun-2024 14:06                7049
error.gettrace.php                                 18-Jun-2024 14:06                4639
error.gettraceasstring.php                         18-Jun-2024 14:06                4465
error.tostring.php                                 18-Jun-2024 14:06                4378
errorexception.construct.php                       18-Jun-2024 14:06                6692
errorexception.getseverity.php                     18-Jun-2024 14:06                4732
errorfunc.configuration.php                        18-Jun-2024 14:06               32254
errorfunc.constants.php                            18-Jun-2024 14:06               14916
errorfunc.examples.php                             18-Jun-2024 14:06               21161
errorfunc.installation.php                         18-Jun-2024 14:06                1455
errorfunc.requirements.php                         18-Jun-2024 14:06                1338
errorfunc.resources.php                            18-Jun-2024 14:06                1399
errorfunc.setup.php                                18-Jun-2024 14:06                1782
ev.backend.php                                     18-Jun-2024 14:06                3903
ev.configuration.php                               18-Jun-2024 14:06                1404
ev.depth.php                                       18-Jun-2024 14:06                3695
ev.embeddablebackends.php                          18-Jun-2024 14:06                7257
ev.examples.php                                    18-Jun-2024 14:06               45820
ev.feedsignal.php                                  18-Jun-2024 14:06                4003
ev.feedsignalevent.php                             18-Jun-2024 14:06                3544                            18-Jun-2024 14:06                1512
ev.installation.php                                18-Jun-2024 14:06                1963
ev.iteration.php                                   18-Jun-2024 14:06                3056                                         18-Jun-2024 14:06                3542
ev.nowupdate.php                                   18-Jun-2024 14:06                3702
ev.periodic-modes.php                              18-Jun-2024 14:06                9364
ev.recommendedbackends.php                         18-Jun-2024 14:06                8280
ev.requirements.php                                18-Jun-2024 14:06                1367
ev.resources.php                                   18-Jun-2024 14:06                1357
ev.resume.php                                      18-Jun-2024 14:06                4454                                         18-Jun-2024 14:06                6043
ev.setup.php                                       18-Jun-2024 14:06                1660
ev.sleep.php                                       18-Jun-2024 14:06                2672
ev.stop.php                                        18-Jun-2024 14:06                3199
ev.supportedbackends.php                           18-Jun-2024 14:06                7207
ev.suspend.php                                     18-Jun-2024 14:06                4107
ev.time.php                                        18-Jun-2024 14:06                3103
ev.verify.php                                      18-Jun-2024 14:06                2563
ev.watcher-callbacks.php                           18-Jun-2024 14:06                5435
ev.watchers.php                                    18-Jun-2024 14:06                4313
evcheck.construct.php                              18-Jun-2024 14:06                3875
evcheck.createstopped.php                          18-Jun-2024 14:06                4108
evchild.construct.php                              18-Jun-2024 14:06                7978
evchild.createstopped.php                          18-Jun-2024 14:06                5516
evchild.set.php                                    18-Jun-2024 14:06                3423
evembed.construct.php                              18-Jun-2024 14:06                9070
evembed.createstopped.php                          18-Jun-2024 14:06                5295
evembed.set.php                                    18-Jun-2024 14:06                2786
evembed.sweep.php                                  18-Jun-2024 14:06                3493
event.add.php                                      18-Jun-2024 14:06               11385
event.addsignal.php                                18-Jun-2024 14:06                1709
event.addtimer.php                                 18-Jun-2024 14:06                1718
event.callbacks.php                                18-Jun-2024 14:06                6426
event.configuration.php                            18-Jun-2024 14:06                1425
event.construct.php                                18-Jun-2024 14:06                5290               18-Jun-2024 14:06                6682
event.del.php                                      18-Jun-2024 14:06                3036
event.delsignal.php                                18-Jun-2024 14:06                1708
event.deltimer.php                                 18-Jun-2024 14:06                1705
event.examples.php                                 18-Jun-2024 14:06              170720
event.flags.php                                    18-Jun-2024 14:06                3287                                     18-Jun-2024 14:06                3503
event.getsupportedmethods.php                      18-Jun-2024 14:06                2903
event.installation.php                             18-Jun-2024 14:06                1986
event.pending.php                                  18-Jun-2024 14:06                3574
event.persistence.php                              18-Jun-2024 14:06                4091
event.requirements.php                             18-Jun-2024 14:06                1677
event.resources.php                                18-Jun-2024 14:06                1333
event.set.php                                      18-Jun-2024 14:06                5415
event.setpriority.php                              18-Jun-2024 14:06                2851
event.settimer.php                                 18-Jun-2024 14:06                4868
event.setup.php                                    18-Jun-2024 14:06                1699
event.signal.php                                   18-Jun-2024 14:06                5010
event.timer.php                                    18-Jun-2024 14:06                4260
eventbase.construct.php                            18-Jun-2024 14:06                3261
eventbase.dispatch.php                             18-Jun-2024 14:06                3776
eventbase.exit.php                                 18-Jun-2024 14:06                3583                                 18-Jun-2024 14:06                3852
eventbase.getfeatures.php                          18-Jun-2024 14:06                6207
eventbase.getmethod.php                            18-Jun-2024 14:06                5043
eventbase.gettimeofdaycached.php                   18-Jun-2024 14:06                3179
eventbase.gotexit.php                              18-Jun-2024 14:06                3797
eventbase.gotstop.php                              18-Jun-2024 14:06                3784
eventbase.loop.php                                 18-Jun-2024 14:06                4088
eventbase.priorityinit.php                         18-Jun-2024 14:06                3450
eventbase.reinit.php                               18-Jun-2024 14:06                2730
eventbase.stop.php                                 18-Jun-2024 14:06                3247
eventbuffer.add.php                                18-Jun-2024 14:06                3391
eventbuffer.addbuffer.php                          18-Jun-2024 14:06                3846
eventbuffer.appendfrom.php                         18-Jun-2024 14:06                5521
eventbuffer.construct.php                          18-Jun-2024 14:06                2073
eventbuffer.copyout.php                            18-Jun-2024 14:06                4426
eventbuffer.drain.php                              18-Jun-2024 14:06                3994
eventbuffer.enablelocking.php                      18-Jun-2024 14:06                3336
eventbuffer.expand.php                             18-Jun-2024 14:06                3283
eventbuffer.freeze.php                             18-Jun-2024 14:06                3606
eventbuffer.lock.php                               18-Jun-2024 14:06                3585
eventbuffer.prepend.php                            18-Jun-2024 14:06                3939
eventbuffer.prependbuffer.php                      18-Jun-2024 14:06                4130
eventbuffer.pullup.php                             18-Jun-2024 14:06                5492                               18-Jun-2024 14:06                5692
eventbuffer.readfrom.php                           18-Jun-2024 14:06                4932
eventbuffer.readline.php                           18-Jun-2024 14:06                4945                             18-Jun-2024 14:06                9200
eventbuffer.searcheol.php                          18-Jun-2024 14:06                5651
eventbuffer.substr.php                             18-Jun-2024 14:06                4011
eventbuffer.unfreeze.php                           18-Jun-2024 14:06                3593
eventbuffer.unlock.php                             18-Jun-2024 14:06                3170
eventbuffer.write.php                              18-Jun-2024 14:06                3924
eventbufferevent.about.callbacks.php               18-Jun-2024 14:06                6920
eventbufferevent.close.php                         18-Jun-2024 14:06                2923
eventbufferevent.connect.php                       18-Jun-2024 14:06               25401
eventbufferevent.connecthost.php                   18-Jun-2024 14:06               19296
eventbufferevent.construct.php                     18-Jun-2024 14:06                7796
eventbufferevent.createpair.php                    18-Jun-2024 14:06                4770
eventbufferevent.disable.php                       18-Jun-2024 14:06                3921
eventbufferevent.enable.php                        18-Jun-2024 14:06                4394                          18-Jun-2024 14:06                3362
eventbufferevent.getdnserrorstring.php             18-Jun-2024 14:06                3593
eventbufferevent.getenabled.php                    18-Jun-2024 14:06                3689
eventbufferevent.getinput.php                      18-Jun-2024 14:06                5556
eventbufferevent.getoutput.php                     18-Jun-2024 14:06                8639                          18-Jun-2024 14:06                3432
eventbufferevent.readbuffer.php                    18-Jun-2024 14:06                3559
eventbufferevent.setcallbacks.php                  18-Jun-2024 14:06                5151
eventbufferevent.setpriority.php                   18-Jun-2024 14:06                3284
eventbufferevent.settimeouts.php                   18-Jun-2024 14:06                3579
eventbufferevent.setwatermark.php                  18-Jun-2024 14:06                4789
eventbufferevent.sslerror.php                      18-Jun-2024 14:06                6550
eventbufferevent.sslfilter.php                     18-Jun-2024 14:06               35515
eventbufferevent.sslgetcipherinfo.php              18-Jun-2024 14:06                3321
eventbufferevent.sslgetciphername.php              18-Jun-2024 14:06                3162
eventbufferevent.sslgetcipherversion.php           18-Jun-2024 14:06                3244
eventbufferevent.sslgetprotocol.php                18-Jun-2024 14:06                3093
eventbufferevent.sslrenegotiate.php                18-Jun-2024 14:06                3348
eventbufferevent.sslsocket.php                     18-Jun-2024 14:06                6486
eventbufferevent.write.php                         18-Jun-2024 14:06                3617
eventbufferevent.writebuffer.php                   18-Jun-2024 14:06                3770
eventconfig.avoidmethod.php                        18-Jun-2024 14:06                4960
eventconfig.construct.php                          18-Jun-2024 14:06                4452
eventconfig.requirefeatures.php                    18-Jun-2024 14:06                6673
eventconfig.setflags.php                           18-Jun-2024 14:06                3871
eventconfig.setmaxdispatchinterval.php             18-Jun-2024 14:06                5478
eventdnsbase.addnameserverip.php                   18-Jun-2024 14:06                3254
eventdnsbase.addsearch.php                         18-Jun-2024 14:06                2817
eventdnsbase.clearsearch.php                       18-Jun-2024 14:06                3134
eventdnsbase.construct.php                         18-Jun-2024 14:06                8653
eventdnsbase.countnameservers.php                  18-Jun-2024 14:06                2964
eventdnsbase.loadhosts.php                         18-Jun-2024 14:06                3146
eventdnsbase.parseresolvconf.php                   18-Jun-2024 14:06                4881
eventdnsbase.setoption.php                         18-Jun-2024 14:06                3770
eventdnsbase.setsearchndots.php                    18-Jun-2024 14:06                3319
eventhttp.accept.php                               18-Jun-2024 14:06               13384
eventhttp.addserveralias.php                       18-Jun-2024 14:06                6910
eventhttp.bind.php                                 18-Jun-2024 14:06                8505
eventhttp.construct.php                            18-Jun-2024 14:06               18391
eventhttp.removeserveralias.php                    18-Jun-2024 14:06                3623
eventhttp.setallowedmethods.php                    18-Jun-2024 14:06                3888
eventhttp.setcallback.php                          18-Jun-2024 14:06               19249
eventhttp.setdefaultcallback.php                   18-Jun-2024 14:06                8603
eventhttp.setmaxbodysize.php                       18-Jun-2024 14:06                3288
eventhttp.setmaxheaderssize.php                    18-Jun-2024 14:06                3150
eventhttp.settimeout.php                           18-Jun-2024 14:06                2796
eventhttpconnection.construct.php                  18-Jun-2024 14:06                5527
eventhttpconnection.getbase.php                    18-Jun-2024 14:06                2929
eventhttpconnection.getpeer.php                    18-Jun-2024 14:06                3355
eventhttpconnection.makerequest.php                18-Jun-2024 14:06               12212
eventhttpconnection.setclosecallback.php           18-Jun-2024 14:06               10697
eventhttpconnection.setlocaladdress.php            18-Jun-2024 14:06                3601
eventhttpconnection.setlocalport.php               18-Jun-2024 14:06                3417
eventhttpconnection.setmaxbodysize.php             18-Jun-2024 14:06                3537
eventhttpconnection.setmaxheaderssize.php          18-Jun-2024 14:06                3572
eventhttpconnection.setretries.php                 18-Jun-2024 14:06                3136
eventhttpconnection.settimeout.php                 18-Jun-2024 14:06                2931
eventhttprequest.addheader.php                     18-Jun-2024 14:06                4348
eventhttprequest.cancel.php                        18-Jun-2024 14:06                3391
eventhttprequest.clearheaders.php                  18-Jun-2024 14:06                3132
eventhttprequest.closeconnection.php               18-Jun-2024 14:06                2633
eventhttprequest.construct.php                     18-Jun-2024 14:06               11857
eventhttprequest.findheader.php                    18-Jun-2024 14:06                3810                          18-Jun-2024 14:06                2580
eventhttprequest.getbufferevent.php                18-Jun-2024 14:06                4209
eventhttprequest.getcommand.php                    18-Jun-2024 14:06                2910
eventhttprequest.getconnection.php                 18-Jun-2024 14:06                5069
eventhttprequest.gethost.php                       18-Jun-2024 14:06                3102
eventhttprequest.getinputbuffer.php                18-Jun-2024 14:06                2989
eventhttprequest.getinputheaders.php               18-Jun-2024 14:06                3192
eventhttprequest.getoutputbuffer.php               18-Jun-2024 14:06                3050
eventhttprequest.getoutputheaders.php              18-Jun-2024 14:06                3094
eventhttprequest.getresponsecode.php               18-Jun-2024 14:06                3387
eventhttprequest.geturi.php                        18-Jun-2024 14:06                3302
eventhttprequest.removeheader.php                  18-Jun-2024 14:06                3768
eventhttprequest.senderror.php                     18-Jun-2024 14:06                6241
eventhttprequest.sendreply.php                     18-Jun-2024 14:06                4469
eventhttprequest.sendreplychunk.php                18-Jun-2024 14:06                3940
eventhttprequest.sendreplyend.php                  18-Jun-2024 14:06                3492
eventhttprequest.sendreplystart.php                18-Jun-2024 14:06                4992
eventlistener.construct.php                        18-Jun-2024 14:06               24099
eventlistener.disable.php                          18-Jun-2024 14:06                3200
eventlistener.enable.php                           18-Jun-2024 14:06                3185
eventlistener.getbase.php                          18-Jun-2024 14:06                2601
eventlistener.getsocketname.php                    18-Jun-2024 14:06                3732
eventlistener.setcallback.php                      18-Jun-2024 14:06                6511
eventlistener.seterrorcallback.php                 18-Jun-2024 14:06                4737
eventsslcontext.construct.php                      18-Jun-2024 14:06                5628
eventutil.construct.php                            18-Jun-2024 14:06                2305
eventutil.getlastsocketerrno.php                   18-Jun-2024 14:06                3649
eventutil.getlastsocketerror.php                   18-Jun-2024 14:06                3455
eventutil.getsocketfd.php                          18-Jun-2024 14:06                3613
eventutil.getsocketname.php                        18-Jun-2024 14:06                4177
eventutil.setsocketoption.php                      18-Jun-2024 14:06                6370
eventutil.sslrandpoll.php                          18-Jun-2024 14:06                2666
evfork.construct.php                               18-Jun-2024 14:06                3974
evfork.createstopped.php                           18-Jun-2024 14:06                4324
evidle.construct.php                               18-Jun-2024 14:06                4036
evidle.createstopped.php                           18-Jun-2024 14:06                4618
evio.construct.php                                 18-Jun-2024 14:06                5291
evio.createstopped.php                             18-Jun-2024 14:06                5646
evio.set.php                                       18-Jun-2024 14:06                3062
evloop.backend.php                                 18-Jun-2024 14:06                3038
evloop.check.php                                   18-Jun-2024 14:06                3577
evloop.child.php                                   18-Jun-2024 14:06                4050
evloop.construct.php                               18-Jun-2024 14:06                4319
evloop.defaultloop.php                             18-Jun-2024 14:06                5134
evloop.embed.php                                   18-Jun-2024 14:06                4092
evloop.fork.php                                    18-Jun-2024 14:06                3697
evloop.idle.php                                    18-Jun-2024 14:06                3713
evloop.invokepending.php                           18-Jun-2024 14:06                2550                                      18-Jun-2024 14:06                4166
evloop.loopfork.php                                18-Jun-2024 14:06                3011                                     18-Jun-2024 14:06                3323
evloop.nowupdate.php                               18-Jun-2024 14:06                3588
evloop.periodic.php                                18-Jun-2024 14:06                4310
evloop.prepare.php                                 18-Jun-2024 14:06                3719
evloop.resume.php                                  18-Jun-2024 14:06                3226                                     18-Jun-2024 14:06                5969
evloop.signal.php                                  18-Jun-2024 14:06                4039
evloop.stat.php                                    18-Jun-2024 14:06                4221
evloop.stop.php                                    18-Jun-2024 14:06                3293
evloop.suspend.php                                 18-Jun-2024 14:06                3167
evloop.timer.php                                   18-Jun-2024 14:06                4236
evloop.verify.php                                  18-Jun-2024 14:06                2990
evperiodic.again.php                               18-Jun-2024 14:06                2929                                  18-Jun-2024 14:06                3027
evperiodic.construct.php                           18-Jun-2024 14:06               10993
evperiodic.createstopped.php                       18-Jun-2024 14:06                6591
evperiodic.set.php                                 18-Jun-2024 14:06                3555
evprepare.construct.php                            18-Jun-2024 14:06                3692
evprepare.createstopped.php                        18-Jun-2024 14:06                4700
evsignal.construct.php                             18-Jun-2024 14:06                5936
evsignal.createstopped.php                         18-Jun-2024 14:06                5320
evsignal.set.php                                   18-Jun-2024 14:06                2714
evstat.attr.php                                    18-Jun-2024 14:06                9158
evstat.construct.php                               18-Jun-2024 14:06                7792
evstat.createstopped.php                           18-Jun-2024 14:06                5819
evstat.prev.php                                    18-Jun-2024 14:06                3290
evstat.set.php                                     18-Jun-2024 14:06                3182
evstat.stat.php                                    18-Jun-2024 14:06                3406
evtimer.again.php                                  18-Jun-2024 14:06                3668
evtimer.construct.php                              18-Jun-2024 14:06               14729
evtimer.createstopped.php                          18-Jun-2024 14:06                9228
evtimer.set.php                                    18-Jun-2024 14:06                3459
evwatcher.clear.php                                18-Jun-2024 14:06                3491
evwatcher.construct.php                            18-Jun-2024 14:06                2323
evwatcher.feed.php                                 18-Jun-2024 14:06                2910
evwatcher.getloop.php                              18-Jun-2024 14:06                2542
evwatcher.invoke.php                               18-Jun-2024 14:06                2957
evwatcher.keepalive.php                            18-Jun-2024 14:06                6009
evwatcher.setcallback.php                          18-Jun-2024 14:06                2886
evwatcher.start.php                                18-Jun-2024 14:06                2876
evwatcher.stop.php                                 18-Jun-2024 14:06                2847
example.xml-external-entity.php                    18-Jun-2024 14:06               22359
example.xml-map-tags.php                           18-Jun-2024 14:06                8547
example.xml-structure.php                          18-Jun-2024 14:06                6470
example.xmlwriter-namespace.php                    18-Jun-2024 14:06                5722
example.xmlwriter-oop.php                          18-Jun-2024 14:06                3709
example.xmlwriter-simple.php                       18-Jun-2024 14:06                8977
exception.clone.php                                18-Jun-2024 14:06                3448
exception.construct.php                            18-Jun-2024 14:06                4112
exception.getcode.php                              18-Jun-2024 14:06                4988
exception.getfile.php                              18-Jun-2024 14:06                4219
exception.getline.php                              18-Jun-2024 14:06                4565
exception.getmessage.php                           18-Jun-2024 14:06                4344
exception.getprevious.php                          18-Jun-2024 14:06                7346
exception.gettrace.php                             18-Jun-2024 14:06                4776
exception.gettraceasstring.php                     18-Jun-2024 14:06                4601
exception.tostring.php                             18-Jun-2024 14:06                4552
exec.configuration.php                             18-Jun-2024 14:06                1418
exec.constants.php                                 18-Jun-2024 14:06                1350
exec.installation.php                              18-Jun-2024 14:06                1420
exec.requirements.php                              18-Jun-2024 14:06                1303
exec.resources.php                                 18-Jun-2024 14:06                1507
exec.setup.php                                     18-Jun-2024 14:06                1733
exif.configuration.php                             18-Jun-2024 14:06                9393
exif.constants.php                                 18-Jun-2024 14:06                2345
exif.installation.php                              18-Jun-2024 14:06                1909
exif.requirements.php                              18-Jun-2024 14:06                2107
exif.resources.php                                 18-Jun-2024 14:06                1364
exif.setup.php                                     18-Jun-2024 14:06                1717
expect.configuration.php                           18-Jun-2024 14:06                6407
expect.constants.php                               18-Jun-2024 14:06                4425
expect.examples-usage.php                          18-Jun-2024 14:06               12806
expect.examples.php                                18-Jun-2024 14:06                1527
expect.installation.php                            18-Jun-2024 14:06                2661
expect.requirements.php                            18-Jun-2024 14:06                1454
expect.resources.php                               18-Jun-2024 14:06                1574
expect.setup.php                                   18-Jun-2024 14:06                1742
extensions.alphabetical.php                        18-Jun-2024 14:07               21366
extensions.membership.php                          18-Jun-2024 14:07               21408
extensions.php                                     18-Jun-2024 14:07                1958
extensions.state.php                               18-Jun-2024 14:07                3186
fann.configuration.php                             18-Jun-2024 14:06                1418
fann.constants.php                                 18-Jun-2024 14:06               28059
fann.examples-1.php                                18-Jun-2024 14:06                8803
fann.examples.php                                  18-Jun-2024 14:06                1443
fann.installation.php                              18-Jun-2024 14:06                6073
fann.requirements.php                              18-Jun-2024 14:06                1252
fann.resources.php                                 18-Jun-2024 14:06                1268
fann.setup.php                                     18-Jun-2024 14:06                1690
fannconnection.construct.php                       18-Jun-2024 14:06                3165
fannconnection.getfromneuron.php                   18-Jun-2024 14:06                2555
fannconnection.gettoneuron.php                     18-Jun-2024 14:06                2527
fannconnection.getweight.php                       18-Jun-2024 14:06                2409
fannconnection.setweight.php                       18-Jun-2024 14:06                3152                                      18-Jun-2024 14:06               29687                                        18-Jun-2024 14:06               15499
faq.databases.php                                  18-Jun-2024 14:06               10343
faq.general.php                                    18-Jun-2024 14:06                6095
faq.html.php                                       18-Jun-2024 14:06               24530
faq.installation.php                               18-Jun-2024 14:06               31616
faq.mailinglist.php                                18-Jun-2024 14:06               14236
faq.misc.php                                       18-Jun-2024 14:06                5660
faq.obtaining.php                                  18-Jun-2024 14:06               12460
faq.passwords.php                                  18-Jun-2024 14:06               13895
faq.php                                            18-Jun-2024 14:06                2341
faq.using.php                                      18-Jun-2024 14:06               28021
fdf.configuration.php                              18-Jun-2024 14:06                1411
fdf.constants.php                                  18-Jun-2024 14:06                9363
fdf.examples.php                                   18-Jun-2024 14:06                6336
fdf.installation.php                               18-Jun-2024 14:06                4230
fdf.requirements.php                               18-Jun-2024 14:06                1734
fdf.resources.php                                  18-Jun-2024 14:06                1937
fdf.setup.php                                      18-Jun-2024 14:06                1698
features.commandline.differences.php               18-Jun-2024 14:06               14930
features.commandline.ini.php                       18-Jun-2024 14:06                2540
features.commandline.interactive.php               18-Jun-2024 14:06               11244                18-Jun-2024 14:06                6968
features.commandline.options.php                   18-Jun-2024 14:06               31436
features.commandline.php                           18-Jun-2024 14:06                9708
features.commandline.usage.php                     18-Jun-2024 14:06               18167
features.commandline.webserver.php                 18-Jun-2024 14:06               15971
features.connection-handling.php                   18-Jun-2024 14:06                7981
features.cookies.php                               18-Jun-2024 14:06                3791
features.dtrace.dtrace.php                         18-Jun-2024 14:06               16547
features.dtrace.introduction.php                   18-Jun-2024 14:06                4886
features.dtrace.php                                18-Jun-2024 14:06                1855
features.dtrace.systemtap.php                      18-Jun-2024 14:06                8645
features.file-upload.common-pitfalls.php           18-Jun-2024 14:06                7592
features.file-upload.errors.php                    18-Jun-2024 14:06                4658
features.file-upload.errors.seealso.php            18-Jun-2024 14:06                1502
features.file-upload.multiple.php                  18-Jun-2024 14:06                8147
features.file-upload.php                           18-Jun-2024 14:06                2160               18-Jun-2024 14:06               20477
features.file-upload.put-method.php                18-Jun-2024 14:06                7307
features.gc.collecting-cycles.php                  18-Jun-2024 14:06               10513
features.gc.performance-considerations.php         18-Jun-2024 14:06               16647
features.gc.php                                    18-Jun-2024 14:06                2001
features.gc.refcounting-basics.php                 18-Jun-2024 14:06               25160
features.http-auth.php                             18-Jun-2024 14:06               26411
features.persistent-connections.php                18-Jun-2024 14:06               14492
features.php                                       18-Jun-2024 14:06                4702
features.remote-files.php                          18-Jun-2024 14:06                9700           18-Jun-2024 14:06               36435
features.sessions.php                              18-Jun-2024 14:06                1677
features.xforms.php                                18-Jun-2024 14:06                7000
ffi-ctype.getalignment.php                         18-Jun-2024 14:06                2531
ffi-ctype.getarrayelementtype.php                  18-Jun-2024 14:06                2617
ffi-ctype.getarraylength.php                       18-Jun-2024 14:06                2574
ffi-ctype.getattributes.php                        18-Jun-2024 14:06                2550
ffi-ctype.getenumkind.php                          18-Jun-2024 14:06                2526
ffi-ctype.getfuncabi.php                           18-Jun-2024 14:06                2534
ffi-ctype.getfuncparametercount.php                18-Jun-2024 14:06                2640
ffi-ctype.getfuncparametertype.php                 18-Jun-2024 14:06                2851
ffi-ctype.getfuncreturntype.php                    18-Jun-2024 14:06                2599
ffi-ctype.getkind.php                              18-Jun-2024 14:06                2488
ffi-ctype.getname.php                              18-Jun-2024 14:06                2494
ffi-ctype.getpointertype.php                       18-Jun-2024 14:06                2543
ffi-ctype.getsize.php                              18-Jun-2024 14:06                2506
ffi-ctype.getstructfieldnames.php                  18-Jun-2024 14:06                2616
ffi-ctype.getstructfieldoffset.php                 18-Jun-2024 14:06                2847
ffi-ctype.getstructfieldtype.php                   18-Jun-2024 14:06                2809
ffi.addr.php                                       18-Jun-2024 14:06                3175
ffi.alignof.php                                    18-Jun-2024 14:06                3167
ffi.arraytype.php                                  18-Jun-2024 14:06                4887
ffi.cast.php                                       18-Jun-2024 14:06                5224
ffi.cdef.php                                       18-Jun-2024 14:06                5147
ffi.configuration.php                              18-Jun-2024 14:06                5115
ffi.constants.php                                  18-Jun-2024 14:06                1288
ffi.examples-basic.php                             18-Jun-2024 14:06               17195
ffi.examples-callback.php                          18-Jun-2024 14:06                5466
ffi.examples-complete.php                          18-Jun-2024 14:06                5415
ffi.examples.php                                   18-Jun-2024 14:06                1706                                       18-Jun-2024 14:06                2710
ffi.installation.php                               18-Jun-2024 14:06                1583
ffi.isnull.php                                     18-Jun-2024 14:06                2966
ffi.load.php                                       18-Jun-2024 14:06                5300
ffi.memcmp.php                                     18-Jun-2024 14:06                4571
ffi.memcpy.php                                     18-Jun-2024 14:06                3608
ffi.memset.php                                     18-Jun-2024 14:06                3402                                        18-Jun-2024 14:06                5932
ffi.requirements.php                               18-Jun-2024 14:06                1390
ffi.resources.php                                  18-Jun-2024 14:06                1357
ffi.scope.php                                      18-Jun-2024 14:06                3709
ffi.setup.php                                      18-Jun-2024 14:06                1688
ffi.sizeof.php                                     18-Jun-2024 14:06                2963
ffi.string.php                                     18-Jun-2024 14:06                4411
ffi.type.php                                       18-Jun-2024 14:06                3898
ffi.typeof.php                                     18-Jun-2024 14:06                3004
fiber.construct.php                                18-Jun-2024 14:06                2555
fiber.getcurrent.php                               18-Jun-2024 14:06                2728
fiber.getreturn.php                                18-Jun-2024 14:06                2912
fiber.isrunning.php                                18-Jun-2024 14:06                2979
fiber.isstarted.php                                18-Jun-2024 14:06                2549
fiber.issuspended.php                              18-Jun-2024 14:06                2580
fiber.isterminated.php                             18-Jun-2024 14:06                2658
fiber.resume.php                                   18-Jun-2024 14:06                3821
fiber.start.php                                    18-Jun-2024 14:06                3515
fiber.suspend.php                                  18-Jun-2024 14:06                4612
fiber.throw.php                                    18-Jun-2024 14:06                3652
fileinfo.configuration.php                         18-Jun-2024 14:06                1446
fileinfo.constants.php                             18-Jun-2024 14:06                7365
fileinfo.installation.php                          18-Jun-2024 14:06                2185
fileinfo.requirements.php                          18-Jun-2024 14:06                1331
fileinfo.resources.php                             18-Jun-2024 14:06                1599
fileinfo.setup.php                                 18-Jun-2024 14:06                1763
filesystem.configuration.php                       18-Jun-2024 14:06                9123
filesystem.constants.php                           18-Jun-2024 14:06               15095
filesystem.installation.php                        18-Jun-2024 14:06                1462
filesystem.requirements.php                        18-Jun-2024 14:06                1345
filesystem.resources.php                           18-Jun-2024 14:06                1675
filesystem.setup.php                               18-Jun-2024 14:06                1810
filesystemiterator.construct.php                   18-Jun-2024 14:06                8583
filesystemiterator.current.php                     18-Jun-2024 14:06                5933
filesystemiterator.getflags.php                    18-Jun-2024 14:06                3591
filesystemiterator.key.php                         18-Jun-2024 14:06                5588                        18-Jun-2024 14:06                4933
filesystemiterator.rewind.php                      18-Jun-2024 14:06                5510
filesystemiterator.setflags.php                    18-Jun-2024 14:06                7286
filter.configuration.php                           18-Jun-2024 14:06                6270
filter.constants.php                               18-Jun-2024 14:06               27622
filter.examples.php                                18-Jun-2024 14:06                1617
filter.examples.sanitization.php                   18-Jun-2024 14:06                6093
filter.examples.validation.php                     18-Jun-2024 14:06               10708
filter.filters.flags.php                           18-Jun-2024 14:06               18684
filter.filters.misc.php                            18-Jun-2024 14:06                2227
filter.filters.php                                 18-Jun-2024 14:06                1791
filter.filters.sanitize.php                        18-Jun-2024 14:06               15415
filter.filters.validate.php                        18-Jun-2024 14:06               16506
filter.installation.php                            18-Jun-2024 14:06                1455
filter.requirements.php                            18-Jun-2024 14:06                1317
filter.resources.php                               18-Jun-2024 14:06                1350
filter.setup.php                                   18-Jun-2024 14:06                1727
filteriterator.accept.php                          18-Jun-2024 14:06                5760
filteriterator.construct.php                       18-Jun-2024 14:06                3397
filteriterator.current.php                         18-Jun-2024 14:06                3334
filteriterator.key.php                             18-Jun-2024 14:06                3240                            18-Jun-2024 14:06                3346
filteriterator.rewind.php                          18-Jun-2024 14:06                3539
filteriterator.valid.php                           18-Jun-2024 14:06                3162
filters.compression.php                            18-Jun-2024 14:07               18870
filters.convert.php                                18-Jun-2024 14:07               12806
filters.encryption.php                             18-Jun-2024 14:07               41656
filters.php                                        18-Jun-2024 14:07                4518
filters.string.php                                 18-Jun-2024 14:07               10879
finfo.buffer.php                                   18-Jun-2024 14:06                2924
finfo.construct.php                                18-Jun-2024 14:06                3164
finfo.file.php                                     18-Jun-2024 14:06                2915
finfo.set-flags.php                                18-Jun-2024 14:06                2149
fpm.observability.php                              18-Jun-2024 14:06                1531
fpm.setup.php                                      18-Jun-2024 14:06                1439
fpm.status.php                                     18-Jun-2024 14:06               14163
ftp.configuration.php                              18-Jun-2024 14:06                1411
ftp.constants.php                                  18-Jun-2024 14:06                5901
ftp.examples-basic.php                             18-Jun-2024 14:06                5313
ftp.examples.php                                   18-Jun-2024 14:06                1483
ftp.installation.php                               18-Jun-2024 14:06                1629
ftp.requirements.php                               18-Jun-2024 14:06                1296
ftp.resources.php                                  18-Jun-2024 14:06                1685
ftp.setup.php                                      18-Jun-2024 14:06                1698
funchand.configuration.php                         18-Jun-2024 14:06                1446
funchand.constants.php                             18-Jun-2024 14:06                1394
funchand.installation.php                          18-Jun-2024 14:06                1448
funchand.requirements.php                          18-Jun-2024 14:06                1331
funchand.resources.php                             18-Jun-2024 14:06                1392
funchand.setup.php                                 18-Jun-2024 14:06                1773
funcref.php                                        18-Jun-2024 14:06               16645
function.abs.php                                   18-Jun-2024 14:06                6401
function.acos.php                                  18-Jun-2024 14:06                4011
function.acosh.php                                 18-Jun-2024 14:06                3732
function.addcslashes.php                           18-Jun-2024 14:06                9321
function.addslashes.php                            18-Jun-2024 14:06                7335
function.apache-child-terminate.php                18-Jun-2024 14:06                4051
function.apache-get-modules.php                    18-Jun-2024 14:06                3750
function.apache-get-version.php                    18-Jun-2024 14:06                4223
function.apache-getenv.php                         18-Jun-2024 14:06                5977
function.apache-lookup-uri.php                     18-Jun-2024 14:06                6312
function.apache-note.php                           18-Jun-2024 14:06                8320
function.apache-request-headers.php                18-Jun-2024 14:06                6505
function.apache-response-headers.php               18-Jun-2024 14:06                4885
function.apache-setenv.php                         18-Jun-2024 14:06                6617
function.apcu-add.php                              18-Jun-2024 14:06                9689
function.apcu-cache-info.php                       18-Jun-2024 14:06                7515
function.apcu-cas.php                              18-Jun-2024 14:06                9199
function.apcu-clear-cache.php                      18-Jun-2024 14:06                2808
function.apcu-dec.php                              18-Jun-2024 14:06                9147
function.apcu-delete.php                           18-Jun-2024 14:06                6494
function.apcu-enabled.php                          18-Jun-2024 14:06                2638
function.apcu-entry.php                            18-Jun-2024 14:06                9811
function.apcu-exists.php                           18-Jun-2024 14:06                7250
function.apcu-fetch.php                            18-Jun-2024 14:06                6533
function.apcu-inc.php                              18-Jun-2024 14:06                9146
function.apcu-key-info.php                         18-Jun-2024 14:06                5409
function.apcu-sma-info.php                         18-Jun-2024 14:06                5078
function.apcu-store.php                            18-Jun-2024 14:06                8395
function.array-change-key-case.php                 18-Jun-2024 14:06                6170
function.array-chunk.php                           18-Jun-2024 14:06                8754
function.array-column.php                          18-Jun-2024 14:06               19155
function.array-combine.php                         18-Jun-2024 14:06                8438
function.array-count-values.php                    18-Jun-2024 14:06                7029
function.array-diff-assoc.php                      18-Jun-2024 14:06               13201
function.array-diff-key.php                        18-Jun-2024 14:06               14513
function.array-diff-uassoc.php                     18-Jun-2024 14:06               14614
function.array-diff-ukey.php                       18-Jun-2024 14:06               14342
function.array-diff.php                            18-Jun-2024 14:06               13769
function.array-fill-keys.php                       18-Jun-2024 14:06                6026
function.array-fill.php                            18-Jun-2024 14:06               10751
function.array-filter.php                          18-Jun-2024 14:06               18541
function.array-flip.php                            18-Jun-2024 14:06                8286
function.array-intersect-assoc.php                 18-Jun-2024 14:06               10490
function.array-intersect-key.php                   18-Jun-2024 14:06               11894
function.array-intersect-uassoc.php                18-Jun-2024 14:06               10553
function.array-intersect-ukey.php                  18-Jun-2024 14:06               13981
function.array-intersect.php                       18-Jun-2024 14:06                7987
function.array-is-list.php                         18-Jun-2024 14:06                7756
function.array-key-exists.php                      18-Jun-2024 14:06               11445
function.array-key-first.php                       18-Jun-2024 14:06                7913
function.array-key-last.php                        18-Jun-2024 14:06                3776
function.array-keys.php                            18-Jun-2024 14:06                9401
function.array-map.php                             18-Jun-2024 14:06               30435
function.array-merge-recursive.php                 18-Jun-2024 14:06                8077
function.array-merge.php                           18-Jun-2024 14:06               14226
function.array-multisort.php                       18-Jun-2024 14:06               27641
function.array-pad.php                             18-Jun-2024 14:06                8607
function.array-pop.php                             18-Jun-2024 14:06                6259
function.array-product.php                         18-Jun-2024 14:06                6611
function.array-push.php                            18-Jun-2024 14:06                8151
function.array-rand.php                            18-Jun-2024 14:06               11488
function.array-reduce.php                          18-Jun-2024 14:06               11099
function.array-replace-recursive.php               18-Jun-2024 14:06               12629
function.array-replace.php                         18-Jun-2024 14:06                8098
function.array-reverse.php                         18-Jun-2024 14:06                6771
function.array-search.php                          18-Jun-2024 14:06                9797
function.array-shift.php                           18-Jun-2024 14:06                6428
function.array-slice.php                           18-Jun-2024 14:06               15690
function.array-splice.php                          18-Jun-2024 14:06               19888
function.array-sum.php                             18-Jun-2024 14:06                7280
function.array-udiff-assoc.php                     18-Jun-2024 14:06               20465
function.array-udiff-uassoc.php                    18-Jun-2024 14:06               21903
function.array-udiff.php                           18-Jun-2024 14:06               33085
function.array-uintersect-assoc.php                18-Jun-2024 14:06               13717
function.array-uintersect-uassoc.php               18-Jun-2024 14:06               14179
function.array-uintersect.php                      18-Jun-2024 14:06               13122
function.array-unique.php                          18-Jun-2024 14:06               11324
function.array-unshift.php                         18-Jun-2024 14:06               12164
function.array-values.php                          18-Jun-2024 14:06                5088
function.array-walk-recursive.php                  18-Jun-2024 14:06                8692
function.array-walk.php                            18-Jun-2024 14:06               15915
function.array.php                                 18-Jun-2024 14:06               13690
function.arsort.php                                18-Jun-2024 14:06               10969
function.asin.php                                  18-Jun-2024 14:06                3991
function.asinh.php                                 18-Jun-2024 14:06                3714
function.asort.php                                 18-Jun-2024 14:06               10946
function.assert-options.php                        18-Jun-2024 14:06               15948
function.assert.php                                18-Jun-2024 14:06               27301
function.atan.php                                  18-Jun-2024 14:06                3999
function.atan2.php                                 18-Jun-2024 14:06                3848
function.atanh.php                                 18-Jun-2024 14:06                3779
function.autoload.php                              18-Jun-2024 14:06                3709
function.base-convert.php                          18-Jun-2024 14:06                8154
function.base64-decode.php                         18-Jun-2024 14:06                5815
function.base64-encode.php                         18-Jun-2024 14:06                5492
function.basename.php                              18-Jun-2024 14:06                8660
function.bcadd.php                                 18-Jun-2024 14:06                6408
function.bccomp.php                                18-Jun-2024 14:06                6190
function.bcdiv.php                                 18-Jun-2024 14:06                5954
function.bcmod.php                                 18-Jun-2024 14:06                8148
function.bcmul.php                                 18-Jun-2024 14:06                8147
function.bcpow.php                                 18-Jun-2024 14:06                8311
function.bcpowmod.php                              18-Jun-2024 14:06                8393
function.bcscale.php                               18-Jun-2024 14:06                6315
function.bcsqrt.php                                18-Jun-2024 14:06                7417
function.bcsub.php                                 18-Jun-2024 14:06                6395
function.bin2hex.php                               18-Jun-2024 14:06                5145
function.bind-textdomain-codeset.php               18-Jun-2024 14:06                5090
function.bindec.php                                18-Jun-2024 14:06               17636
function.bindtextdomain.php                        18-Jun-2024 14:06                6160
function.boolval.php                               18-Jun-2024 14:06               11005
function.bzclose.php                               18-Jun-2024 14:06                3432
function.bzcompress.php                            18-Jun-2024 14:06                5879
function.bzdecompress.php                          18-Jun-2024 14:06                7259
function.bzerrno.php                               18-Jun-2024 14:06                3515
function.bzerror.php                               18-Jun-2024 14:06                4826
function.bzerrstr.php                              18-Jun-2024 14:06                3533
function.bzflush.php                               18-Jun-2024 14:06                3883
function.bzopen.php                                18-Jun-2024 14:06                5635
function.bzread.php                                18-Jun-2024 14:06                7196
function.bzwrite.php                               18-Jun-2024 14:06                7013                     18-Jun-2024 14:06                5034                           18-Jun-2024 14:06                8338                              18-Jun-2024 14:06                6698                             18-Jun-2024 14:06                7279                  18-Jun-2024 14:06               19489                        18-Jun-2024 14:06               15929
function.ceil.php                                  18-Jun-2024 14:06                6102
function.chdir.php                                 18-Jun-2024 14:06                6469
function.checkdate.php                             18-Jun-2024 14:06                6418
function.checkdnsrr.php                            18-Jun-2024 14:06                6014
function.chgrp.php                                 18-Jun-2024 14:06                7488
function.chmod.php                                 18-Jun-2024 14:06               10956
function.chop.php                                  18-Jun-2024 14:06                2246
function.chown.php                                 18-Jun-2024 14:06                7735
function.chr.php                                   18-Jun-2024 14:06               10540
function.chroot.php                                18-Jun-2024 14:06                5529
function.chunk-split.php                           18-Jun-2024 14:06                5891
function.class-alias.php                           18-Jun-2024 14:06               10168
function.class-exists.php                          18-Jun-2024 14:06                7722
function.class-implements.php                      18-Jun-2024 14:06                8258
function.class-parents.php                         18-Jun-2024 14:06                7898
function.class-uses.php                            18-Jun-2024 14:06                7133
function.clearstatcache.php                        18-Jun-2024 14:06               12286
function.cli-get-process-title.php                 18-Jun-2024 14:06                5175
function.cli-set-process-title.php                 18-Jun-2024 14:06                6245
function.closedir.php                              18-Jun-2024 14:06                5521
function.closelog.php                              18-Jun-2024 14:06                3297                       18-Jun-2024 14:06                3219                        18-Jun-2024 14:06               11606                 18-Jun-2024 14:06                6624                      18-Jun-2024 14:06                6401                      18-Jun-2024 14:06                4902                    18-Jun-2024 14:06                5971
function.commonmark-parse.php                      18-Jun-2024 14:06                4336
function.commonmark-render-html.php                18-Jun-2024 14:06                4871
function.commonmark-render-latex.php               18-Jun-2024 14:06                5195
function.commonmark-render-man.php                 18-Jun-2024 14:06                5177
function.commonmark-render-xml.php                 18-Jun-2024 14:06                4828
function.commonmark-render.php                     18-Jun-2024 14:06                5123
function.compact.php                               18-Jun-2024 14:06                9884
function.connection-aborted.php                    18-Jun-2024 14:06                3441
function.connection-status.php                     18-Jun-2024 14:06                3694
function.constant.php                              18-Jun-2024 14:06               10273
function.convert-cyr-string.php                    18-Jun-2024 14:06                5816
function.convert-uudecode.php                      18-Jun-2024 14:06                5160
function.convert-uuencode.php                      18-Jun-2024 14:06                6319
function.copy.php                                  18-Jun-2024 14:06                6866
function.cos.php                                   18-Jun-2024 14:06                4367
function.cosh.php                                  18-Jun-2024 14:06                3642
function.count-chars.php                           18-Jun-2024 14:06                8767
function.count.php                                 18-Jun-2024 14:06               18760
function.crc32.php                                 18-Jun-2024 14:06                8494
function.create-function.php                       18-Jun-2024 14:06               34482
function.crypt.php                                 18-Jun-2024 14:06               17173
function.ctype-alnum.php                           18-Jun-2024 14:06                8027
function.ctype-alpha.php                           18-Jun-2024 14:06                8658
function.ctype-cntrl.php                           18-Jun-2024 14:06                8150
function.ctype-digit.php                           18-Jun-2024 14:06               10289
function.ctype-graph.php                           18-Jun-2024 14:06                8867
function.ctype-lower.php                           18-Jun-2024 14:06                8260
function.ctype-print.php                           18-Jun-2024 14:06                8956
function.ctype-punct.php                           18-Jun-2024 14:06                8182
function.ctype-space.php                           18-Jun-2024 14:06                9113
function.ctype-upper.php                           18-Jun-2024 14:06                8348
function.ctype-xdigit.php                          18-Jun-2024 14:06                7988
function.cubrid-affected-rows.php                  18-Jun-2024 14:06               10446
function.cubrid-bind.php                           18-Jun-2024 14:06               22093
function.cubrid-client-encoding.php                18-Jun-2024 14:06                5873
function.cubrid-close-prepare.php                  18-Jun-2024 14:06                6626
function.cubrid-close-request.php                  18-Jun-2024 14:06                6633
function.cubrid-close.php                          18-Jun-2024 14:06                7050
function.cubrid-col-get.php                        18-Jun-2024 14:06                9130
function.cubrid-col-size.php                       18-Jun-2024 14:06                9264
function.cubrid-column-names.php                   18-Jun-2024 14:06                9002
function.cubrid-column-types.php                   18-Jun-2024 14:06                8968
function.cubrid-commit.php                         18-Jun-2024 14:06               16147
function.cubrid-connect-with-url.php               18-Jun-2024 14:06               17466
function.cubrid-connect.php                        18-Jun-2024 14:06               13541
function.cubrid-current-oid.php                    18-Jun-2024 14:06                6516
function.cubrid-data-seek.php                      18-Jun-2024 14:06                8098
function.cubrid-db-name.php                        18-Jun-2024 14:06                7187
function.cubrid-disconnect.php                     18-Jun-2024 14:06                7779
function.cubrid-drop.php                           18-Jun-2024 14:06               11887
function.cubrid-errno.php                          18-Jun-2024 14:06                7385
function.cubrid-error-code-facility.php            18-Jun-2024 14:06                6201
function.cubrid-error-code.php                     18-Jun-2024 14:06                6212
function.cubrid-error-msg.php                      18-Jun-2024 14:06                5657
function.cubrid-error.php                          18-Jun-2024 14:06                6912
function.cubrid-execute.php                        18-Jun-2024 14:06               16173
function.cubrid-fetch-array.php                    18-Jun-2024 14:06               11179
function.cubrid-fetch-assoc.php                    18-Jun-2024 14:06               10444
function.cubrid-fetch-field.php                    18-Jun-2024 14:06               15727
function.cubrid-fetch-lengths.php                  18-Jun-2024 14:06                6685
function.cubrid-fetch-object.php                   18-Jun-2024 14:06               13150
function.cubrid-fetch-row.php                      18-Jun-2024 14:06               10388
function.cubrid-fetch.php                          18-Jun-2024 14:06               11445
function.cubrid-field-flags.php                    18-Jun-2024 14:06                8638
function.cubrid-field-len.php                      18-Jun-2024 14:06                9165
function.cubrid-field-name.php                     18-Jun-2024 14:06                7908
function.cubrid-field-seek.php                     18-Jun-2024 14:06               12482
function.cubrid-field-table.php                    18-Jun-2024 14:06                8285
function.cubrid-field-type.php                     18-Jun-2024 14:06                8185
function.cubrid-free-result.php                    18-Jun-2024 14:06                6625
function.cubrid-get-autocommit.php                 18-Jun-2024 14:06                4293
function.cubrid-get-charset.php                    18-Jun-2024 14:06                5494
function.cubrid-get-class-name.php                 18-Jun-2024 14:06                6884
function.cubrid-get-client-info.php                18-Jun-2024 14:06                8683
function.cubrid-get-db-parameter.php               18-Jun-2024 14:06               17193
function.cubrid-get-query-timeout.php              18-Jun-2024 14:06                7218
function.cubrid-get-server-info.php                18-Jun-2024 14:06                8931
function.cubrid-get.php                            18-Jun-2024 14:06               10848
function.cubrid-insert-id.php                      18-Jun-2024 14:06                8213
function.cubrid-is-instance.php                    18-Jun-2024 14:06                7928
function.cubrid-list-dbs.php                       18-Jun-2024 14:06                4922
function.cubrid-load-from-glo.php                  18-Jun-2024 14:06                7565
function.cubrid-lob-close.php                      18-Jun-2024 14:06                7793
function.cubrid-lob-export.php                     18-Jun-2024 14:06                8505
function.cubrid-lob-get.php                        18-Jun-2024 14:06                8371
function.cubrid-lob-send.php                       18-Jun-2024 14:06                7579
function.cubrid-lob-size.php                       18-Jun-2024 14:06                6378
function.cubrid-lob2-bind.php                      18-Jun-2024 14:06               10647
function.cubrid-lob2-close.php                     18-Jun-2024 14:06                3883
function.cubrid-lob2-export.php                    18-Jun-2024 14:06                9608
function.cubrid-lob2-import.php                    18-Jun-2024 14:06                9474
function.cubrid-lob2-new.php                       18-Jun-2024 14:06                4487
function.cubrid-lob2-read.php                      18-Jun-2024 14:06               14516
function.cubrid-lob2-seek.php                      18-Jun-2024 14:06               12654
function.cubrid-lob2-seek64.php                    18-Jun-2024 14:06               14322
function.cubrid-lob2-size.php                      18-Jun-2024 14:06                4851
function.cubrid-lob2-size64.php                    18-Jun-2024 14:06                5168
function.cubrid-lob2-tell.php                      18-Jun-2024 14:06                4867
function.cubrid-lob2-tell64.php                    18-Jun-2024 14:06                5206
function.cubrid-lob2-write.php                     18-Jun-2024 14:06               14764
function.cubrid-lock-read.php                      18-Jun-2024 14:06                9803
function.cubrid-lock-write.php                     18-Jun-2024 14:06               10188
function.cubrid-move-cursor.php                    18-Jun-2024 14:06               10699
function.cubrid-new-glo.php                        18-Jun-2024 14:06                7599
function.cubrid-next-result.php                    18-Jun-2024 14:06               17455
function.cubrid-num-cols.php                       18-Jun-2024 14:06                6676
function.cubrid-num-fields.php                     18-Jun-2024 14:06                6451
function.cubrid-num-rows.php                       18-Jun-2024 14:06                8160
function.cubrid-pconnect-with-url.php              18-Jun-2024 14:06               16894
function.cubrid-pconnect.php                       18-Jun-2024 14:06               13405
function.cubrid-ping.php                           18-Jun-2024 14:06                6562
function.cubrid-prepare.php                        18-Jun-2024 14:06               11382
function.cubrid-put.php                            18-Jun-2024 14:06               12557
function.cubrid-query.php                          18-Jun-2024 14:06               16651
function.cubrid-real-escape-string.php             18-Jun-2024 14:06                9014
function.cubrid-result.php                         18-Jun-2024 14:06                8390
function.cubrid-rollback.php                       18-Jun-2024 14:06               15173
function.cubrid-save-to-glo.php                    18-Jun-2024 14:06                7458
function.cubrid-schema.php                         18-Jun-2024 14:06               21668
function.cubrid-send-glo.php                       18-Jun-2024 14:06                6932
function.cubrid-seq-drop.php                       18-Jun-2024 14:06               10560
function.cubrid-seq-insert.php                     18-Jun-2024 14:06               11094
function.cubrid-seq-put.php                        18-Jun-2024 14:06               11032
function.cubrid-set-add.php                        18-Jun-2024 14:06               10199
function.cubrid-set-autocommit.php                 18-Jun-2024 14:06                4672
function.cubrid-set-db-parameter.php               18-Jun-2024 14:06                8992
function.cubrid-set-drop.php                       18-Jun-2024 14:06               10170
function.cubrid-set-query-timeout.php              18-Jun-2024 14:06                3960
function.cubrid-unbuffered-query.php               18-Jun-2024 14:06                7967
function.cubrid-version.php                        18-Jun-2024 14:06                9043
function.curl-close.php                            18-Jun-2024 14:06                6664
function.curl-copy-handle.php                      18-Jun-2024 14:06                6990
function.curl-errno.php                            18-Jun-2024 14:06                6532
function.curl-error.php                            18-Jun-2024 14:06                6518
function.curl-escape.php                           18-Jun-2024 14:06                8033
function.curl-exec.php                             18-Jun-2024 14:06                8488
function.curl-getinfo.php                          18-Jun-2024 14:06               49632
function.curl-init.php                             18-Jun-2024 14:06                8092
function.curl-multi-add-handle.php                 18-Jun-2024 14:06               10848
function.curl-multi-close.php                      18-Jun-2024 14:06               10168
function.curl-multi-errno.php                      18-Jun-2024 14:06                4233
function.curl-multi-exec.php                       18-Jun-2024 14:06               11114
function.curl-multi-getcontent.php                 18-Jun-2024 14:06                4899
function.curl-multi-info-read.php                  18-Jun-2024 14:06               13133
function.curl-multi-init.php                       18-Jun-2024 14:06                9335
function.curl-multi-remove-handle.php              18-Jun-2024 14:06                6060
function.curl-multi-select.php                     18-Jun-2024 14:06                4873
function.curl-multi-setopt.php                     18-Jun-2024 14:06               15283
function.curl-multi-strerror.php                   18-Jun-2024 14:06                7618
function.curl-pause.php                            18-Jun-2024 14:06                4420
function.curl-reset.php                            18-Jun-2024 14:06                7011
function.curl-setopt-array.php                     18-Jun-2024 14:06                8799
function.curl-setopt.php                           18-Jun-2024 14:06              205628
function.curl-share-close.php                      18-Jun-2024 14:06                8966
function.curl-share-errno.php                      18-Jun-2024 14:06                4470
function.curl-share-init.php                       18-Jun-2024 14:06                8417
function.curl-share-setopt.php                     18-Jun-2024 14:06               11527
function.curl-share-strerror.php                   18-Jun-2024 14:06                3793
function.curl-strerror.php                         18-Jun-2024 14:06                6749
function.curl-unescape.php                         18-Jun-2024 14:06                8629
function.curl-version.php                          18-Jun-2024 14:06                7570
function.curl_upkeep.php                           18-Jun-2024 14:06                7674
function.current.php                               18-Jun-2024 14:06               13354                              18-Jun-2024 14:06                1788               18-Jun-2024 14:06                1963     18-Jun-2024 14:06                2075                 18-Jun-2024 14:06                4667                           18-Jun-2024 14:06                4828                         18-Jun-2024 14:06                1847             18-Jun-2024 14:06                7754             18-Jun-2024 14:06                6517                             18-Jun-2024 14:06                1807                           18-Jun-2024 14:06                1815                  18-Jun-2024 14:06                1980 18-Jun-2024 14:06                2091                  18-Jun-2024 14:06                1942                      18-Jun-2024 14:06                1870                           18-Jun-2024 14:06                1819                       18-Jun-2024 14:06                1863                18-Jun-2024 14:06               16538                            18-Jun-2024 14:06               23221                              18-Jun-2024 14:06                2492                         18-Jun-2024 14:06               17948                          18-Jun-2024 14:06               16401                           18-Jun-2024 14:06               16500                         18-Jun-2024 14:06                1833                    18-Jun-2024 14:06                1892                    18-Jun-2024 14:06                1900                     18-Jun-2024 14:06                1889                     18-Jun-2024 14:06                1861                                  18-Jun-2024 14:06               25307
function.db2-autocommit.php                        18-Jun-2024 14:06               12595
function.db2-bind-param.php                        18-Jun-2024 14:06               25925
function.db2-client-info.php                       18-Jun-2024 14:06               12721
function.db2-close.php                             18-Jun-2024 14:06                6396
function.db2-column-privileges.php                 18-Jun-2024 14:06               10910
function.db2-columns.php                           18-Jun-2024 14:06               13085
function.db2-commit.php                            18-Jun-2024 14:06                4361
function.db2-conn-error.php                        18-Jun-2024 14:06                8294
function.db2-conn-errormsg.php                     18-Jun-2024 14:06                8129
function.db2-connect.php                           18-Jun-2024 14:06               47124
function.db2-cursor-type.php                       18-Jun-2024 14:06                3729
function.db2-escape-string.php                     18-Jun-2024 14:06                8027
function.db2-exec.php                              18-Jun-2024 14:06               28675
function.db2-execute.php                           18-Jun-2024 14:06               28498
function.db2-fetch-array.php                       18-Jun-2024 14:06               13142
function.db2-fetch-assoc.php                       18-Jun-2024 14:06               13092
function.db2-fetch-both.php                        18-Jun-2024 14:06               13924
function.db2-fetch-object.php                      18-Jun-2024 14:06               10986
function.db2-fetch-row.php                         18-Jun-2024 14:06               18115
function.db2-field-display-size.php                18-Jun-2024 14:06                6006
function.db2-field-name.php                        18-Jun-2024 14:06                5742
function.db2-field-num.php                         18-Jun-2024 14:06                5817
function.db2-field-precision.php                   18-Jun-2024 14:06                5818
function.db2-field-scale.php                       18-Jun-2024 14:06                5768
function.db2-field-type.php                        18-Jun-2024 14:06                5820
function.db2-field-width.php                       18-Jun-2024 14:06                6192
function.db2-foreign-keys.php                      18-Jun-2024 14:06               11182
function.db2-free-result.php                       18-Jun-2024 14:06                3886
function.db2-free-stmt.php                         18-Jun-2024 14:06                3857
function.db2-get-option.php                        18-Jun-2024 14:06               26954
function.db2-last-insert-id.php                    18-Jun-2024 14:06                9316
function.db2-lob-read.php                          18-Jun-2024 14:06               17315
function.db2-next-result.php                       18-Jun-2024 14:06               10174
function.db2-num-fields.php                        18-Jun-2024 14:06                8061
function.db2-num-rows.php                          18-Jun-2024 14:06                6126
function.db2-pclose.php                            18-Jun-2024 14:06                6942
function.db2-pconnect.php                          18-Jun-2024 14:06               40031
function.db2-prepare.php                           18-Jun-2024 14:06               13007
function.db2-primary-keys.php                      18-Jun-2024 14:06                9379
function.db2-procedure-columns.php                 18-Jun-2024 14:06               15109
function.db2-procedures.php                        18-Jun-2024 14:06                9978
function.db2-result.php                            18-Jun-2024 14:06                9230
function.db2-rollback.php                          18-Jun-2024 14:06               10140
function.db2-server-info.php                       18-Jun-2024 14:06               25751
function.db2-set-option.php                        18-Jun-2024 14:06               68935
function.db2-special-columns.php                   18-Jun-2024 14:06               12824
function.db2-statistics.php                        18-Jun-2024 14:06               15955
function.db2-stmt-error.php                        18-Jun-2024 14:06                5371
function.db2-stmt-errormsg.php                     18-Jun-2024 14:06                4947
function.db2-table-privileges.php                  18-Jun-2024 14:06               10643
function.db2-tables.php                            18-Jun-2024 14:06               10845
function.dba-close.php                             18-Jun-2024 14:06                3553
function.dba-delete.php                            18-Jun-2024 14:06                4587
function.dba-exists.php                            18-Jun-2024 14:06                4560
function.dba-fetch.php                             18-Jun-2024 14:06                8366
function.dba-firstkey.php                          18-Jun-2024 14:06                4118
function.dba-handlers.php                          18-Jun-2024 14:06                6281
function.dba-insert.php                            18-Jun-2024 14:06                5336
function.dba-key-split.php                         18-Jun-2024 14:06                4364
function.dba-list.php                              18-Jun-2024 14:06                2460
function.dba-nextkey.php                           18-Jun-2024 14:06                4004
function.dba-open.php                              18-Jun-2024 14:06               16748
function.dba-optimize.php                          18-Jun-2024 14:06                3528
function.dba-popen.php                             18-Jun-2024 14:06               11251
function.dba-replace.php                           18-Jun-2024 14:06                5149
function.dba-sync.php                              18-Jun-2024 14:06                3600
function.dbase-add-record.php                      18-Jun-2024 14:06                7660
function.dbase-close.php                           18-Jun-2024 14:06                5729
function.dbase-create.php                          18-Jun-2024 14:06                9312
function.dbase-delete-record.php                   18-Jun-2024 14:06                5580
function.dbase-get-header-info.php                 18-Jun-2024 14:06                7977
function.dbase-get-record-with-names.php           18-Jun-2024 14:06               10320
function.dbase-get-record.php                      18-Jun-2024 14:06                6565
function.dbase-numfields.php                       18-Jun-2024 14:06                9257
function.dbase-numrecords.php                      18-Jun-2024 14:06                6789
function.dbase-open.php                            18-Jun-2024 14:06                7659
function.dbase-pack.php                            18-Jun-2024 14:06                6965
function.dbase-replace-record.php                  18-Jun-2024 14:06               10565
function.dcgettext.php                             18-Jun-2024 14:06                3818
function.dcngettext.php                            18-Jun-2024 14:06                4564
function.debug-backtrace.php                       18-Jun-2024 14:06               13655
function.debug-print-backtrace.php                 18-Jun-2024 14:06                7517
function.debug-zval-dump.php                       18-Jun-2024 14:06               12233
function.decbin.php                                18-Jun-2024 14:06               10211
function.dechex.php                                18-Jun-2024 14:06                8674
function.decoct.php                                18-Jun-2024 14:06                5922
function.define.php                                18-Jun-2024 14:06               13830
function.defined.php                               18-Jun-2024 14:06                8706
function.deflate-add.php                           18-Jun-2024 14:06                6555
function.deflate-init.php                          18-Jun-2024 14:06                9056
function.deg2rad.php                               18-Jun-2024 14:06                4390
function.delete.php                                18-Jun-2024 14:06                2786
function.dgettext.php                              18-Jun-2024 14:06                3598
function.die.php                                   18-Jun-2024 14:06                1656
function.dio-close.php                             18-Jun-2024 14:06                4422
function.dio-fcntl.php                             18-Jun-2024 14:06               10822
function.dio-open.php                              18-Jun-2024 14:06                9428
function.dio-read.php                              18-Jun-2024 14:06                3890
function.dio-seek.php                              18-Jun-2024 14:06                7989
function.dio-stat.php                              18-Jun-2024 14:06                4860
function.dio-tcsetattr.php                         18-Jun-2024 14:06                7592
function.dio-truncate.php                          18-Jun-2024 14:06                4281
function.dio-write.php                             18-Jun-2024 14:06                4247
function.dir.php                                   18-Jun-2024 14:06                8370
function.dirname.php                               18-Jun-2024 14:06               11345
function.disk-free-space.php                       18-Jun-2024 14:06                6311
function.disk-total-space.php                      18-Jun-2024 14:06                5772
function.diskfreespace.php                         18-Jun-2024 14:06                1836
function.dl.php                                    18-Jun-2024 14:06               11316
function.dngettext.php                             18-Jun-2024 14:06                4304
function.dns-check-record.php                      18-Jun-2024 14:06                1793
function.dns-get-mx.php                            18-Jun-2024 14:06                1763
function.dns-get-record.php                        18-Jun-2024 14:06               28544
function.dom-import-simplexml.php                  18-Jun-2024 14:06                7523
function.doubleval.php                             18-Jun-2024 14:06                1768
function.each.php                                  18-Jun-2024 14:06               13291
function.easter-date.php                           18-Jun-2024 14:06               16603
function.easter-days.php                           18-Jun-2024 14:06                8612
function.echo.php                                  18-Jun-2024 14:06               20954
function.eio-busy.php                              18-Jun-2024 14:06                5629
function.eio-cancel.php                            18-Jun-2024 14:06                8389
function.eio-chmod.php                             18-Jun-2024 14:06                7162
function.eio-chown.php                             18-Jun-2024 14:06                7410
function.eio-close.php                             18-Jun-2024 14:06                6453
function.eio-custom.php                            18-Jun-2024 14:06               11624
function.eio-dup2.php                              18-Jun-2024 14:06                6615
function.eio-event-loop.php                        18-Jun-2024 14:06                6293
function.eio-fallocate.php                         18-Jun-2024 14:06                8707
function.eio-fchmod.php                            18-Jun-2024 14:06                7078
function.eio-fchown.php                            18-Jun-2024 14:06                7421
function.eio-fdatasync.php                         18-Jun-2024 14:06                6433
function.eio-fstat.php                             18-Jun-2024 14:06               12800
function.eio-fstatvfs.php                          18-Jun-2024 14:06                6576
function.eio-fsync.php                             18-Jun-2024 14:06                6552
function.eio-ftruncate.php                         18-Jun-2024 14:06                7018
function.eio-futime.php                            18-Jun-2024 14:06                7532
function.eio-get-event-stream.php                  18-Jun-2024 14:06                8776
function.eio-get-last-error.php                    18-Jun-2024 14:06                3549
function.eio-grp-add.php                           18-Jun-2024 14:06               12422
function.eio-grp-cancel.php                        18-Jun-2024 14:06                3450
function.eio-grp-limit.php                         18-Jun-2024 14:06                3444
function.eio-grp.php                               18-Jun-2024 14:06               12779
function.eio-init.php                              18-Jun-2024 14:06                2964
function.eio-link.php                              18-Jun-2024 14:06               13344
function.eio-lstat.php                             18-Jun-2024 14:06               10868
function.eio-mkdir.php                             18-Jun-2024 14:06               10230
function.eio-mknod.php                             18-Jun-2024 14:06               13181
function.eio-nop.php                               18-Jun-2024 14:06                6224
function.eio-npending.php                          18-Jun-2024 14:06                3459
function.eio-nready.php                            18-Jun-2024 14:06                3079
function.eio-nreqs.php                             18-Jun-2024 14:06                5995
function.eio-nthreads.php                          18-Jun-2024 14:06                4065
function.eio-open.php                              18-Jun-2024 14:06               13307
function.eio-poll.php                              18-Jun-2024 14:06                6370
function.eio-read.php                              18-Jun-2024 14:06               13981
function.eio-readahead.php                         18-Jun-2024 14:06                7287
function.eio-readdir.php                           18-Jun-2024 14:06               20686
function.eio-readlink.php                          18-Jun-2024 14:06               13082
function.eio-realpath.php                          18-Jun-2024 14:06                5643
function.eio-rename.php                            18-Jun-2024 14:06               10224
function.eio-rmdir.php                             18-Jun-2024 14:06                9100
function.eio-seek.php                              18-Jun-2024 14:06                8373
function.eio-sendfile.php                          18-Jun-2024 14:06                7566
function.eio-set-max-idle.php                      18-Jun-2024 14:06                3628
function.eio-set-max-parallel.php                  18-Jun-2024 14:06                3671
function.eio-set-max-poll-reqs.php                 18-Jun-2024 14:06                2727
function.eio-set-max-poll-time.php                 18-Jun-2024 14:06                2884
function.eio-set-min-parallel.php                  18-Jun-2024 14:06                3661
function.eio-stat.php                              18-Jun-2024 14:06               10939
function.eio-statvfs.php                           18-Jun-2024 14:06                9400
function.eio-symlink.php                           18-Jun-2024 14:06               11762
function.eio-sync-file-range.php                   18-Jun-2024 14:06                8570
function.eio-sync.php                              18-Jun-2024 14:06                3122
function.eio-syncfs.php                            18-Jun-2024 14:06                5965
function.eio-truncate.php                          18-Jun-2024 14:06                6965
function.eio-unlink.php                            18-Jun-2024 14:06                6084
function.eio-utime.php                             18-Jun-2024 14:06                7098
function.eio-write.php                             18-Jun-2024 14:06                7852
function.empty.php                                 18-Jun-2024 14:06               11101
function.enchant-broker-describe.php               18-Jun-2024 14:06                6666
function.enchant-broker-dict-exists.php            18-Jun-2024 14:06                6209
function.enchant-broker-free-dict.php              18-Jun-2024 14:06                5292
function.enchant-broker-free.php                   18-Jun-2024 14:06                4868
function.enchant-broker-get-dict-path.php          18-Jun-2024 14:06                5879
function.enchant-broker-get-error.php              18-Jun-2024 14:06                4027
function.enchant-broker-init.php                   18-Jun-2024 14:06                3796
function.enchant-broker-list-dicts.php             18-Jun-2024 14:06                7423
function.enchant-broker-request-dict.php           18-Jun-2024 14:06                7764
function.enchant-broker-request-pwl-dict.php       18-Jun-2024 14:06                6123
function.enchant-broker-set-dict-path.php          18-Jun-2024 14:06                6172
function.enchant-broker-set-ordering.php           18-Jun-2024 14:06                5500
function.enchant-dict-add-to-personal.php          18-Jun-2024 14:06                2213
function.enchant-dict-add-to-session.php           18-Jun-2024 14:06                4910
function.enchant-dict-add.php                      18-Jun-2024 14:06                6897
function.enchant-dict-check.php                    18-Jun-2024 14:06                4648
function.enchant-dict-describe.php                 18-Jun-2024 14:06                7107
function.enchant-dict-get-error.php                18-Jun-2024 14:06                4227
function.enchant-dict-is-added.php                 18-Jun-2024 14:06                4958
function.enchant-dict-is-in-session.php            18-Jun-2024 14:06                2202
function.enchant-dict-quick-check.php              18-Jun-2024 14:06                8978
function.enchant-dict-store-replacement.php        18-Jun-2024 14:06                5247
function.enchant-dict-suggest.php                  18-Jun-2024 14:06                7915
function.end.php                                   18-Jun-2024 14:06                8029
function.enum-exists.php                           18-Jun-2024 14:06                6048
function.error-clear-last.php                      18-Jun-2024 14:06                4972
function.error-get-last.php                        18-Jun-2024 14:06                5401
function.error-log.php                             18-Jun-2024 14:06               12526
function.error-reporting.php                       18-Jun-2024 14:06               11130
function.escapeshellarg.php                        18-Jun-2024 14:06                6591
function.escapeshellcmd.php                        18-Jun-2024 14:06                9041
function.eval.php                                  18-Jun-2024 14:06               11729
function.exec.php                                  18-Jun-2024 14:06               12967
function.exif-imagetype.php                        18-Jun-2024 14:06               10936
function.exif-read-data.php                        18-Jun-2024 14:06               25420
function.exif-tagname.php                          18-Jun-2024 14:06                5125
function.exif-thumbnail.php                        18-Jun-2024 14:06               10036
function.exit.php                                  18-Jun-2024 14:06               10769
function.exp.php                                   18-Jun-2024 14:06                4744
function.expect-expectl.php                        18-Jun-2024 14:06               12245
function.expect-popen.php                          18-Jun-2024 14:06                5070
function.explode.php                               18-Jun-2024 14:06               17740
function.expm1.php                                 18-Jun-2024 14:06                4055
function.extension-loaded.php                      18-Jun-2024 14:06                6192
function.extract.php                               18-Jun-2024 14:06               17701
function.ezmlm-hash.php                            18-Jun-2024 14:06                4873
function.fann-cascadetrain-on-data.php             18-Jun-2024 14:06                7976
function.fann-cascadetrain-on-file.php             18-Jun-2024 14:06                6201
function.fann-clear-scaling-params.php             18-Jun-2024 14:06                3055
function.fann-copy.php                             18-Jun-2024 14:06                3714
function.fann-create-from-file.php                 18-Jun-2024 14:06                3790
function.fann-create-shortcut-array.php            18-Jun-2024 14:06                5027
function.fann-create-shortcut.php                  18-Jun-2024 14:06                6318
function.fann-create-sparse-array.php              18-Jun-2024 14:06                5848
function.fann-create-sparse.php                    18-Jun-2024 14:06                6642
function.fann-create-standard-array.php            18-Jun-2024 14:06                5454
function.fann-create-standard.php                  18-Jun-2024 14:06                6292
function.fann-create-train-from-callback.php       18-Jun-2024 14:06               10268
function.fann-create-train.php                     18-Jun-2024 14:06                5232
function.fann-descale-input.php                    18-Jun-2024 14:06                4467
function.fann-descale-output.php                   18-Jun-2024 14:06                4488
function.fann-descale-train.php                    18-Jun-2024 14:06                4526
function.fann-destroy-train.php                    18-Jun-2024 14:06                3010
function.fann-destroy.php                          18-Jun-2024 14:06                3052
function.fann-duplicate-train-data.php             18-Jun-2024 14:06                3290
function.fann-get-activation-function.php          18-Jun-2024 14:06                6044
function.fann-get-activation-steepness.php         18-Jun-2024 14:06                6757
function.fann-get-bias-array.php                   18-Jun-2024 14:06                2876
function.fann-get-bit-fail-limit.php               18-Jun-2024 14:06                4764
function.fann-get-bit-fail.php                     18-Jun-2024 14:06                5739
function.fann-get-cascade-activation-functions-..> 18-Jun-2024 14:06                4319
function.fann-get-cascade-activation-functions.php 18-Jun-2024 14:06                5246
function.fann-get-cascade-activation-steepnesse..> 18-Jun-2024 14:06                4340
function.fann-get-cascade-activation-steepnesse..> 18-Jun-2024 14:06                4613
function.fann-get-cascade-candidate-change-frac..> 18-Jun-2024 14:06                6110
function.fann-get-cascade-candidate-limit.php      18-Jun-2024 14:06                4218
function.fann-get-cascade-candidate-stagnation-..> 18-Jun-2024 14:06                4944
function.fann-get-cascade-max-cand-epochs.php      18-Jun-2024 14:06                4013
function.fann-get-cascade-max-out-epochs.php       18-Jun-2024 14:06                3943
function.fann-get-cascade-min-cand-epochs.php      18-Jun-2024 14:06                4370
function.fann-get-cascade-min-out-epochs.php       18-Jun-2024 14:06                4361
function.fann-get-cascade-num-candidate-groups.php 18-Jun-2024 14:06                4533
function.fann-get-cascade-num-candidates.php       18-Jun-2024 14:06                7064
function.fann-get-cascade-output-change-fractio..> 18-Jun-2024 14:06                6054
function.fann-get-cascade-output-stagnation-epo..> 18-Jun-2024 14:06                4926
function.fann-get-cascade-weight-multiplier.php    18-Jun-2024 14:06                4039
function.fann-get-connection-array.php             18-Jun-2024 14:06                2845
function.fann-get-connection-rate.php              18-Jun-2024 14:06                3131
function.fann-get-errno.php                        18-Jun-2024 14:06                3666
function.fann-get-errstr.php                       18-Jun-2024 14:06                3697
function.fann-get-layer-array.php                  18-Jun-2024 14:06                3010
function.fann-get-learning-momentum.php            18-Jun-2024 14:06                4562
function.fann-get-learning-rate.php                18-Jun-2024 14:06                4420
function.fann-get-mse.php                          18-Jun-2024 14:06                3774
function.fann-get-network-type.php                 18-Jun-2024 14:06                3012
function.fann-get-num-input.php                    18-Jun-2024 14:06                2935
function.fann-get-num-layers.php                   18-Jun-2024 14:06                2969
function.fann-get-num-output.php                   18-Jun-2024 14:06                2957
function.fann-get-quickprop-decay.php              18-Jun-2024 14:06                4029
function.fann-get-quickprop-mu.php                 18-Jun-2024 14:06                3813
function.fann-get-rprop-decrease-factor.php        18-Jun-2024 14:06                3915
function.fann-get-rprop-delta-max.php              18-Jun-2024 14:06                3976
function.fann-get-rprop-delta-min.php              18-Jun-2024 14:06                3721
function.fann-get-rprop-delta-zero.php             18-Jun-2024 14:06                4119
function.fann-get-rprop-increase-factor.php        18-Jun-2024 14:06                3941
function.fann-get-sarprop-step-error-shift.php     18-Jun-2024 14:06                4101
function.fann-get-sarprop-step-error-threshold-..> 18-Jun-2024 14:06                4334
function.fann-get-sarprop-temperature.php          18-Jun-2024 14:06                3991
function.fann-get-sarprop-weight-decay-shift.php   18-Jun-2024 14:06                4122
function.fann-get-total-connections.php            18-Jun-2024 14:06                3118
function.fann-get-total-neurons.php                18-Jun-2024 14:06                3232
function.fann-get-train-error-function.php         18-Jun-2024 14:06                4227
function.fann-get-train-stop-function.php          18-Jun-2024 14:06                4148
function.fann-get-training-algorithm.php           18-Jun-2024 14:06                4343
function.fann-init-weights.php                     18-Jun-2024 14:06                5417
function.fann-length-train-data.php                18-Jun-2024 14:06                3306
function.fann-merge-train-data.php                 18-Jun-2024 14:06                3729
function.fann-num-input-train-data.php             18-Jun-2024 14:06                4084
function.fann-num-output-train-data.php            18-Jun-2024 14:06                4085
function.fann-print-error.php                      18-Jun-2024 14:06                3329
function.fann-randomize-weights.php                18-Jun-2024 14:06                4459
function.fann-read-train-from-file.php             18-Jun-2024 14:06                5698
function.fann-reset-errno.php                      18-Jun-2024 14:06                3571
function.fann-reset-errstr.php                     18-Jun-2024 14:06                3562
function.fann-reset-mse.php                        18-Jun-2024 14:06                3979
function.fann-run.php                              18-Jun-2024 14:06                3337
function.fann-save-train.php                       18-Jun-2024 14:06                3952
function.fann-save.php                             18-Jun-2024 14:06                5016
function.fann-scale-input-train-data.php           18-Jun-2024 14:06                4889
function.fann-scale-input.php                      18-Jun-2024 14:06                4491
function.fann-scale-output-train-data.php          18-Jun-2024 14:06                4920
function.fann-scale-output.php                     18-Jun-2024 14:06                4500
function.fann-scale-train-data.php                 18-Jun-2024 14:06                4911
function.fann-scale-train.php                      18-Jun-2024 14:06                4521
function.fann-set-activation-function-hidden.php   18-Jun-2024 14:06                5098
function.fann-set-activation-function-layer.php    18-Jun-2024 14:06                5678
function.fann-set-activation-function-output.php   18-Jun-2024 14:06                5115
function.fann-set-activation-function.php          18-Jun-2024 14:06                7464
function.fann-set-activation-steepness-hidden.php  18-Jun-2024 14:06                5448
function.fann-set-activation-steepness-layer.php   18-Jun-2024 14:06                5961
function.fann-set-activation-steepness-output.php  18-Jun-2024 14:06                5389
function.fann-set-activation-steepness.php         18-Jun-2024 14:06                7219
function.fann-set-bit-fail-limit.php               18-Jun-2024 14:06                3958
function.fann-set-callback.php                     18-Jun-2024 14:06                6601
function.fann-set-cascade-activation-functions.php 18-Jun-2024 14:06                4676
function.fann-set-cascade-activation-steepnesse..> 18-Jun-2024 14:06                4889
function.fann-set-cascade-candidate-change-frac..> 18-Jun-2024 14:06                4268
function.fann-set-cascade-candidate-limit.php      18-Jun-2024 14:06                4009
function.fann-set-cascade-candidate-stagnation-..> 18-Jun-2024 14:06                4373
function.fann-set-cascade-max-cand-epochs.php      18-Jun-2024 14:06                4066
function.fann-set-cascade-max-out-epochs.php       18-Jun-2024 14:06                4049
function.fann-set-cascade-min-cand-epochs.php      18-Jun-2024 14:06                4431
function.fann-set-cascade-min-out-epochs.php       18-Jun-2024 14:06                4475
function.fann-set-cascade-num-candidate-groups.php 18-Jun-2024 14:06                4135
function.fann-set-cascade-output-change-fractio..> 18-Jun-2024 14:06                4258
function.fann-set-cascade-output-stagnation-epo..> 18-Jun-2024 14:06                4345
function.fann-set-cascade-weight-multiplier.php    18-Jun-2024 14:06                3970
function.fann-set-error-log.php                    18-Jun-2024 14:06                3358
function.fann-set-input-scaling-params.php         18-Jun-2024 14:06                5426
function.fann-set-learning-momentum.php            18-Jun-2024 14:06                4308
function.fann-set-learning-rate.php                18-Jun-2024 14:06                4258
function.fann-set-output-scaling-params.php        18-Jun-2024 14:06                5445
function.fann-set-quickprop-decay.php              18-Jun-2024 14:06                4061
function.fann-set-quickprop-mu.php                 18-Jun-2024 14:06                3763
function.fann-set-rprop-decrease-factor.php        18-Jun-2024 14:06                4141
function.fann-set-rprop-delta-max.php              18-Jun-2024 14:06                4260
function.fann-set-rprop-delta-min.php              18-Jun-2024 14:06                4037
function.fann-set-rprop-delta-zero.php             18-Jun-2024 14:06                4418
function.fann-set-rprop-increase-factor.php        18-Jun-2024 14:06                4166
function.fann-set-sarprop-step-error-shift.php     18-Jun-2024 14:06                4430
function.fann-set-sarprop-step-error-threshold-..> 18-Jun-2024 14:06                4704
function.fann-set-sarprop-temperature.php          18-Jun-2024 14:06                4320
function.fann-set-sarprop-weight-decay-shift.php   18-Jun-2024 14:06                4433
function.fann-set-scaling-params.php               18-Jun-2024 14:06                6771
function.fann-set-train-error-function.php         18-Jun-2024 14:06                4365
function.fann-set-train-stop-function.php          18-Jun-2024 14:06                4374
function.fann-set-training-algorithm.php           18-Jun-2024 14:06                4187
function.fann-set-weight-array.php                 18-Jun-2024 14:06                3632
function.fann-set-weight.php                       18-Jun-2024 14:06                3962
function.fann-shuffle-train-data.php               18-Jun-2024 14:06                3326
function.fann-subset-train-data.php                18-Jun-2024 14:06                4796
function.fann-test-data.php                        18-Jun-2024 14:06                4785
function.fann-test.php                             18-Jun-2024 14:06                5333
function.fann-train-epoch.php                      18-Jun-2024 14:06                5450
function.fann-train-on-data.php                    18-Jun-2024 14:06                7549
function.fann-train-on-file.php                    18-Jun-2024 14:06                7481
function.fann-train.php                            18-Jun-2024 14:06                5364
function.fastcgi-finish-request.php                18-Jun-2024 14:06                2952
function.fbird-add-user.php                        18-Jun-2024 14:06                2404
function.fbird-affected-rows.php                   18-Jun-2024 14:06                2415
function.fbird-backup.php                          18-Jun-2024 14:06                1807
function.fbird-blob-add.php                        18-Jun-2024 14:06                2756
function.fbird-blob-cancel.php                     18-Jun-2024 14:06                4017
function.fbird-blob-close.php                      18-Jun-2024 14:06                2787
function.fbird-blob-create.php                     18-Jun-2024 14:06                2787
function.fbird-blob-echo.php                       18-Jun-2024 14:06                2572
function.fbird-blob-get.php                        18-Jun-2024 14:06                2565
function.fbird-blob-import.php                     18-Jun-2024 14:06                2783
function.fbird-blob-info.php                       18-Jun-2024 14:06                1839
function.fbird-blob-open.php                       18-Jun-2024 14:06                2562
function.fbird-close.php                           18-Jun-2024 14:06                2338
function.fbird-commit-ret.php                      18-Jun-2024 14:06                1832
function.fbird-commit.php                          18-Jun-2024 14:06                1800
function.fbird-connect.php                         18-Jun-2024 14:06                2344
function.fbird-db-info.php                         18-Jun-2024 14:06                1813
function.fbird-delete-user.php                     18-Jun-2024 14:06                2412
function.fbird-drop-db.php                         18-Jun-2024 14:06                2360
function.fbird-errcode.php                         18-Jun-2024 14:06                2173
function.fbird-errmsg.php                          18-Jun-2024 14:06                2166
function.fbird-execute.php                         18-Jun-2024 14:06                2178
function.fbird-fetch-assoc.php                     18-Jun-2024 14:06                2428
function.fbird-fetch-object.php                    18-Jun-2024 14:06                2439
function.fbird-fetch-row.php                       18-Jun-2024 14:06                2416
function.fbird-field-info.php                      18-Jun-2024 14:06                2248
function.fbird-free-event-handler.php              18-Jun-2024 14:06                2352
function.fbird-free-query.php                      18-Jun-2024 14:06                1868
function.fbird-free-result.php                     18-Jun-2024 14:06                1853
function.fbird-gen-id.php                          18-Jun-2024 14:06                1810
function.fbird-maintain-db.php                     18-Jun-2024 14:06                1855
function.fbird-modify-user.php                     18-Jun-2024 14:06                2428
function.fbird-name-result.php                     18-Jun-2024 14:06                2411
function.fbird-num-fields.php                      18-Jun-2024 14:06                2237
function.fbird-num-params.php                      18-Jun-2024 14:06                2406
function.fbird-param-info.php                      18-Jun-2024 14:06                2411
function.fbird-pconnect.php                        18-Jun-2024 14:06                2361
function.fbird-prepare.php                         18-Jun-2024 14:06                1803
function.fbird-query.php                           18-Jun-2024 14:06                2697
function.fbird-restore.php                         18-Jun-2024 14:06                1810
function.fbird-rollback-ret.php                    18-Jun-2024 14:06                1862
function.fbird-rollback.php                        18-Jun-2024 14:06                1834
function.fbird-server-info.php                     18-Jun-2024 14:06                1865
function.fbird-service-attach.php                  18-Jun-2024 14:06                1904
function.fbird-service-detach.php                  18-Jun-2024 14:06                1916
function.fbird-set-event-handler.php               18-Jun-2024 14:06                2521
function.fbird-trans.php                           18-Jun-2024 14:06                1809
function.fbird-wait-event.php                      18-Jun-2024 14:06                2446
function.fclose.php                                18-Jun-2024 14:06                4970
function.fdatasync.php                             18-Jun-2024 14:06                6691
function.fdf-add-doc-javascript.php                18-Jun-2024 14:06                5998
function.fdf-add-template.php                      18-Jun-2024 14:06                3021
function.fdf-close.php                             18-Jun-2024 14:06                3332
function.fdf-create.php                            18-Jun-2024 14:06                5949
function.fdf-enum-values.php                       18-Jun-2024 14:06                2645
function.fdf-errno.php                             18-Jun-2024 14:06                3099
function.fdf-error.php                             18-Jun-2024 14:06                3587
function.fdf-get-ap.php                            18-Jun-2024 14:06                4684
function.fdf-get-attachment.php                    18-Jun-2024 14:06                6739
function.fdf-get-encoding.php                      18-Jun-2024 14:06                3690
function.fdf-get-file.php                          18-Jun-2024 14:06                3470
function.fdf-get-flags.php                         18-Jun-2024 14:06                2507
function.fdf-get-opt.php                           18-Jun-2024 14:06                2559
function.fdf-get-status.php                        18-Jun-2024 14:06                3464
function.fdf-get-value.php                         18-Jun-2024 14:06                4934
function.fdf-get-version.php                       18-Jun-2024 14:06                3938
function.fdf-header.php                            18-Jun-2024 14:06                2653
function.fdf-next-field-name.php                   18-Jun-2024 14:06                5733
function.fdf-open-string.php                       18-Jun-2024 14:06                5296
function.fdf-open.php                              18-Jun-2024 14:06                6400
function.fdf-remove-item.php                       18-Jun-2024 14:06                2553
function.fdf-save-string.php                       18-Jun-2024 14:06                6031
function.fdf-save.php                              18-Jun-2024 14:06                4465
function.fdf-set-ap.php                            18-Jun-2024 14:06                4915
function.fdf-set-encoding.php                      18-Jun-2024 14:06                4136
function.fdf-set-file.php                          18-Jun-2024 14:06                7545
function.fdf-set-flags.php                         18-Jun-2024 14:06                4710
function.fdf-set-javascript-action.php             18-Jun-2024 14:06                4929
function.fdf-set-on-import-javascript.php          18-Jun-2024 14:06                3422
function.fdf-set-opt.php                           18-Jun-2024 14:06                4986
function.fdf-set-status.php                        18-Jun-2024 14:06                4184
function.fdf-set-submit-form-action.php            18-Jun-2024 14:06                5249
function.fdf-set-target-frame.php                  18-Jun-2024 14:06                4175
function.fdf-set-value.php                         18-Jun-2024 14:06                5998
function.fdf-set-version.php                       18-Jun-2024 14:06                4455
function.fdiv.php                                  18-Jun-2024 14:06                7183
function.feof.php                                  18-Jun-2024 14:06                8568
function.fflush.php                                18-Jun-2024 14:06                6164
function.fgetc.php                                 18-Jun-2024 14:06                7512
function.fgetcsv.php                               18-Jun-2024 14:06               15347
function.fgets.php                                 18-Jun-2024 14:06               10084
function.fgetss.php                                18-Jun-2024 14:06               10667
function.file-exists.php                           18-Jun-2024 14:06                8516
function.file-get-contents.php                     18-Jun-2024 14:06               22191
function.file-put-contents.php                     18-Jun-2024 14:06               15604
function.file.php                                  18-Jun-2024 14:06               14162
function.fileatime.php                             18-Jun-2024 14:06                8555
function.filectime.php                             18-Jun-2024 14:06                8445
function.filegroup.php                             18-Jun-2024 14:06                6687
function.fileinode.php                             18-Jun-2024 14:06                6074
function.filemtime.php                             18-Jun-2024 14:06                7804
function.fileowner.php                             18-Jun-2024 14:06                6450
function.fileperms.php                             18-Jun-2024 14:06               18059
function.filesize.php                              18-Jun-2024 14:06                6863
function.filetype.php                              18-Jun-2024 14:06                7756
function.filter-has-var.php                        18-Jun-2024 14:06                3721
function.filter-id.php                             18-Jun-2024 14:06                3304
function.filter-input-array.php                    18-Jun-2024 14:06               15105
function.filter-input.php                          18-Jun-2024 14:06                9813
function.filter-list.php                           18-Jun-2024 14:06                4163
function.filter-var-array.php                      18-Jun-2024 14:06               13591
function.filter-var.php                            18-Jun-2024 14:06               16199
function.finfo-buffer.php                          18-Jun-2024 14:06                9140
function.finfo-close.php                           18-Jun-2024 14:06                3965
function.finfo-file.php                            18-Jun-2024 14:06                9751
function.finfo-open.php                            18-Jun-2024 14:06               11369
function.finfo-set-flags.php                       18-Jun-2024 14:06                5143
function.floatval.php                              18-Jun-2024 14:06                7775
function.flock.php                                 18-Jun-2024 14:06               16053
function.floor.php                                 18-Jun-2024 14:06                6012
function.flush.php                                 18-Jun-2024 14:06                5843
function.fmod.php                                  18-Jun-2024 14:06                5720
function.fnmatch.php                               18-Jun-2024 14:06               13717
function.fopen.php                                 18-Jun-2024 14:06               29558
function.forward-static-call-array.php             18-Jun-2024 14:06               10262
function.forward-static-call.php                   18-Jun-2024 14:06                9674
function.fpassthru.php                             18-Jun-2024 14:06                8560
function.fpm-get-status.php                        18-Jun-2024 14:06                3425
function.fprintf.php                               18-Jun-2024 14:06               27734
function.fputcsv.php                               18-Jun-2024 14:06               11755
function.fputs.php                                 18-Jun-2024 14:06                1724
function.fread.php                                 18-Jun-2024 14:06               17448
function.frenchtojd.php                            18-Jun-2024 14:06                4934
function.fscanf.php                                18-Jun-2024 14:06               10992
function.fseek.php                                 18-Jun-2024 14:06                9580
function.fsockopen.php                             18-Jun-2024 14:06               19799
function.fstat.php                                 18-Jun-2024 14:06                6980
function.fsync.php                                 18-Jun-2024 14:06                6409
function.ftell.php                                 18-Jun-2024 14:06                7041
function.ftok.php                                  18-Jun-2024 14:06                4185
function.ftp-alloc.php                             18-Jun-2024 14:06                9549
function.ftp-append.php                            18-Jun-2024 14:06                4989
function.ftp-cdup.php                              18-Jun-2024 14:06                7290
function.ftp-chdir.php                             18-Jun-2024 14:06                8282
function.ftp-chmod.php                             18-Jun-2024 14:06                7933
function.ftp-close.php                             18-Jun-2024 14:06                6839
function.ftp-connect.php                           18-Jun-2024 14:06                7562
function.ftp-delete.php                            18-Jun-2024 14:06                6756
function.ftp-exec.php                              18-Jun-2024 14:06                7392
function.ftp-fget.php                              18-Jun-2024 14:06               11089
function.ftp-fput.php                              18-Jun-2024 14:06               10435
function.ftp-get-option.php                        18-Jun-2024 14:06                6910
function.ftp-get.php                               18-Jun-2024 14:06               10359
function.ftp-login.php                             18-Jun-2024 14:06                7507
function.ftp-mdtm.php                              18-Jun-2024 14:06                7784
function.ftp-mkdir.php                             18-Jun-2024 14:06                7615
function.ftp-mlsd.php                              18-Jun-2024 14:06                9951
function.ftp-nb-continue.php                       18-Jun-2024 14:06                5929
function.ftp-nb-fget.php                           18-Jun-2024 14:06               11501
function.ftp-nb-fput.php                           18-Jun-2024 14:06               11296
function.ftp-nb-get.php                            18-Jun-2024 14:06               15720
function.ftp-nb-put.php                            18-Jun-2024 14:06               12724
function.ftp-nlist.php                             18-Jun-2024 14:06                7697
function.ftp-pasv.php                              18-Jun-2024 14:06                8165
function.ftp-put.php                               18-Jun-2024 14:06                9996
function.ftp-pwd.php                               18-Jun-2024 14:06                6613
function.ftp-quit.php                              18-Jun-2024 14:06                1711
function.ftp-raw.php                               18-Jun-2024 14:06                6121
function.ftp-rawlist.php                           18-Jun-2024 14:06                9207
function.ftp-rename.php                            18-Jun-2024 14:06                7934
function.ftp-rmdir.php                             18-Jun-2024 14:06                7221
function.ftp-set-option.php                        18-Jun-2024 14:06                8552
function.ftp-site.php                              18-Jun-2024 14:06                7565
function.ftp-size.php                              18-Jun-2024 14:06                7506
function.ftp-ssl-connect.php                       18-Jun-2024 14:06               10347
function.ftp-systype.php                           18-Jun-2024 14:06                6093
function.ftruncate.php                             18-Jun-2024 14:06                7233
function.func-get-arg.php                          18-Jun-2024 14:06               13107
function.func-get-args.php                         18-Jun-2024 14:06               13730
function.func-num-args.php                         18-Jun-2024 14:06                7039
function.function-exists.php                       18-Jun-2024 14:06                6935
function.fwrite.php                                18-Jun-2024 14:06               16849
function.gc-collect-cycles.php                     18-Jun-2024 14:06                2810
function.gc-disable.php                            18-Jun-2024 14:06                2877
function.gc-enable.php                             18-Jun-2024 14:06                2835
function.gc-enabled.php                            18-Jun-2024 14:06                3769
function.gc-mem-caches.php                         18-Jun-2024 14:06                2780
function.gc-status.php                             18-Jun-2024 14:06                9305                               18-Jun-2024 14:06               10563
function.geoip-asnum-by-name.php                   18-Jun-2024 14:06                4591
function.geoip-continent-code-by-name.php          18-Jun-2024 14:06                6387
function.geoip-country-code-by-name.php            18-Jun-2024 14:06                6178
function.geoip-country-code3-by-name.php           18-Jun-2024 14:06                5588
function.geoip-country-name-by-name.php            18-Jun-2024 14:06                5521
function.geoip-database-info.php                   18-Jun-2024 14:06                4845
function.geoip-db-avail.php                        18-Jun-2024 14:06                5185
function.geoip-db-filename.php                     18-Jun-2024 14:06                4835
function.geoip-db-get-all-info.php                 18-Jun-2024 14:06                7638
function.geoip-domain-by-name.php                  18-Jun-2024 14:06                5003
function.geoip-id-by-name.php                      18-Jun-2024 14:06                5976
function.geoip-isp-by-name.php                     18-Jun-2024 14:06                4943
function.geoip-netspeedcell-by-name.php            18-Jun-2024 14:06                5943
function.geoip-org-by-name.php                     18-Jun-2024 14:06                5114
function.geoip-record-by-name.php                  18-Jun-2024 14:06                9023
function.geoip-region-by-name.php                  18-Jun-2024 14:06                5817
function.geoip-region-name-by-code.php             18-Jun-2024 14:06                8332
function.geoip-setup-custom-directory.php          18-Jun-2024 14:06                4651
function.geoip-time-zone-by-country-and-region.php 18-Jun-2024 14:06                8549
function.get-browser.php                           18-Jun-2024 14:06                9940
function.get-called-class.php                      18-Jun-2024 14:06                7052
function.get-cfg-var.php                           18-Jun-2024 14:06                4473
function.get-class-methods.php                     18-Jun-2024 14:06                7564
function.get-class-vars.php                        18-Jun-2024 14:06               10737
function.get-class.php                             18-Jun-2024 14:06               14513
function.get-current-user.php                      18-Jun-2024 14:06                4813
function.get-debug-type.php                        18-Jun-2024 14:06               10669
function.get-declared-classes.php                  18-Jun-2024 14:06                6229
function.get-declared-interfaces.php               18-Jun-2024 14:06                4879
function.get-declared-traits.php                   18-Jun-2024 14:06                3191
function.get-defined-constants.php                 18-Jun-2024 14:06                8543
function.get-defined-functions.php                 18-Jun-2024 14:06                7937
function.get-defined-vars.php                      18-Jun-2024 14:06                7058
function.get-extension-funcs.php                   18-Jun-2024 14:06                6055
function.get-headers.php                           18-Jun-2024 14:06               10298
function.get-html-translation-table.php            18-Jun-2024 14:06               17412
function.get-include-path.php                      18-Jun-2024 14:06                4941
function.get-included-files.php                    18-Jun-2024 14:06                6621
function.get-loaded-extensions.php                 18-Jun-2024 14:06                6138
function.get-magic-quotes-gpc.php                  18-Jun-2024 14:06                4667
function.get-magic-quotes-runtime.php              18-Jun-2024 14:06                4107
function.get-mangled-object-vars.php               18-Jun-2024 14:06                9230
function.get-meta-tags.php                         18-Jun-2024 14:06                9169
function.get-object-vars.php                       18-Jun-2024 14:06                6753
function.get-parent-class.php                      18-Jun-2024 14:06                8756
function.get-required-files.php                    18-Jun-2024 14:06                1904
function.get-resource-id.php                       18-Jun-2024 14:06                5483
function.get-resource-type.php                     18-Jun-2024 14:06                5442
function.get-resources.php                         18-Jun-2024 14:06                8803
function.getallheaders.php                         18-Jun-2024 14:06                5267
function.getcwd.php                                18-Jun-2024 14:06                6353
function.getdate.php                               18-Jun-2024 14:06               11059
function.getenv.php                                18-Jun-2024 14:06               10686
function.gethostbyaddr.php                         18-Jun-2024 14:06                4891
function.gethostbyname.php                         18-Jun-2024 14:06                5042
function.gethostbynamel.php                        18-Jun-2024 14:06                5741
function.gethostname.php                           18-Jun-2024 14:06                4480
function.getimagesize.php                          18-Jun-2024 14:06               20564
function.getimagesizefromstring.php                18-Jun-2024 14:06                6271
function.getlastmod.php                            18-Jun-2024 14:06                5928
function.getmxrr.php                               18-Jun-2024 14:06                6977
function.getmygid.php                              18-Jun-2024 14:06                3874
function.getmyinode.php                            18-Jun-2024 14:06                3822
function.getmypid.php                              18-Jun-2024 14:06                4384
function.getmyuid.php                              18-Jun-2024 14:06                3846
function.getopt.php                                18-Jun-2024 14:06               17689
function.getprotobyname.php                        18-Jun-2024 14:06                5021
function.getprotobynumber.php                      18-Jun-2024 14:06                3597
function.getrandmax.php                            18-Jun-2024 14:06                3500
function.getrusage.php                             18-Jun-2024 14:06               12870
function.getservbyname.php                         18-Jun-2024 14:06                7054
function.getservbyport.php                         18-Jun-2024 14:06                4319
function.gettext.php                               18-Jun-2024 14:06                6506
function.gettimeofday.php                          18-Jun-2024 14:06                5658
function.gettype.php                               18-Jun-2024 14:06               10291
function.glob.php                                  18-Jun-2024 14:06               12653
function.gmdate.php                                18-Jun-2024 14:06                8743
function.gmmktime.php                              18-Jun-2024 14:06               13859
function.gmp-abs.php                               18-Jun-2024 14:06                4941
function.gmp-add.php                               18-Jun-2024 14:06                5304
function.gmp-and.php                               18-Jun-2024 14:06                5753
function.gmp-binomial.php                          18-Jun-2024 14:06                4499
function.gmp-clrbit.php                            18-Jun-2024 14:06                6098
function.gmp-cmp.php                               18-Jun-2024 14:06                6242
function.gmp-com.php                               18-Jun-2024 14:06                4401
function.gmp-div-q.php                             18-Jun-2024 14:06               11256
function.gmp-div-qr.php                            18-Jun-2024 14:06                7358
function.gmp-div-r.php                             18-Jun-2024 14:06                6864
function.gmp-div.php                               18-Jun-2024 14:06                1730
function.gmp-divexact.php                          18-Jun-2024 14:06                6529
function.gmp-export.php                            18-Jun-2024 14:06                6235
function.gmp-fact.php                              18-Jun-2024 14:06                5257
function.gmp-gcd.php                               18-Jun-2024 14:06                5861
function.gmp-gcdext.php                            18-Jun-2024 14:06               10232
function.gmp-hamdist.php                           18-Jun-2024 14:06                7351
function.gmp-import.php                            18-Jun-2024 14:06                6560
function.gmp-init.php                              18-Jun-2024 14:06                6756
function.gmp-intval.php                            18-Jun-2024 14:06                6287
function.gmp-invert.php                            18-Jun-2024 14:06                6053
function.gmp-jacobi.php                            18-Jun-2024 14:06                6342
function.gmp-kronecker.php                         18-Jun-2024 14:06                4538
function.gmp-lcm.php                               18-Jun-2024 14:06                4335
function.gmp-legendre.php                          18-Jun-2024 14:06                6356
function.gmp-mod.php                               18-Jun-2024 14:06                5559
function.gmp-mul.php                               18-Jun-2024 14:06                5593
function.gmp-neg.php                               18-Jun-2024 14:06                4845
function.gmp-nextprime.php                         18-Jun-2024 14:06                5727
function.gmp-or.php                                18-Jun-2024 14:06                5965
function.gmp-perfect-power.php                     18-Jun-2024 14:06                4118
function.gmp-perfect-square.php                    18-Jun-2024 14:06                6429
function.gmp-popcount.php                          18-Jun-2024 14:06                5440
function.gmp-pow.php                               18-Jun-2024 14:06                6321
function.gmp-powm.php                              18-Jun-2024 14:06                6900
function.gmp-prob-prime.php                        18-Jun-2024 14:06                6795
function.gmp-random-bits.php                       18-Jun-2024 14:06                7090
function.gmp-random-range.php                      18-Jun-2024 14:06                8669
function.gmp-random-seed.php                       18-Jun-2024 14:06                8479
function.gmp-random.php                            18-Jun-2024 14:06                7852
function.gmp-root.php                              18-Jun-2024 14:06                3655
function.gmp-rootrem.php                           18-Jun-2024 14:06                4044
function.gmp-scan0.php                             18-Jun-2024 14:06                6135
function.gmp-scan1.php                             18-Jun-2024 14:06                6125
function.gmp-setbit.php                            18-Jun-2024 14:06               12465
function.gmp-sign.php                              18-Jun-2024 14:06                5613
function.gmp-sqrt.php                              18-Jun-2024 14:06                5384
function.gmp-sqrtrem.php                           18-Jun-2024 14:06                6899
function.gmp-strval.php                            18-Jun-2024 14:06                5311
function.gmp-sub.php                               18-Jun-2024 14:06                5607
function.gmp-testbit.php                           18-Jun-2024 14:06                6558
function.gmp-xor.php                               18-Jun-2024 14:06                6016
function.gmstrftime.php                            18-Jun-2024 14:06               10627
function.gnupg-adddecryptkey.php                   18-Jun-2024 14:06                5799
function.gnupg-addencryptkey.php                   18-Jun-2024 14:06                5301
function.gnupg-addsignkey.php                      18-Jun-2024 14:06                5774
function.gnupg-cleardecryptkeys.php                18-Jun-2024 14:06                4874
function.gnupg-clearencryptkeys.php                18-Jun-2024 14:06                4878
function.gnupg-clearsignkeys.php                   18-Jun-2024 14:06                4821
function.gnupg-decrypt.php                         18-Jun-2024 14:06                6663
function.gnupg-decryptverify.php                   18-Jun-2024 14:06                7910
function.gnupg-deletekey.php                       18-Jun-2024 14:06                5652
function.gnupg-encrypt.php                         18-Jun-2024 14:06                6535
function.gnupg-encryptsign.php                     18-Jun-2024 14:06                7560
function.gnupg-export.php                          18-Jun-2024 14:06                5670
function.gnupg-getengineinfo.php                   18-Jun-2024 14:06                6069
function.gnupg-geterror.php                        18-Jun-2024 14:06                4855
function.gnupg-geterrorinfo.php                    18-Jun-2024 14:06                6238
function.gnupg-getprotocol.php                     18-Jun-2024 14:06                4862
function.gnupg-gettrustlist.php                    18-Jun-2024 14:06                5861
function.gnupg-import.php                          18-Jun-2024 14:06                5953
function.gnupg-init.php                            18-Jun-2024 14:06                8378
function.gnupg-keyinfo.php                         18-Jun-2024 14:06                5927
function.gnupg-listsignatures.php                  18-Jun-2024 14:06                5996
function.gnupg-setarmor.php                        18-Jun-2024 14:06                6376
function.gnupg-seterrormode.php                    18-Jun-2024 14:06                6380
function.gnupg-setsignmode.php                     18-Jun-2024 14:06                6443
function.gnupg-sign.php                            18-Jun-2024 14:06                6969
function.gnupg-verify.php                          18-Jun-2024 14:06                9323
function.grapheme-extract.php                      18-Jun-2024 14:06               10381
function.grapheme-stripos.php                      18-Jun-2024 14:06                9346
function.grapheme-stristr.php                      18-Jun-2024 14:06                8672
function.grapheme-strlen.php                       18-Jun-2024 14:06                6142
function.grapheme-strpos.php                       18-Jun-2024 14:06                9001
function.grapheme-strripos.php                     18-Jun-2024 14:06                8815
function.grapheme-strrpos.php                      18-Jun-2024 14:06                8461
function.grapheme-strstr.php                       18-Jun-2024 14:06                8318
function.grapheme-substr.php                       18-Jun-2024 14:06                9367
function.gregoriantojd.php                         18-Jun-2024 14:06                9154
function.gzclose.php                               18-Jun-2024 14:06                4678
function.gzcompress.php                            18-Jun-2024 14:06                6727
function.gzdecode.php                              18-Jun-2024 14:06                4202
function.gzdeflate.php                             18-Jun-2024 14:06                6088
function.gzencode.php                              18-Jun-2024 14:06                7684
function.gzeof.php                                 18-Jun-2024 14:06                4666
function.gzfile.php                                18-Jun-2024 14:06                5347
function.gzgetc.php                                18-Jun-2024 14:06                5140
function.gzgets.php                                18-Jun-2024 14:06                6940
function.gzgetss.php                               18-Jun-2024 14:06                6865
function.gzinflate.php                             18-Jun-2024 14:06                5848
function.gzopen.php                                18-Jun-2024 14:06                6606
function.gzpassthru.php                            18-Jun-2024 14:06                5353
function.gzputs.php                                18-Jun-2024 14:06                1696
function.gzread.php                                18-Jun-2024 14:06                7471
function.gzrewind.php                              18-Jun-2024 14:06                3767
function.gzseek.php                                18-Jun-2024 14:06                7517
function.gztell.php                                18-Jun-2024 14:06                3952
function.gzuncompress.php                          18-Jun-2024 14:06                5814
function.gzwrite.php                               18-Jun-2024 14:06                7367
function.halt-compiler.php                         18-Jun-2024 14:06                5750
function.hash-algos.php                            18-Jun-2024 14:06                6358
function.hash-copy.php                             18-Jun-2024 14:06                5944
function.hash-equals.php                           18-Jun-2024 14:06                8697
function.hash-file.php                             18-Jun-2024 14:06                9095
function.hash-final.php                            18-Jun-2024 14:06                5745
function.hash-hkdf.php                             18-Jun-2024 14:06               11669
function.hash-hmac-algos.php                       18-Jun-2024 14:06                5940
function.hash-hmac-file.php                        18-Jun-2024 14:06               10176
function.hash-hmac.php                             18-Jun-2024 14:06                9628
function.hash-init.php                             18-Jun-2024 14:06               12160
function.hash-pbkdf2.php                           18-Jun-2024 14:06               14834
function.hash-update-file.php                      18-Jun-2024 14:06                6771
function.hash-update-stream.php                    18-Jun-2024 14:06                8317
function.hash-update.php                           18-Jun-2024 14:06                4987
function.hash.php                                  18-Jun-2024 14:06                8880
function.header-register-callback.php              18-Jun-2024 14:06                7919
function.header-remove.php                         18-Jun-2024 14:06                7766
function.header.php                                18-Jun-2024 14:06               24168
function.headers-list.php                          18-Jun-2024 14:06                6922
function.headers-sent.php                          18-Jun-2024 14:06                9694
function.hebrev.php                                18-Jun-2024 14:06                3948
function.hebrevc.php                               18-Jun-2024 14:06                4464
function.hex2bin.php                               18-Jun-2024 14:06                6128
function.hexdec.php                                18-Jun-2024 14:06                7988
function.highlight-file.php                        18-Jun-2024 14:06                7403
function.highlight-string.php                      18-Jun-2024 14:06                8059
function.hrtime.php                                18-Jun-2024 14:06                6003
function.html-entity-decode.php                    18-Jun-2024 14:06               18672
function.htmlentities.php                          18-Jun-2024 14:06               22431
function.htmlspecialchars-decode.php               18-Jun-2024 14:06               11026
function.htmlspecialchars.php                      18-Jun-2024 14:06               29194
function.http-build-query.php                      18-Jun-2024 14:06               21902
function.http-response-code.php                    18-Jun-2024 14:06                7955
function.hypot.php                                 18-Jun-2024 14:06                3409
function.ibase-add-user.php                        18-Jun-2024 14:06                5713
function.ibase-affected-rows.php                   18-Jun-2024 14:06                3931
function.ibase-backup.php                          18-Jun-2024 14:06               12448
function.ibase-blob-add.php                        18-Jun-2024 14:06                4497
function.ibase-blob-cancel.php                     18-Jun-2024 14:06                4168
function.ibase-blob-close.php                      18-Jun-2024 14:06                4422
function.ibase-blob-create.php                     18-Jun-2024 14:06                4587
function.ibase-blob-echo.php                       18-Jun-2024 14:06                4779
function.ibase-blob-get.php                        18-Jun-2024 14:06                7238
function.ibase-blob-import.php                     18-Jun-2024 14:06                8776
function.ibase-blob-info.php                       18-Jun-2024 14:06                4058
function.ibase-blob-open.php                       18-Jun-2024 14:06                5005
function.ibase-close.php                           18-Jun-2024 14:06                4367
function.ibase-commit-ret.php                      18-Jun-2024 14:06                3915
function.ibase-commit.php                          18-Jun-2024 14:06                3587
function.ibase-connect.php                         18-Jun-2024 14:06               12098
function.ibase-db-info.php                         18-Jun-2024 14:06                2872
function.ibase-delete-user.php                     18-Jun-2024 14:06                4009
function.ibase-drop-db.php                         18-Jun-2024 14:06                4176
function.ibase-errcode.php                         18-Jun-2024 14:06                2989
function.ibase-errmsg.php                          18-Jun-2024 14:06                2999
function.ibase-execute.php                         18-Jun-2024 14:06                7755
function.ibase-fetch-assoc.php                     18-Jun-2024 14:06                5719
function.ibase-fetch-object.php                    18-Jun-2024 14:06                7379
function.ibase-fetch-row.php                       18-Jun-2024 14:06                5302
function.ibase-field-info.php                      18-Jun-2024 14:06                7297
function.ibase-free-event-handler.php              18-Jun-2024 14:06                3997
function.ibase-free-query.php                      18-Jun-2024 14:06                3146
function.ibase-free-result.php                     18-Jun-2024 14:06                3229
function.ibase-gen-id.php                          18-Jun-2024 14:06                3154
function.ibase-maintain-db.php                     18-Jun-2024 14:06                3444
function.ibase-modify-user.php                     18-Jun-2024 14:06                5660
function.ibase-name-result.php                     18-Jun-2024 14:06                6299
function.ibase-num-fields.php                      18-Jun-2024 14:06                6771
function.ibase-num-params.php                      18-Jun-2024 14:06                3960
function.ibase-param-info.php                      18-Jun-2024 14:06                4051
function.ibase-pconnect.php                        18-Jun-2024 14:06                9454
function.ibase-prepare.php                         18-Jun-2024 14:06                5244
function.ibase-query.php                           18-Jun-2024 14:06                8404
function.ibase-restore.php                         18-Jun-2024 14:06               12529
function.ibase-rollback-ret.php                    18-Jun-2024 14:06                3977
function.ibase-rollback.php                        18-Jun-2024 14:06                3653
function.ibase-server-info.php                     18-Jun-2024 14:06               10750
function.ibase-service-attach.php                  18-Jun-2024 14:06               12101
function.ibase-service-detach.php                  18-Jun-2024 14:06                6725
function.ibase-set-event-handler.php               18-Jun-2024 14:06                8842
function.ibase-trans.php                           18-Jun-2024 14:06                6891
function.ibase-wait-event.php                      18-Jun-2024 14:06                4888
function.iconv-get-encoding.php                    18-Jun-2024 14:06                6595
function.iconv-mime-decode-headers.php             18-Jun-2024 14:06               11835
function.iconv-mime-decode.php                     18-Jun-2024 14:06                9529
function.iconv-mime-encode.php                     18-Jun-2024 14:06               13513
function.iconv-set-encoding.php                    18-Jun-2024 14:06                5594
function.iconv-strlen.php                          18-Jun-2024 14:06                5718
function.iconv-strpos.php                          18-Jun-2024 14:06                8523
function.iconv-strrpos.php                         18-Jun-2024 14:06                7556
function.iconv-substr.php                          18-Jun-2024 14:06                9603
function.iconv.php                                 18-Jun-2024 14:06               10665
function.idate.php                                 18-Jun-2024 14:06               13536
function.idn-to-ascii.php                          18-Jun-2024 14:06                8793
function.idn-to-utf8.php                           18-Jun-2024 14:06                8859
function.igbinary-serialize.php                    18-Jun-2024 14:06               12102
function.igbinary-unserialize.php                  18-Jun-2024 14:06               12179
function.ignore-user-abort.php                     18-Jun-2024 14:06                9090
function.image-type-to-extension.php               18-Jun-2024 14:06                5938
function.image-type-to-mime-type.php               18-Jun-2024 14:06                9651
function.image2wbmp.php                            18-Jun-2024 14:06                7528
function.imageaffine.php                           18-Jun-2024 14:06                5608
function.imageaffinematrixconcat.php               18-Jun-2024 14:06                7572
function.imageaffinematrixget.php                  18-Jun-2024 14:06                7532
function.imagealphablending.php                    18-Jun-2024 14:06                9263
function.imageantialias.php                        18-Jun-2024 14:06               12418
function.imagearc.php                              18-Jun-2024 14:06               14811
function.imageavif.php                             18-Jun-2024 14:06                7389
function.imagebmp.php                              18-Jun-2024 14:06                9372
function.imagechar.php                             18-Jun-2024 14:06               11399
function.imagecharup.php                           18-Jun-2024 14:06               11207
function.imagecolorallocate.php                    18-Jun-2024 14:06               11465
function.imagecolorallocatealpha.php               18-Jun-2024 14:06               20049
function.imagecolorat.php                          18-Jun-2024 14:06               11567
function.imagecolorclosest.php                     18-Jun-2024 14:06               13689
function.imagecolorclosestalpha.php                18-Jun-2024 14:06               13890
function.imagecolorclosesthwb.php                  18-Jun-2024 14:06                7537
function.imagecolordeallocate.php                  18-Jun-2024 14:06                6743
function.imagecolorexact.php                       18-Jun-2024 14:06                9512
function.imagecolorexactalpha.php                  18-Jun-2024 14:06               10564
function.imagecolormatch.php                       18-Jun-2024 14:06                9215
function.imagecolorresolve.php                     18-Jun-2024 14:06                8762
function.imagecolorresolvealpha.php                18-Jun-2024 14:06                9559
function.imagecolorset.php                         18-Jun-2024 14:06                9881
function.imagecolorsforindex.php                   18-Jun-2024 14:06                8398
function.imagecolorstotal.php                      18-Jun-2024 14:06                6713
function.imagecolortransparent.php                 18-Jun-2024 14:06               10482
function.imageconvolution.php                      18-Jun-2024 14:06               13011
function.imagecopy.php                             18-Jun-2024 14:06               10353
function.imagecopymerge.php                        18-Jun-2024 14:06               10858
function.imagecopymergegray.php                    18-Jun-2024 14:06               11651
function.imagecopyresampled.php                    18-Jun-2024 14:06               21964
function.imagecopyresized.php                      18-Jun-2024 14:06               16726
function.imagecreate.php                           18-Jun-2024 14:06                9474
function.imagecreatefromavif.php                   18-Jun-2024 14:06                3331
function.imagecreatefrombmp.php                    18-Jun-2024 14:06                6661
function.imagecreatefromgd.php                     18-Jun-2024 14:06                7502
function.imagecreatefromgd2.php                    18-Jun-2024 14:06                7670
function.imagecreatefromgd2part.php                18-Jun-2024 14:06               10391
function.imagecreatefromgif.php                    18-Jun-2024 14:06               11107
function.imagecreatefromjpeg.php                   18-Jun-2024 14:06               10528
function.imagecreatefrompng.php                    18-Jun-2024 14:06               10481
function.imagecreatefromstring.php                 18-Jun-2024 14:06                9355
function.imagecreatefromtga.php                    18-Jun-2024 14:06                4088
function.imagecreatefromwbmp.php                   18-Jun-2024 14:06               10567
function.imagecreatefromwebp.php                   18-Jun-2024 14:06                6869
function.imagecreatefromxbm.php                    18-Jun-2024 14:06                6618
function.imagecreatefromxpm.php                    18-Jun-2024 14:06                7383
function.imagecreatetruecolor.php                  18-Jun-2024 14:06                8070
function.imagecrop.php                             18-Jun-2024 14:06                8902
function.imagecropauto.php                         18-Jun-2024 14:06               12833
function.imagedashedline.php                       18-Jun-2024 14:06               13893
function.imagedestroy.php                          18-Jun-2024 14:06                5922
function.imageellipse.php                          18-Jun-2024 14:06               11090
function.imagefill.php                             18-Jun-2024 14:06                8501
function.imagefilledarc.php                        18-Jun-2024 14:06               20181
function.imagefilledellipse.php                    18-Jun-2024 14:06               10796
function.imagefilledpolygon.php                    18-Jun-2024 14:06               13487
function.imagefilledrectangle.php                  18-Jun-2024 14:06                9383
function.imagefilltoborder.php                     18-Jun-2024 14:06               12562
function.imagefilter.php                           18-Jun-2024 14:06               37684
function.imageflip.php                             18-Jun-2024 14:06               11194
function.imagefontheight.php                       18-Jun-2024 14:06                7369
function.imagefontwidth.php                        18-Jun-2024 14:06                7296
function.imageftbbox.php                           18-Jun-2024 14:06               15735
function.imagefttext.php                           18-Jun-2024 14:06               18271
function.imagegammacorrect.php                     18-Jun-2024 14:06                6859
function.imagegd.php                               18-Jun-2024 14:06               12339
function.imagegd2.php                              18-Jun-2024 14:06               13373
function.imagegetclip.php                          18-Jun-2024 14:06                7058
function.imagegetinterpolation.php                 18-Jun-2024 14:06                4272
function.imagegif.php                              18-Jun-2024 14:06               18564
function.imagegrabscreen.php                       18-Jun-2024 14:06                5455
function.imagegrabwindow.php                       18-Jun-2024 14:06               10810
function.imageinterlace.php                        18-Jun-2024 14:06                8289
function.imageistruecolor.php                      18-Jun-2024 14:06                8270
function.imagejpeg.php                             18-Jun-2024 14:06               17120
function.imagelayereffect.php                      18-Jun-2024 14:06               13355
function.imageline.php                             18-Jun-2024 14:06               16430
function.imageloadfont.php                         18-Jun-2024 14:06               10681
function.imageopenpolygon.php                      18-Jun-2024 14:06               11758
function.imagepalettecopy.php                      18-Jun-2024 14:06                8134
function.imagepalettetotruecolor.php               18-Jun-2024 14:06               11035
function.imagepng.php                              18-Jun-2024 14:06               10637
function.imagepolygon.php                          18-Jun-2024 14:06               12065
function.imagerectangle.php                        18-Jun-2024 14:06               11526
function.imageresolution.php                       18-Jun-2024 14:06                9594
function.imagerotate.php                           18-Jun-2024 14:06               10522
function.imagesavealpha.php                        18-Jun-2024 14:06                9146
function.imagescale.php                            18-Jun-2024 14:06                8153
function.imagesetbrush.php                         18-Jun-2024 14:06               10505
function.imagesetclip.php                          18-Jun-2024 14:06                6091
function.imagesetinterpolation.php                 18-Jun-2024 14:06               13136
function.imagesetpixel.php                         18-Jun-2024 14:06               12415
function.imagesetstyle.php                         18-Jun-2024 14:06               13321
function.imagesetthickness.php                     18-Jun-2024 14:06                9317
function.imagesettile.php                          18-Jun-2024 14:06                9942
function.imagestring.php                           18-Jun-2024 14:06               11556
function.imagestringup.php                         18-Jun-2024 14:06               10689
function.imagesx.php                               18-Jun-2024 14:06                5762
function.imagesy.php                               18-Jun-2024 14:06                5782
function.imagetruecolortopalette.php               18-Jun-2024 14:06                8170
function.imagettfbbox.php                          18-Jun-2024 14:06               21579
function.imagettftext.php                          18-Jun-2024 14:06               20956
function.imagetypes.php                            18-Jun-2024 14:06                5759
function.imagewbmp.php                             18-Jun-2024 14:06               16934
function.imagewebp.php                             18-Jun-2024 14:06                8621
function.imagexbm.php                              18-Jun-2024 14:06               13628
function.imap-8bit.php                             18-Jun-2024 14:06                3575
function.imap-alerts.php                           18-Jun-2024 14:06                3735
function.imap-append.php                           18-Jun-2024 14:06               10711
function.imap-base64.php                           18-Jun-2024 14:06                3889
function.imap-binary.php                           18-Jun-2024 14:06                3433
function.imap-body.php                             18-Jun-2024 14:06                6339
function.imap-bodystruct.php                       18-Jun-2024 14:06                5212
function.imap-check.php                            18-Jun-2024 14:06                6659
function.imap-clearflag-full.php                   18-Jun-2024 14:06                7429
function.imap-close.php                            18-Jun-2024 14:06                5704
function.imap-create.php                           18-Jun-2024 14:06                1801
function.imap-createmailbox.php                    18-Jun-2024 14:06               15218
function.imap-delete.php                           18-Jun-2024 14:06               11848
function.imap-deletemailbox.php                    18-Jun-2024 14:06                5513
function.imap-errors.php                           18-Jun-2024 14:06                3910
function.imap-expunge.php                          18-Jun-2024 14:06                4031
function.imap-fetch-overview.php                   18-Jun-2024 14:06               12745
function.imap-fetchbody.php                        18-Jun-2024 14:06                6947
function.imap-fetchheader.php                      18-Jun-2024 14:06                6464
function.imap-fetchmime.php                        18-Jun-2024 14:06                7146
function.imap-fetchstructure.php                   18-Jun-2024 14:06               10952
function.imap-fetchtext.php                        18-Jun-2024 14:06                1782
function.imap-gc.php                               18-Jun-2024 14:06                6488
function.imap-get-quota.php                        18-Jun-2024 14:06               13943
function.imap-get-quotaroot.php                    18-Jun-2024 14:06               10307
function.imap-getacl.php                           18-Jun-2024 14:06                6653
function.imap-getmailboxes.php                     18-Jun-2024 14:06               14306
function.imap-getsubscribed.php                    18-Jun-2024 14:06                9709
function.imap-header.php                           18-Jun-2024 14:06                2004
function.imap-headerinfo.php                       18-Jun-2024 14:06               13108
function.imap-headers.php                          18-Jun-2024 14:06                3954
function.imap-is-open.php                          18-Jun-2024 14:06                4552
function.imap-last-error.php                       18-Jun-2024 14:06                3499
function.imap-list.php                             18-Jun-2024 14:06                9886
function.imap-listmailbox.php                      18-Jun-2024 14:06                1787
function.imap-listscan.php                         18-Jun-2024 14:06                8047
function.imap-listsubscribed.php                   18-Jun-2024 14:06                1808
function.imap-lsub.php                             18-Jun-2024 14:06                7140
function.imap-mail-compose.php                     18-Jun-2024 14:06               17617
function.imap-mail-copy.php                        18-Jun-2024 14:06                7250
function.imap-mail-move.php                        18-Jun-2024 14:06                7853
function.imap-mail.php                             18-Jun-2024 14:06                8172
function.imap-mailboxmsginfo.php                   18-Jun-2024 14:06                9948
function.imap-mime-header-decode.php               18-Jun-2024 14:06                7091
function.imap-msgno.php                            18-Jun-2024 14:06                4537
function.imap-mutf7-to-utf8.php                    18-Jun-2024 14:06                3728
function.imap-num-msg.php                          18-Jun-2024 14:06                4622
function.imap-num-recent.php                       18-Jun-2024 14:06                4371
function.imap-open.php                             18-Jun-2024 14:06               25357
function.imap-ping.php                             18-Jun-2024 14:06                5515
function.imap-qprint.php                           18-Jun-2024 14:06                3580
function.imap-rename.php                           18-Jun-2024 14:06                1804
function.imap-renamemailbox.php                    18-Jun-2024 14:06                6294
function.imap-reopen.php                           18-Jun-2024 14:06                9807
function.imap-rfc822-parse-adrlist.php             18-Jun-2024 14:06                8324
function.imap-rfc822-parse-headers.php             18-Jun-2024 14:06                4075
function.imap-rfc822-write-address.php             18-Jun-2024 14:06                6032
function.imap-savebody.php                         18-Jun-2024 14:06                7342
function.imap-scan.php                             18-Jun-2024 14:06                1769
function.imap-scanmailbox.php                      18-Jun-2024 14:06                1799
function.imap-search.php                           18-Jun-2024 14:06               15416
function.imap-set-quota.php                        18-Jun-2024 14:06                7722
function.imap-setacl.php                           18-Jun-2024 14:06                6363
function.imap-setflag-full.php                     18-Jun-2024 14:06                9702
function.imap-sort.php                             18-Jun-2024 14:06                9581
function.imap-status.php                           18-Jun-2024 14:06               11932
function.imap-subscribe.php                        18-Jun-2024 14:06                5018
function.imap-thread.php                           18-Jun-2024 14:06                8532
function.imap-timeout.php                          18-Jun-2024 14:06                5354
function.imap-uid.php                              18-Jun-2024 14:06                5149
function.imap-undelete.php                         18-Jun-2024 14:06                5576
function.imap-unsubscribe.php                      18-Jun-2024 14:06                5088
function.imap-utf7-decode.php                      18-Jun-2024 14:06                4337
function.imap-utf7-encode.php                      18-Jun-2024 14:06                3824
function.imap-utf8-to-mutf7.php                    18-Jun-2024 14:06                3773
function.imap-utf8.php                             18-Jun-2024 14:06                4852
function.implode.php                               18-Jun-2024 14:06                8920                              18-Jun-2024 14:06               13320
function.include-once.php                          18-Jun-2024 14:06                2783
function.include.php                               18-Jun-2024 14:06               25454
function.inet-ntop.php                             18-Jun-2024 14:06                6748
function.inet-pton.php                             18-Jun-2024 14:06                5316
function.inflate-add.php                           18-Jun-2024 14:06                7089
function.inflate-get-read-len.php                  18-Jun-2024 14:06                3776
function.inflate-get-status.php                    18-Jun-2024 14:06                3463
function.inflate-init.php                          18-Jun-2024 14:06                8139
function.ini-alter.php                             18-Jun-2024 14:06                1762
function.ini-get-all.php                           18-Jun-2024 14:06               11714
function.ini-get.php                               18-Jun-2024 14:06               12041
function.ini-parse-quantity.php                    18-Jun-2024 14:06                8434
function.ini-restore.php                           18-Jun-2024 14:06                7086
function.ini-set.php                               18-Jun-2024 14:06                7722
function.inotify-add-watch.php                     18-Jun-2024 14:06                5238
function.inotify-init.php                          18-Jun-2024 14:06               10291
function.inotify-queue-len.php                     18-Jun-2024 14:06                4415
function.inotify-read.php                          18-Jun-2024 14:06                5378
function.inotify-rm-watch.php                      18-Jun-2024 14:06                4102
function.intdiv.php                                18-Jun-2024 14:06                8338
function.interface-exists.php                      18-Jun-2024 14:06                6063
function.intl-error-name.php                       18-Jun-2024 14:06                5457
function.intl-get-error-code.php                   18-Jun-2024 14:06                5050
function.intl-get-error-message.php                18-Jun-2024 14:06                5029
function.intl-is-failure.php                       18-Jun-2024 14:06                5887
function.intval.php                                18-Jun-2024 14:06               15862
function.ip2long.php                               18-Jun-2024 14:06               10019
function.iptcembed.php                             18-Jun-2024 14:06               12418
function.iptcparse.php                             18-Jun-2024 14:06                5136                                  18-Jun-2024 14:06                8318                              18-Jun-2024 14:06                6409                               18-Jun-2024 14:06                6523                           18-Jun-2024 14:06               12351                          18-Jun-2024 14:06                7068                                18-Jun-2024 14:06                7795                             18-Jun-2024 14:06                1768                         18-Jun-2024 14:06                7639                               18-Jun-2024 14:06                7063                             18-Jun-2024 14:06                7149                              18-Jun-2024 14:06                7673                           18-Jun-2024 14:06                6221                                18-Jun-2024 14:06                7728                            18-Jun-2024 14:06                1761                           18-Jun-2024 14:06                6297                               18-Jun-2024 14:06                6593                               18-Jun-2024 14:06                1742                                18-Jun-2024 14:06                8186                               18-Jun-2024 14:06                6895                            18-Jun-2024 14:06               13359                             18-Jun-2024 14:06                8068                           18-Jun-2024 14:06                7520                               18-Jun-2024 14:06                1973                           18-Jun-2024 14:06                5695                             18-Jun-2024 14:06                9566                         18-Jun-2024 14:06                9031                             18-Jun-2024 14:06                7357                        18-Jun-2024 14:06               15011                            18-Jun-2024 14:06                2746                      18-Jun-2024 14:06                7734                           18-Jun-2024 14:06                7017                          18-Jun-2024 14:06                1803
function.isset.php                                 18-Jun-2024 14:06               18314
function.iterator-apply.php                        18-Jun-2024 14:06                7657
function.iterator-count.php                        18-Jun-2024 14:06                9586
function.iterator-to-array.php                     18-Jun-2024 14:06                8763
function.jddayofweek.php                           18-Jun-2024 14:06                4450
function.jdmonthname.php                           18-Jun-2024 14:06                5807
function.jdtofrench.php                            18-Jun-2024 14:06                3820
function.jdtogregorian.php                         18-Jun-2024 14:06                3871
function.jdtojewish.php                            18-Jun-2024 14:06                8394
function.jdtojulian.php                            18-Jun-2024 14:06                3762
function.jdtounix.php                              18-Jun-2024 14:06                5104
function.jewishtojd.php                            18-Jun-2024 14:06                5434
function.join.php                                  18-Jun-2024 14:06                1726
function.jpeg2wbmp.php                             18-Jun-2024 14:06                7462
function.json-decode.php                           18-Jun-2024 14:06               23035
function.json-encode.php                           18-Jun-2024 14:06               35448
function.json-last-error-msg.php                   18-Jun-2024 14:06                3501
function.json-last-error.php                       18-Jun-2024 14:06               15991
function.json-validate.php                         18-Jun-2024 14:06               10507
function.juliantojd.php                            18-Jun-2024 14:06                5557
function.key-exists.php                            18-Jun-2024 14:06                1803
function.key.php                                   18-Jun-2024 14:06                9158
function.krsort.php                                18-Jun-2024 14:06               10236
function.ksort.php                                 18-Jun-2024 14:06               12251
function.lcfirst.php                               18-Jun-2024 14:06                6737
function.lcg-value.php                             18-Jun-2024 14:06                6981
function.lchgrp.php                                18-Jun-2024 14:06                6945
function.lchown.php                                18-Jun-2024 14:06                6650
function.ldap-8859-to-t61.php                      18-Jun-2024 14:06                3735
function.ldap-add-ext.php                          18-Jun-2024 14:06                6454
function.ldap-add.php                              18-Jun-2024 14:06               11654
function.ldap-bind-ext.php                         18-Jun-2024 14:06                6668
function.ldap-bind.php                             18-Jun-2024 14:06               10850
function.ldap-close.php                            18-Jun-2024 14:06                1748
function.ldap-compare.php                          18-Jun-2024 14:06               11605
function.ldap-connect-wallet.php                   18-Jun-2024 14:06                4730
function.ldap-connect.php                          18-Jun-2024 14:06               11197
function.ldap-control-paged-result-response.php    18-Jun-2024 14:06                6904
function.ldap-control-paged-result.php             18-Jun-2024 14:06               16443
function.ldap-count-entries.php                    18-Jun-2024 14:06                6425
function.ldap-count-references.php                 18-Jun-2024 14:06                5307
function.ldap-delete-ext.php                       18-Jun-2024 14:06                5884
function.ldap-delete.php                           18-Jun-2024 14:06                6031
function.ldap-dn2ufn.php                           18-Jun-2024 14:06                3091
function.ldap-err2str.php                          18-Jun-2024 14:06                5330
function.ldap-errno.php                            18-Jun-2024 14:06                8519
function.ldap-error.php                            18-Jun-2024 14:06                5546
function.ldap-escape.php                           18-Jun-2024 14:06                6965
function.ldap-exop-passwd.php                      18-Jun-2024 14:06               11908
function.ldap-exop-refresh.php                     18-Jun-2024 14:06                6104
function.ldap-exop-sync.php                        18-Jun-2024 14:06                5937
function.ldap-exop-whoami.php                      18-Jun-2024 14:06                4344
function.ldap-exop.php                             18-Jun-2024 14:06               14196
function.ldap-explode-dn.php                       18-Jun-2024 14:06                4343
function.ldap-first-attribute.php                  18-Jun-2024 14:06                6242
function.ldap-first-entry.php                      18-Jun-2024 14:06                6603
function.ldap-first-reference.php                  18-Jun-2024 14:06                2514
function.ldap-free-result.php                      18-Jun-2024 14:06                4940
function.ldap-get-attributes.php                   18-Jun-2024 14:06                9366
function.ldap-get-dn.php                           18-Jun-2024 14:06                4776
function.ldap-get-entries.php                      18-Jun-2024 14:06                7280
function.ldap-get-option.php                       18-Jun-2024 14:06               17432
function.ldap-get-values-len.php                   18-Jun-2024 14:06                6361
function.ldap-get-values.php                       18-Jun-2024 14:06               10158
function.ldap-list.php                             18-Jun-2024 14:06               18604
function.ldap-mod-add.php                          18-Jun-2024 14:06                8083
function.ldap-mod-del.php                          18-Jun-2024 14:06                7212
function.ldap-mod-replace.php                      18-Jun-2024 14:06                7906
function.ldap-mod_add-ext.php                      18-Jun-2024 14:06                6439
function.ldap-mod_del-ext.php                      18-Jun-2024 14:06                6447
function.ldap-mod_replace-ext.php                  18-Jun-2024 14:06                6485
function.ldap-modify-batch.php                     18-Jun-2024 14:06               20831
function.ldap-modify.php                           18-Jun-2024 14:06                2177
function.ldap-next-attribute.php                   18-Jun-2024 14:06                5934
function.ldap-next-entry.php                       18-Jun-2024 14:06                6617
function.ldap-next-reference.php                   18-Jun-2024 14:06                2451
function.ldap-parse-exop.php                       18-Jun-2024 14:06                6702
function.ldap-parse-reference.php                  18-Jun-2024 14:06                2584
function.ldap-parse-result.php                     18-Jun-2024 14:06               10930
function.ldap-read.php                             18-Jun-2024 14:06               15991
function.ldap-rename-ext.php                       18-Jun-2024 14:06                6739
function.ldap-rename.php                           18-Jun-2024 14:06                8222
function.ldap-sasl-bind.php                        18-Jun-2024 14:06                7809
function.ldap-search.php                           18-Jun-2024 14:06               18982
function.ldap-set-option.php                       18-Jun-2024 14:06               21033
function.ldap-set-rebind-proc.php                  18-Jun-2024 14:06                3606
function.ldap-sort.php                             18-Jun-2024 14:06                8024
function.ldap-start-tls.php                        18-Jun-2024 14:06                2185
function.ldap-t61-to-8859.php                      18-Jun-2024 14:06                2354
function.ldap-unbind.php                           18-Jun-2024 14:06                4322
function.levenshtein.php                           18-Jun-2024 14:06               13974
function.libxml-clear-errors.php                   18-Jun-2024 14:06                3176
function.libxml-disable-entity-loader.php          18-Jun-2024 14:06                5894
function.libxml-get-errors.php                     18-Jun-2024 14:06               11220
function.libxml-get-external-entity-loader.php     18-Jun-2024 14:06                3970
function.libxml-get-last-error.php                 18-Jun-2024 14:06                3553
function.libxml-set-external-entity-loader.php     18-Jun-2024 14:06               11539
function.libxml-set-streams-context.php            18-Jun-2024 14:06                5570
function.libxml-use-internal-errors.php            18-Jun-2024 14:06                7610                                  18-Jun-2024 14:06                6734
function.linkinfo.php                              18-Jun-2024 14:06                5300
function.list.php                                  18-Jun-2024 14:06               18746
function.localeconv.php                            18-Jun-2024 14:06               11797
function.localtime.php                             18-Jun-2024 14:06               10809
function.log.php                                   18-Jun-2024 14:06                4603
function.log10.php                                 18-Jun-2024 14:06                3009
function.log1p.php                                 18-Jun-2024 14:06                4128
function.long2ip.php                               18-Jun-2024 14:06                5097
function.lstat.php                                 18-Jun-2024 14:06                7605
function.ltrim.php                                 18-Jun-2024 14:06               10367
function.lzf-compress.php                          18-Jun-2024 14:06                3205
function.lzf-decompress.php                        18-Jun-2024 14:06                3340
function.lzf-optimized-for.php                     18-Jun-2024 14:06                2553
function.mail.php                                  18-Jun-2024 14:06               30435
function.mailparse-determine-best-xfer-encoding..> 18-Jun-2024 14:06                4702
function.mailparse-msg-create.php                  18-Jun-2024 14:06                3781
function.mailparse-msg-extract-part-file.php       18-Jun-2024 14:06                6103
function.mailparse-msg-extract-part.php            18-Jun-2024 14:06                4519
function.mailparse-msg-extract-whole-part-file.php 18-Jun-2024 14:06                4477
function.mailparse-msg-free.php                    18-Jun-2024 14:06                3942
function.mailparse-msg-get-part-data.php           18-Jun-2024 14:06                2787
function.mailparse-msg-get-part.php                18-Jun-2024 14:06                3071
function.mailparse-msg-get-structure.php           18-Jun-2024 14:06                2792
function.mailparse-msg-parse-file.php              18-Jun-2024 14:06                4893
function.mailparse-msg-parse.php                   18-Jun-2024 14:06                4069
function.mailparse-rfc822-parse-addresses.php      18-Jun-2024 14:06                6294
function.mailparse-stream-encode.php               18-Jun-2024 14:06                6371
function.mailparse-uudecode-all.php                18-Jun-2024 14:06                7599
function.max.php                                   18-Jun-2024 14:06               14273
function.mb-check-encoding.php                     18-Jun-2024 14:06                6609
function.mb-chr.php                                18-Jun-2024 14:06                8168
function.mb-convert-case.php                       18-Jun-2024 14:06               13609
function.mb-convert-encoding.php                   18-Jun-2024 14:06               14382
function.mb-convert-kana.php                       18-Jun-2024 14:06               11424
function.mb-convert-variables.php                  18-Jun-2024 14:06                8509
function.mb-decode-mimeheader.php                  18-Jun-2024 14:06                3728
function.mb-decode-numericentity.php               18-Jun-2024 14:06               35120
function.mb-detect-encoding.php                    18-Jun-2024 14:06               19260
function.mb-detect-order.php                       18-Jun-2024 14:06               11090
function.mb-encode-mimeheader.php                  18-Jun-2024 14:06               11174
function.mb-encode-numericentity.php               18-Jun-2024 14:06               13873
function.mb-encoding-aliases.php                   18-Jun-2024 14:06                7219
function.mb-ereg-match.php                         18-Jun-2024 14:06                6645
function.mb-ereg-replace-callback.php              18-Jun-2024 14:06               14583
function.mb-ereg-replace.php                       18-Jun-2024 14:06                8719
function.mb-ereg-search-getpos.php                 18-Jun-2024 14:06                4652
function.mb-ereg-search-getregs.php                18-Jun-2024 14:06                5529
function.mb-ereg-search-init.php                   18-Jun-2024 14:06                7247
function.mb-ereg-search-pos.php                    18-Jun-2024 14:06                7216
function.mb-ereg-search-regs.php                   18-Jun-2024 14:06                6811
function.mb-ereg-search-setpos.php                 18-Jun-2024 14:06                5660
function.mb-ereg-search.php                        18-Jun-2024 14:06                6776
function.mb-ereg.php                               18-Jun-2024 14:06                8195
function.mb-eregi-replace.php                      18-Jun-2024 14:06                8815
function.mb-eregi.php                              18-Jun-2024 14:06                8169
function.mb-get-info.php                           18-Jun-2024 14:06                7277
function.mb-http-input.php                         18-Jun-2024 14:06                6146
function.mb-http-output.php                        18-Jun-2024 14:06                6189
function.mb-internal-encoding.php                  18-Jun-2024 14:06                9074
function.mb-language.php                           18-Jun-2024 14:06                7738
function.mb-list-encodings.php                     18-Jun-2024 14:06                5566
function.mb-ord.php                                18-Jun-2024 14:06                7840
function.mb-output-handler.php                     18-Jun-2024 14:06                6208
function.mb-parse-str.php                          18-Jun-2024 14:06                5815
function.mb-preferred-mime-name.php                18-Jun-2024 14:06                5001
function.mb-regex-encoding.php                     18-Jun-2024 14:06                5828
function.mb-regex-set-options.php                  18-Jun-2024 14:06               10774
function.mb-scrub.php                              18-Jun-2024 14:06                5041
function.mb-send-mail.php                          18-Jun-2024 14:06               12443
function.mb-split.php                              18-Jun-2024 14:06                5715
function.mb-str-pad.php                            18-Jun-2024 14:06                9660
function.mb-str-split.php                          18-Jun-2024 14:06                6453
function.mb-strcut.php                             18-Jun-2024 14:06                9038
function.mb-strimwidth.php                         18-Jun-2024 14:06                9545
function.mb-stripos.php                            18-Jun-2024 14:06                7632
function.mb-stristr.php                            18-Jun-2024 14:06                7982
function.mb-strlen.php                             18-Jun-2024 14:06                6059
function.mb-strpos.php                             18-Jun-2024 14:06                7937
function.mb-strrchr.php                            18-Jun-2024 14:06                7853
function.mb-strrichr.php                           18-Jun-2024 14:06                7982
function.mb-strripos.php                           18-Jun-2024 14:06                7505
function.mb-strrpos.php                            18-Jun-2024 14:06                8199
function.mb-strstr.php                             18-Jun-2024 14:06                7735
function.mb-strtolower.php                         18-Jun-2024 14:06                8421
function.mb-strtoupper.php                         18-Jun-2024 14:06                8424
function.mb-strwidth.php                           18-Jun-2024 14:06               10326
function.mb-substitute-character.php               18-Jun-2024 14:06                8682
function.mb-substr-count.php                       18-Jun-2024 14:06                6798
function.mb-substr.php                             18-Jun-2024 14:06                7670
function.mcrypt-create-iv.php                      18-Jun-2024 14:06                8040
function.mcrypt-decrypt.php                        18-Jun-2024 14:06                6864
function.mcrypt-enc-get-algorithms-name.php        18-Jun-2024 14:06                5722
function.mcrypt-enc-get-block-size.php             18-Jun-2024 14:06                3300
function.mcrypt-enc-get-iv-size.php                18-Jun-2024 14:06                3776
function.mcrypt-enc-get-key-size.php               18-Jun-2024 14:06                3416
function.mcrypt-enc-get-modes-name.php             18-Jun-2024 14:06                5682
function.mcrypt-enc-get-supported-key-sizes.php    18-Jun-2024 14:06                5589
function.mcrypt-enc-is-block-algorithm-mode.php    18-Jun-2024 14:06                3900
function.mcrypt-enc-is-block-algorithm.php         18-Jun-2024 14:06                3622
function.mcrypt-enc-is-block-mode.php              18-Jun-2024 14:06                3799
function.mcrypt-enc-self-test.php                  18-Jun-2024 14:06                3521
function.mcrypt-encrypt.php                        18-Jun-2024 14:06               15754
function.mcrypt-generic-deinit.php                 18-Jun-2024 14:06                4776
function.mcrypt-generic-init.php                   18-Jun-2024 14:06                6534
function.mcrypt-generic.php                        18-Jun-2024 14:06                7564
function.mcrypt-get-block-size.php                 18-Jun-2024 14:06                7372
function.mcrypt-get-cipher-name.php                18-Jun-2024 14:06                5547
function.mcrypt-get-iv-size.php                    18-Jun-2024 14:06                7790
function.mcrypt-get-key-size.php                   18-Jun-2024 14:06                7751
function.mcrypt-list-algorithms.php                18-Jun-2024 14:06                5379
function.mcrypt-list-modes.php                     18-Jun-2024 14:06                5274
function.mcrypt-module-close.php                   18-Jun-2024 14:06                3950
function.mcrypt-module-get-algo-block-size.php     18-Jun-2024 14:06                3932
function.mcrypt-module-get-algo-key-size.php       18-Jun-2024 14:06                4014
function.mcrypt-module-get-supported-key-sizes.php 18-Jun-2024 14:06                5434
function.mcrypt-module-is-block-algorithm-mode.php 18-Jun-2024 14:06                5065
function.mcrypt-module-is-block-algorithm.php      18-Jun-2024 14:06                4459
function.mcrypt-module-is-block-mode.php           18-Jun-2024 14:06                5052
function.mcrypt-module-open.php                    18-Jun-2024 14:06               15775
function.mcrypt-module-self-test.php               18-Jun-2024 14:06                5645
function.md5-file.php                              18-Jun-2024 14:06                5702
function.md5.php                                   18-Jun-2024 14:06                6733
function.mdecrypt-generic.php                      18-Jun-2024 14:06               12242
function.memcache-debug.php                        18-Jun-2024 14:06                4303
function.memory-get-peak-usage.php                 18-Jun-2024 14:06                4388
function.memory-get-usage.php                      18-Jun-2024 14:06                6417
function.memory-reset-peak-usage.php               18-Jun-2024 14:06                5519
function.metaphone.php                             18-Jun-2024 14:06                9547
function.method-exists.php                         18-Jun-2024 14:06                7458
function.mhash-count.php                           18-Jun-2024 14:06                5177
function.mhash-get-block-size.php                  18-Jun-2024 14:06                5047
function.mhash-get-hash-name.php                   18-Jun-2024 14:06                4949
function.mhash-keygen-s2k.php                      18-Jun-2024 14:06                6633
function.mhash.php                                 18-Jun-2024 14:06                5555
function.microtime.php                             18-Jun-2024 14:06                9357
function.mime-content-type.php                     18-Jun-2024 14:06                5660
function.min.php                                   18-Jun-2024 14:06               14800
function.mkdir.php                                 18-Jun-2024 14:06               11605
function.mktime.php                                18-Jun-2024 14:06               22365                          18-Jun-2024 14:06               21601
function.mongodb.bson-fromjson.php                 18-Jun-2024 14:06                6405
function.mongodb.bson-fromphp.php                  18-Jun-2024 14:06                6868
function.mongodb.bson-tocanonicalextendedjson.php  18-Jun-2024 14:06               14776
function.mongodb.bson-tojson.php                   18-Jun-2024 14:06               15982
function.mongodb.bson-tophp.php                    18-Jun-2024 14:06               10897
function.mongodb.bson-torelaxedextendedjson.php    18-Jun-2024 14:06               14412
function.mongodb.driver.monitoring.addsubscribe..> 18-Jun-2024 14:06                6085
function.mongodb.driver.monitoring.removesubscr..> 18-Jun-2024 14:06                5710
function.move-uploaded-file.php                    18-Jun-2024 14:06               10102
function.mqseries-back.php                         18-Jun-2024 14:06                7181
function.mqseries-begin.php                        18-Jun-2024 14:06                7956
function.mqseries-close.php                        18-Jun-2024 14:06                7061
function.mqseries-cmit.php                         18-Jun-2024 14:06                6873
function.mqseries-conn.php                         18-Jun-2024 14:06                6455
function.mqseries-connx.php                        18-Jun-2024 14:06               13370
function.mqseries-disc.php                         18-Jun-2024 14:06                6053
function.mqseries-get.php                          18-Jun-2024 14:06               12982
function.mqseries-inq.php                          18-Jun-2024 14:06                9917
function.mqseries-open.php                         18-Jun-2024 14:06                7732
function.mqseries-put.php                          18-Jun-2024 14:06               13324
function.mqseries-put1.php                         18-Jun-2024 14:06                7000
function.mqseries-set.php                          18-Jun-2024 14:06                6749
function.mqseries-strerror.php                     18-Jun-2024 14:06                4545
function.msg-get-queue.php                         18-Jun-2024 14:06                6798
function.msg-queue-exists.php                      18-Jun-2024 14:06                3902
function.msg-receive.php                           18-Jun-2024 14:06               14201
function.msg-remove-queue.php                      18-Jun-2024 14:06                5389
function.msg-send.php                              18-Jun-2024 14:06               11425
function.msg-set-queue.php                         18-Jun-2024 14:06                6115
function.msg-stat-queue.php                        18-Jun-2024 14:06                7970                         18-Jun-2024 14:06                3987                               18-Jun-2024 14:06               13418                              18-Jun-2024 14:06               11148
function.mysql-affected-rows.php                   18-Jun-2024 14:06               13938
function.mysql-client-encoding.php                 18-Jun-2024 14:06                6965
function.mysql-close.php                           18-Jun-2024 14:06                8834
function.mysql-connect.php                         18-Jun-2024 14:06               19770
function.mysql-create-db.php                       18-Jun-2024 14:06                9579
function.mysql-data-seek.php                       18-Jun-2024 14:06               13394
function.mysql-db-name.php                         18-Jun-2024 14:06                8482
function.mysql-db-query.php                        18-Jun-2024 14:06               11277
function.mysql-drop-db.php                         18-Jun-2024 14:06                8812
function.mysql-errno.php                           18-Jun-2024 14:06                9057
function.mysql-error.php                           18-Jun-2024 14:06                9137
function.mysql-escape-string.php                   18-Jun-2024 14:06                7329
function.mysql-fetch-array.php                     18-Jun-2024 14:06               17495
function.mysql-fetch-assoc.php                     18-Jun-2024 14:06               13312
function.mysql-fetch-field.php                     18-Jun-2024 14:06               14550
function.mysql-fetch-lengths.php                   18-Jun-2024 14:06                8402
function.mysql-fetch-object.php                    18-Jun-2024 14:06               13569
function.mysql-fetch-row.php                       18-Jun-2024 14:06                9010
function.mysql-field-flags.php                     18-Jun-2024 14:06                9475
function.mysql-field-len.php                       18-Jun-2024 14:06                7667
function.mysql-field-name.php                      18-Jun-2024 14:06               10011
function.mysql-field-seek.php                      18-Jun-2024 14:06                5805
function.mysql-field-table.php                     18-Jun-2024 14:06                8336
function.mysql-field-type.php                      18-Jun-2024 14:06               12488
function.mysql-free-result.php                     18-Jun-2024 14:06                9072
function.mysql-get-client-info.php                 18-Jun-2024 14:06                5773
function.mysql-get-host-info.php                   18-Jun-2024 14:06                8032
function.mysql-get-proto-info.php                  18-Jun-2024 14:06                7458
function.mysql-get-server-info.php                 18-Jun-2024 14:06                7956
function.mysql-info.php                            18-Jun-2024 14:06                7457
function.mysql-insert-id.php                       18-Jun-2024 14:06                9790
function.mysql-list-dbs.php                        18-Jun-2024 14:06                9883
function.mysql-list-fields.php                     18-Jun-2024 14:06               10020
function.mysql-list-processes.php                  18-Jun-2024 14:06                8394
function.mysql-list-tables.php                     18-Jun-2024 14:06               10773
function.mysql-num-fields.php                      18-Jun-2024 14:06                7387
function.mysql-num-rows.php                        18-Jun-2024 14:06                9060
function.mysql-pconnect.php                        18-Jun-2024 14:06                9993
function.mysql-ping.php                            18-Jun-2024 14:06                9004
function.mysql-query.php                           18-Jun-2024 14:06               16102
function.mysql-real-escape-string.php              18-Jun-2024 14:06               17769
function.mysql-result.php                          18-Jun-2024 14:06               11103
function.mysql-select-db.php                       18-Jun-2024 14:06                8791
function.mysql-set-charset.php                     18-Jun-2024 14:06                6907
function.mysql-stat.php                            18-Jun-2024 14:06               10458
function.mysql-tablename.php                       18-Jun-2024 14:06                8987
function.mysql-thread-id.php                       18-Jun-2024 14:06                7879
function.mysql-unbuffered-query.php                18-Jun-2024 14:06                8530
function.mysql-xdevapi-expression.php              18-Jun-2024 14:06                5157
function.mysql-xdevapi-getsession.php              18-Jun-2024 14:06               15473
function.mysqli-connect.php                        18-Jun-2024 14:06                2589
function.mysqli-escape-string.php                  18-Jun-2024 14:06                2028
function.mysqli-execute.php                        18-Jun-2024 14:06                2679
function.mysqli-get-client-stats.php               18-Jun-2024 14:06                8802
function.mysqli-get-links-stats.php                18-Jun-2024 14:06                3983
function.mysqli-report.php                         18-Jun-2024 14:06                1815
function.mysqli-set-opt.php                        18-Jun-2024 14:06                1924
function.natcasesort.php                           18-Jun-2024 14:06                8963
function.natsort.php                               18-Jun-2024 14:06               12515                    18-Jun-2024 14:06                5751                                  18-Jun-2024 14:06               11762
function.ngettext.php                              18-Jun-2024 14:06                6480                           18-Jun-2024 14:06               21987
function.nl2br.php                                 18-Jun-2024 14:06                7865
function.number-format.php                         18-Jun-2024 14:06               10235
function.oauth-get-sbs.php                         18-Jun-2024 14:06                3467
function.oauth-urlencode.php                       18-Jun-2024 14:06                2847
function.ob-clean.php                              18-Jun-2024 14:06                5423
function.ob-end-clean.php                          18-Jun-2024 14:06                6827
function.ob-end-flush.php                          18-Jun-2024 14:06                6843
function.ob-flush.php                              18-Jun-2024 14:06                5686
function.ob-get-clean.php                          18-Jun-2024 14:06                8126
function.ob-get-contents.php                       18-Jun-2024 14:06                5244
function.ob-get-flush.php                          18-Jun-2024 14:06                7950
function.ob-get-length.php                         18-Jun-2024 14:06                5171
function.ob-get-level.php                          18-Jun-2024 14:06                4284
function.ob-get-status.php                         18-Jun-2024 14:06               12341
function.ob-gzhandler.php                          18-Jun-2024 14:06                6994
function.ob-iconv-handler.php                      18-Jun-2024 14:06                5937
function.ob-implicit-flush.php                     18-Jun-2024 14:06                6214
function.ob-list-handlers.php                      18-Jun-2024 14:06               15599
function.ob-start.php                              18-Jun-2024 14:06               18362
function.ob-tidyhandler.php                        18-Jun-2024 14:06                4766
function.oci-bind-array-by-name.php                18-Jun-2024 14:06               15238
function.oci-bind-by-name.php                      18-Jun-2024 14:06               85601
function.oci-cancel.php                            18-Jun-2024 14:06                3023
function.oci-client-version.php                    18-Jun-2024 14:06                4477
function.oci-close.php                             18-Jun-2024 14:06               21182
function.oci-commit.php                            18-Jun-2024 14:06               12717
function.oci-connect.php                           18-Jun-2024 14:06               39369
function.oci-define-by-name.php                    18-Jun-2024 14:06               26041
function.oci-error.php                             18-Jun-2024 14:06               12767
function.oci-execute.php                           18-Jun-2024 14:06               24100
function.oci-fetch-all.php                         18-Jun-2024 14:06               28367
function.oci-fetch-array.php                       18-Jun-2024 14:06               68995
function.oci-fetch-assoc.php                       18-Jun-2024 14:06               10033
function.oci-fetch-object.php                      18-Jun-2024 14:06               20421
function.oci-fetch-row.php                         18-Jun-2024 14:06                9919
function.oci-fetch.php                             18-Jun-2024 14:06               15138
function.oci-field-is-null.php                     18-Jun-2024 14:06                8334
function.oci-field-name.php                        18-Jun-2024 14:06               10345
function.oci-field-precision.php                   18-Jun-2024 14:06                9262
function.oci-field-scale.php                       18-Jun-2024 14:06                9372
function.oci-field-size.php                        18-Jun-2024 14:06               10750
function.oci-field-type-raw.php                    18-Jun-2024 14:06                8421
function.oci-field-type.php                        18-Jun-2024 14:06               11182
function.oci-free-descriptor.php                   18-Jun-2024 14:06                3906
function.oci-free-statement.php                    18-Jun-2024 14:06                3364
function.oci-get-implicit-resultset.php            18-Jun-2024 14:06               29940
function.oci-internal-debug.php                    18-Jun-2024 14:06                3538
function.oci-lob-copy.php                          18-Jun-2024 14:06                5309
function.oci-lob-is-equal.php                      18-Jun-2024 14:06                3594
function.oci-new-collection.php                    18-Jun-2024 14:06                5710
function.oci-new-connect.php                       18-Jun-2024 14:06               19778
function.oci-new-cursor.php                        18-Jun-2024 14:06                8319
function.oci-new-descriptor.php                    18-Jun-2024 14:06               19471
function.oci-num-fields.php                        18-Jun-2024 14:06                7318
function.oci-num-rows.php                          18-Jun-2024 14:06                8556
function.oci-parse.php                             18-Jun-2024 14:06               13775
function.oci-password-change.php                   18-Jun-2024 14:06               15065
function.oci-pconnect.php                          18-Jun-2024 14:06               18278
function.oci-register-taf-callback.php             18-Jun-2024 14:06                6771
function.oci-result.php                            18-Jun-2024 14:06                9790
function.oci-rollback.php                          18-Jun-2024 14:06               16182
function.oci-server-version.php                    18-Jun-2024 14:06                5168
function.oci-set-action.php                        18-Jun-2024 14:06                9877
function.oci-set-call-timout.php                   18-Jun-2024 14:06                7447
function.oci-set-client-identifier.php             18-Jun-2024 14:06                9558
function.oci-set-client-info.php                   18-Jun-2024 14:06                9756
function.oci-set-db-operation.php                  18-Jun-2024 14:06                9005
function.oci-set-edition.php                       18-Jun-2024 14:06               11433
function.oci-set-module-name.php                   18-Jun-2024 14:06                9981
function.oci-set-prefetch-lob.php                  18-Jun-2024 14:06               10196
function.oci-set-prefetch.php                      18-Jun-2024 14:06               24386
function.oci-statement-type.php                    18-Jun-2024 14:06                7619
function.oci-unregister-taf-callback.php           18-Jun-2024 14:06                4136
function.ocibindbyname.php                         18-Jun-2024 14:06                2204
function.ocicancel.php                             18-Jun-2024 14:06                2131
function.ocicloselob.php                           18-Jun-2024 14:06                2128
function.ocicollappend.php                         18-Jun-2024 14:06                2193
function.ocicollassign.php                         18-Jun-2024 14:06                2211
function.ocicollassignelem.php                     18-Jun-2024 14:06                2256
function.ocicollgetelem.php                        18-Jun-2024 14:06                2223
function.ocicollmax.php                            18-Jun-2024 14:06                2175
function.ocicollsize.php                           18-Jun-2024 14:06                2178
function.ocicolltrim.php                           18-Jun-2024 14:06                2188
function.ocicolumnisnull.php                       18-Jun-2024 14:06                2216
function.ocicolumnname.php                         18-Jun-2024 14:06                2208
function.ocicolumnprecision.php                    18-Jun-2024 14:06                2251
function.ocicolumnscale.php                        18-Jun-2024 14:06                2215
function.ocicolumnsize.php                         18-Jun-2024 14:06                2196
function.ocicolumntype.php                         18-Jun-2024 14:06                2200
function.ocicolumntyperaw.php                      18-Jun-2024 14:06                2223
function.ocicommit.php                             18-Jun-2024 14:06                2160
function.ocidefinebyname.php                       18-Jun-2024 14:06                2206
function.ocierror.php                              18-Jun-2024 14:06                2137
function.ociexecute.php                            18-Jun-2024 14:06                2141
function.ocifetch.php                              18-Jun-2024 14:06                2131
function.ocifetchinto.php                          18-Jun-2024 14:06                2896
function.ocifetchstatement.php                     18-Jun-2024 14:06                2224
function.ocifreecollection.php                     18-Jun-2024 14:06                2238
function.ocifreecursor.php                         18-Jun-2024 14:06                2214
function.ocifreedesc.php                           18-Jun-2024 14:06                2154
function.ocifreestatement.php                      18-Jun-2024 14:06                2233
function.ociinternaldebug.php                      18-Jun-2024 14:06                2247
function.ociloadlob.php                            18-Jun-2024 14:06                2139
function.ocilogoff.php                             18-Jun-2024 14:06                2130
function.ocilogon.php                              18-Jun-2024 14:06                2145
function.ocinewcollection.php                      18-Jun-2024 14:06                2231
function.ocinewcursor.php                          18-Jun-2024 14:06                2199
function.ocinewdescriptor.php                      18-Jun-2024 14:06                2221
function.ocinlogon.php                             18-Jun-2024 14:06                2170
function.ocinumcols.php                            18-Jun-2024 14:06                2155
function.ociparse.php                              18-Jun-2024 14:06                2125
function.ociplogon.php                             18-Jun-2024 14:06                2140
function.ociresult.php                             18-Jun-2024 14:06                2138
function.ocirollback.php                           18-Jun-2024 14:06                2160
function.ocirowcount.php                           18-Jun-2024 14:06                2162
function.ocisavelob.php                            18-Jun-2024 14:06                2139
function.ocisavelobfile.php                        18-Jun-2024 14:06                2177
function.ociserverversion.php                      18-Jun-2024 14:06                2235
function.ocisetprefetch.php                        18-Jun-2024 14:06                2221
function.ocistatementtype.php                      18-Jun-2024 14:06                2241
function.ociwritelobtofile.php                     18-Jun-2024 14:06                2218
function.ociwritetemporarylob.php                  18-Jun-2024 14:06                2241
function.octdec.php                                18-Jun-2024 14:06                7229
function.odbc-autocommit.php                       18-Jun-2024 14:06                6708
function.odbc-binmode.php                          18-Jun-2024 14:06                8392
function.odbc-close-all.php                        18-Jun-2024 14:06                2969
function.odbc-close.php                            18-Jun-2024 14:06                3301
function.odbc-columnprivileges.php                 18-Jun-2024 14:06                9925
function.odbc-columns.php                          18-Jun-2024 14:06               12938
function.odbc-commit.php                           18-Jun-2024 14:06                3058
function.odbc-connect.php                          18-Jun-2024 14:06                9740
function.odbc-connection-string-is-quoted.php      18-Jun-2024 14:06                4431
function.odbc-connection-string-quote.php          18-Jun-2024 14:06                7063
function.odbc-connection-string-should-quote.php   18-Jun-2024 14:06                4779
function.odbc-cursor.php                           18-Jun-2024 14:06                2955
function.odbc-data-source.php                      18-Jun-2024 14:06                6921
function.odbc-do.php                               18-Jun-2024 14:06                1731
function.odbc-error.php                            18-Jun-2024 14:06                4882
function.odbc-errormsg.php                         18-Jun-2024 14:06                4958
function.odbc-exec.php                             18-Jun-2024 14:06                4543
function.odbc-execute.php                          18-Jun-2024 14:06                8377
function.odbc-fetch-array.php                      18-Jun-2024 14:06                4921
function.odbc-fetch-into.php                       18-Jun-2024 14:06                5754
function.odbc-fetch-object.php                     18-Jun-2024 14:06                4912
function.odbc-fetch-row.php                        18-Jun-2024 14:06                5649
function.odbc-field-len.php                        18-Jun-2024 14:06                3894
function.odbc-field-name.php                       18-Jun-2024 14:06                3422
function.odbc-field-num.php                        18-Jun-2024 14:06                3467
function.odbc-field-precision.php                  18-Jun-2024 14:06                2355
function.odbc-field-scale.php                      18-Jun-2024 14:06                3461
function.odbc-field-type.php                       18-Jun-2024 14:06                3421
function.odbc-foreignkeys.php                      18-Jun-2024 14:06               10612
function.odbc-free-result.php                      18-Jun-2024 14:06                3955
function.odbc-gettypeinfo.php                      18-Jun-2024 14:06                5143
function.odbc-longreadlen.php                      18-Jun-2024 14:06                4405
function.odbc-next-result.php                      18-Jun-2024 14:06               10154
function.odbc-num-fields.php                       18-Jun-2024 14:06                2938
function.odbc-num-rows.php                         18-Jun-2024 14:06                3819
function.odbc-pconnect.php                         18-Jun-2024 14:06                5547
function.odbc-prepare.php                          18-Jun-2024 14:06                7410
function.odbc-primarykeys.php                      18-Jun-2024 14:06                8776
function.odbc-procedurecolumns.php                 18-Jun-2024 14:06               13210
function.odbc-procedures.php                       18-Jun-2024 14:06               10887
function.odbc-result-all.php                       18-Jun-2024 14:06                4942
function.odbc-result.php                           18-Jun-2024 14:06                6839
function.odbc-rollback.php                         18-Jun-2024 14:06                3079
function.odbc-setoption.php                        18-Jun-2024 14:06                8705
function.odbc-specialcolumns.php                   18-Jun-2024 14:06                9172
function.odbc-statistics.php                       18-Jun-2024 14:06               10883
function.odbc-tableprivileges.php                  18-Jun-2024 14:06                9361
function.odbc-tables.php                           18-Jun-2024 14:06               14885
function.opcache-compile-file.php                  18-Jun-2024 14:06                4371
function.opcache-get-configuration.php             18-Jun-2024 14:06                3722
function.opcache-get-status.php                    18-Jun-2024 14:06                4377
function.opcache-invalidate.php                    18-Jun-2024 14:06                4962
function.opcache-is-script-cached.php              18-Jun-2024 14:06                3800
function.opcache-reset.php                         18-Jun-2024 14:06                3919
function.openal-buffer-create.php                  18-Jun-2024 14:06                3204
function.openal-buffer-data.php                    18-Jun-2024 14:06                5481
function.openal-buffer-destroy.php                 18-Jun-2024 14:06                3468
function.openal-buffer-get.php                     18-Jun-2024 14:06                4337
function.openal-buffer-loadwav.php                 18-Jun-2024 14:06                4104
function.openal-context-create.php                 18-Jun-2024 14:06                3675
function.openal-context-current.php                18-Jun-2024 14:06                3546
function.openal-context-destroy.php                18-Jun-2024 14:06                3520
function.openal-context-process.php                18-Jun-2024 14:06                3980
function.openal-context-suspend.php                18-Jun-2024 14:06                3974
function.openal-device-close.php                   18-Jun-2024 14:06                3527
function.openal-device-open.php                    18-Jun-2024 14:06                3811
function.openal-listener-get.php                   18-Jun-2024 14:06                3845
function.openal-listener-set.php                   18-Jun-2024 14:06                4319
function.openal-source-create.php                  18-Jun-2024 14:06                3451
function.openal-source-destroy.php                 18-Jun-2024 14:06                3504
function.openal-source-get.php                     18-Jun-2024 14:06                6025
function.openal-source-pause.php                   18-Jun-2024 14:06                3898
function.openal-source-play.php                    18-Jun-2024 14:06                3897
function.openal-source-rewind.php                  18-Jun-2024 14:06                3907
function.openal-source-set.php                     18-Jun-2024 14:06                6935
function.openal-source-stop.php                    18-Jun-2024 14:06                3879
function.openal-stream.php                         18-Jun-2024 14:06                4946
function.opendir.php                               18-Jun-2024 14:06                8910
function.openlog.php                               18-Jun-2024 14:06               12338
function.openssl-cipher-iv-length.php              18-Jun-2024 14:06                5038
function.openssl-cipher-key-length.php             18-Jun-2024 14:06                4892
function.openssl-cms-decrypt.php                   18-Jun-2024 14:06                6118
function.openssl-cms-encrypt.php                   18-Jun-2024 14:06                7345
function.openssl-cms-read.php                      18-Jun-2024 14:06                3589
function.openssl-cms-sign.php                      18-Jun-2024 14:06                9008
function.openssl-cms-verify.php                    18-Jun-2024 14:06                8032
function.openssl-csr-export-to-file.php            18-Jun-2024 14:06                9313
function.openssl-csr-export.php                    18-Jun-2024 14:06                9322
function.openssl-csr-get-public-key.php            18-Jun-2024 14:06                9534
function.openssl-csr-get-subject.php               18-Jun-2024 14:06               10336
function.openssl-csr-new.php                       18-Jun-2024 14:06               24268
function.openssl-csr-sign.php                      18-Jun-2024 14:06               15433
function.openssl-decrypt.php                       18-Jun-2024 14:06                9211
function.openssl-dh-compute-key.php                18-Jun-2024 14:06               18294
function.openssl-digest.php                        18-Jun-2024 14:06                5374
function.openssl-encrypt.php                       18-Jun-2024 14:06               19869
function.openssl-error-string.php                  18-Jun-2024 14:06                4357
function.openssl-free-key.php                      18-Jun-2024 14:06                4236
function.openssl-get-cert-locations.php            18-Jun-2024 14:06                4530
function.openssl-get-cipher-methods.php            18-Jun-2024 14:06               14839
function.openssl-get-curve-names.php               18-Jun-2024 14:06                7890
function.openssl-get-md-methods.php                18-Jun-2024 14:06                7632
function.openssl-get-privatekey.php                18-Jun-2024 14:06                1956
function.openssl-get-publickey.php                 18-Jun-2024 14:06                1927
function.openssl-open.php                          18-Jun-2024 14:06               11648
function.openssl-pbkdf2.php                        18-Jun-2024 14:06                8358
function.openssl-pkcs12-export-to-file.php         18-Jun-2024 14:06                8487
function.openssl-pkcs12-export.php                 18-Jun-2024 14:06                8595
function.openssl-pkcs12-read.php                   18-Jun-2024 14:06                6481
function.openssl-pkcs7-decrypt.php                 18-Jun-2024 14:06                8667
function.openssl-pkcs7-encrypt.php                 18-Jun-2024 14:06               12165
function.openssl-pkcs7-read.php                    18-Jun-2024 14:06                7525
function.openssl-pkcs7-sign.php                    18-Jun-2024 14:06               13545
function.openssl-pkcs7-verify.php                  18-Jun-2024 14:06                9346
function.openssl-pkey-derive.php                   18-Jun-2024 14:06                9022
function.openssl-pkey-export-to-file.php           18-Jun-2024 14:06                7495
function.openssl-pkey-export.php                   18-Jun-2024 14:06                7479
function.openssl-pkey-free.php                     18-Jun-2024 14:06                4538
function.openssl-pkey-get-details.php              18-Jun-2024 14:06               11078
function.openssl-pkey-get-private.php              18-Jun-2024 14:06                7075
function.openssl-pkey-get-public.php               18-Jun-2024 14:06                6144
function.openssl-pkey-new.php                      18-Jun-2024 14:06                7847
function.openssl-private-decrypt.php               18-Jun-2024 14:06                7873
function.openssl-private-encrypt.php               18-Jun-2024 14:06                7429
function.openssl-public-decrypt.php                18-Jun-2024 14:06                7424
function.openssl-public-encrypt.php                18-Jun-2024 14:06                7781
function.openssl-random-pseudo-bytes.php           18-Jun-2024 14:06                9858
function.openssl-seal.php                          18-Jun-2024 14:06               13131
function.openssl-sign.php                          18-Jun-2024 14:06               14082
function.openssl-spki-export-challenge.php         18-Jun-2024 14:06                8630
function.openssl-spki-export.php                   18-Jun-2024 14:06                9461
function.openssl-spki-new.php                      18-Jun-2024 14:06               10431
function.openssl-spki-verify.php                   18-Jun-2024 14:06                8729
function.openssl-verify.php                        18-Jun-2024 14:06               14470
function.openssl-x509-check-private-key.php        18-Jun-2024 14:06                6734
function.openssl-x509-checkpurpose.php             18-Jun-2024 14:06                8503
function.openssl-x509-export-to-file.php           18-Jun-2024 14:06                5761
function.openssl-x509-export.php                   18-Jun-2024 14:06                5814
function.openssl-x509-fingerprint.php              18-Jun-2024 14:06                6096
function.openssl-x509-free.php                     18-Jun-2024 14:06                4479
function.openssl-x509-parse.php                    18-Jun-2024 14:06                5569
function.openssl-x509-read.php                     18-Jun-2024 14:06                5206
function.openssl-x509-verify.php                   18-Jun-2024 14:06               13291
function.ord.php                                   18-Jun-2024 14:06                8405
function.output-add-rewrite-var.php                18-Jun-2024 14:06               11205
function.output-reset-rewrite-vars.php             18-Jun-2024 14:06                7578
function.pack.php                                  18-Jun-2024 14:06               17411
function.parse-ini-file.php                        18-Jun-2024 14:06               25208
function.parse-ini-string.php                      18-Jun-2024 14:06                8778
function.parse-str.php                             18-Jun-2024 14:06               11545
function.parse-url.php                             18-Jun-2024 14:06               19109
function.passthru.php                              18-Jun-2024 14:06                9147
function.password-algos.php                        18-Jun-2024 14:06                3925
function.password-get-info.php                     18-Jun-2024 14:06                3937
function.password-hash.php                         18-Jun-2024 14:06               29139
function.password-needs-rehash.php                 18-Jun-2024 14:06                9189
function.password-verify.php                       18-Jun-2024 14:06                7960
function.pathinfo.php                              18-Jun-2024 14:06               16973
function.pclose.php                                18-Jun-2024 14:06                5545
function.pcntl-alarm.php                           18-Jun-2024 14:06                3394
function.pcntl-async-signals.php                   18-Jun-2024 14:06                4827
function.pcntl-errno.php                           18-Jun-2024 14:06                1819
function.pcntl-exec.php                            18-Jun-2024 14:06                4381
function.pcntl-fork.php                            18-Jun-2024 14:06                6026
function.pcntl-get-last-error.php                  18-Jun-2024 14:06                3035
function.pcntl-getpriority.php                     18-Jun-2024 14:06                6976
function.pcntl-rfork.php                           18-Jun-2024 14:06                9367
function.pcntl-setpriority.php                     18-Jun-2024 14:06                6720
function.pcntl-signal-dispatch.php                 18-Jun-2024 14:06                6558
function.pcntl-signal-get-handler.php              18-Jun-2024 14:06                7307
function.pcntl-signal.php                          18-Jun-2024 14:06               13586
function.pcntl-sigprocmask.php                     18-Jun-2024 14:06                6847
function.pcntl-sigtimedwait.php                    18-Jun-2024 14:06                5755
function.pcntl-sigwaitinfo.php                     18-Jun-2024 14:06                8962
function.pcntl-strerror.php                        18-Jun-2024 14:06                3212
function.pcntl-unshare.php                         18-Jun-2024 14:06                5510
function.pcntl-wait.php                            18-Jun-2024 14:06               10297
function.pcntl-waitpid.php                         18-Jun-2024 14:06               11863
function.pcntl-wexitstatus.php                     18-Jun-2024 14:06                4370
function.pcntl-wifexited.php                       18-Jun-2024 14:06                4116
function.pcntl-wifsignaled.php                     18-Jun-2024 14:06                4050
function.pcntl-wifstopped.php                      18-Jun-2024 14:06                4078
function.pcntl-wstopsig.php                        18-Jun-2024 14:06                4268
function.pcntl-wtermsig.php                        18-Jun-2024 14:06                4543
function.pfsockopen.php                            18-Jun-2024 14:06                6401                      18-Jun-2024 14:06                7786                       18-Jun-2024 14:06                8395                    18-Jun-2024 14:06                8123                              18-Jun-2024 14:06                8124                       18-Jun-2024 14:06                4463                            18-Jun-2024 14:06               13232                    18-Jun-2024 14:06                6490                   18-Jun-2024 14:06                6457                  18-Jun-2024 14:06                6143                      18-Jun-2024 14:06                4131                            18-Jun-2024 14:06               11664                          18-Jun-2024 14:06                9158                            18-Jun-2024 14:06                8271                             18-Jun-2024 14:06                5978                             18-Jun-2024 14:06               11497                           18-Jun-2024 14:06                8388                       18-Jun-2024 14:06                9467                  18-Jun-2024 14:06                9298                     18-Jun-2024 14:06                9718                      18-Jun-2024 14:06                8912                            18-Jun-2024 14:06               12226                  18-Jun-2024 14:06                7793                          18-Jun-2024 14:06               10659                        18-Jun-2024 14:06               14912                        18-Jun-2024 14:06               10742                       18-Jun-2024 14:06               14001                       18-Jun-2024 14:06               10571                          18-Jun-2024 14:06               11360                      18-Jun-2024 14:06                9644                         18-Jun-2024 14:06                9623                          18-Jun-2024 14:06                7402                       18-Jun-2024 14:06               12139                         18-Jun-2024 14:06                9970                        18-Jun-2024 14:06                9881                     18-Jun-2024 14:06                8419                         18-Jun-2024 14:06                8035                              18-Jun-2024 14:06                4173                        18-Jun-2024 14:06                8272                         18-Jun-2024 14:06                8522                            18-Jun-2024 14:06                5715                         18-Jun-2024 14:06                9588                               18-Jun-2024 14:06                7203                             18-Jun-2024 14:06               14362                         18-Jun-2024 14:06                8630                        18-Jun-2024 14:06                9603                           18-Jun-2024 14:06                9008                           18-Jun-2024 14:06                7843                          18-Jun-2024 14:06                9922                          18-Jun-2024 14:06                9163                          18-Jun-2024 14:06                8623                            18-Jun-2024 14:06               10130                        18-Jun-2024 14:06                7142                            18-Jun-2024 14:06                7827                            18-Jun-2024 14:06                8894                            18-Jun-2024 14:06                7933                        18-Jun-2024 14:06                7299                          18-Jun-2024 14:06                7885                           18-Jun-2024 14:06                9164                          18-Jun-2024 14:06                8253                         18-Jun-2024 14:06                6778                           18-Jun-2024 14:06                6738                            18-Jun-2024 14:06                6365                   18-Jun-2024 14:06               10111                           18-Jun-2024 14:06               11857                               18-Jun-2024 14:06                7011                               18-Jun-2024 14:06                6606                            18-Jun-2024 14:06               12603                           18-Jun-2024 14:06               10023                       18-Jun-2024 14:06               13600                              18-Jun-2024 14:06               14422                 18-Jun-2024 14:06               10908                       18-Jun-2024 14:06                9297                        18-Jun-2024 14:06                8634                      18-Jun-2024 14:06                9688                             18-Jun-2024 14:06               14362                       18-Jun-2024 14:06               11977                       18-Jun-2024 14:06               12460                  18-Jun-2024 14:06                9596                         18-Jun-2024 14:06               11419                18-Jun-2024 14:06               10080       18-Jun-2024 14:06                7718                18-Jun-2024 14:06               10361                             18-Jun-2024 14:06                4394                              18-Jun-2024 14:06               10741                 18-Jun-2024 14:06                7563                                18-Jun-2024 14:06                6887                     18-Jun-2024 14:06                7678                            18-Jun-2024 14:06                7651                             18-Jun-2024 14:06               12665                            18-Jun-2024 14:06                7733
function.php-ini-loaded-file.php                   18-Jun-2024 14:06                5138
function.php-ini-scanned-files.php                 18-Jun-2024 14:06                7269
function.php-sapi-name.php                         18-Jun-2024 14:06                6771
function.php-strip-whitespace.php                  18-Jun-2024 14:06                5542
function.php-uname.php                             18-Jun-2024 14:06               10425
function.phpcredits.php                            18-Jun-2024 14:06                9321
function.phpdbg-break-file.php                     18-Jun-2024 14:06                4175
function.phpdbg-break-function.php                 18-Jun-2024 14:06                3900
function.phpdbg-break-method.php                   18-Jun-2024 14:06                4230
function.phpdbg-break-next.php                     18-Jun-2024 14:06                3579
function.phpdbg-clear.php                          18-Jun-2024 14:06                4021
function.phpdbg-color.php                          18-Jun-2024 14:06                4031
function.phpdbg-end-oplog.php                      18-Jun-2024 14:06                2792
function.phpdbg-exec.php                           18-Jun-2024 14:06                3492
function.phpdbg-get-executable.php                 18-Jun-2024 14:06                2735
function.phpdbg-prompt.php                         18-Jun-2024 14:06                3185
function.phpdbg-start-oplog.php                    18-Jun-2024 14:06                2539
function.phpinfo.php                               18-Jun-2024 14:06               11153
function.phpversion.php                            18-Jun-2024 14:06               12211
function.pi.php                                    18-Jun-2024 14:06                3490
function.png2wbmp.php                              18-Jun-2024 14:06                7432
function.popen.php                                 18-Jun-2024 14:06               10105
function.pos.php                                   18-Jun-2024 14:06                1699
function.posix-access.php                          18-Jun-2024 14:06                7447
function.posix-ctermid.php                         18-Jun-2024 14:06                5320
function.posix-eaccess.php                         18-Jun-2024 14:06                8560
function.posix-errno.php                           18-Jun-2024 14:06                1825
function.posix-fpathconf.php                       18-Jun-2024 14:06                7911
function.posix-get-last-error.php                  18-Jun-2024 14:06                5020
function.posix-getcwd.php                          18-Jun-2024 14:06                5148
function.posix-getegid.php                         18-Jun-2024 14:06                6084
function.posix-geteuid.php                         18-Jun-2024 14:06                6204
function.posix-getgid.php                          18-Jun-2024 14:06                5455
function.posix-getgrgid.php                        18-Jun-2024 14:06                7619
function.posix-getgrnam.php                        18-Jun-2024 14:06                7591
function.posix-getgroups.php                       18-Jun-2024 14:06                4597
function.posix-getlogin.php                        18-Jun-2024 14:06                4081
function.posix-getpgid.php                         18-Jun-2024 14:06                5360
function.posix-getpgrp.php                         18-Jun-2024 14:06                2916
function.posix-getpid.php                          18-Jun-2024 14:06                3690
function.posix-getppid.php                         18-Jun-2024 14:06                3335
function.posix-getpwnam.php                        18-Jun-2024 14:06                8424
function.posix-getpwuid.php                        18-Jun-2024 14:06                8435
function.posix-getrlimit.php                       18-Jun-2024 14:06               10999
function.posix-getsid.php                          18-Jun-2024 14:06                5457
function.posix-getuid.php                          18-Jun-2024 14:06                3852
function.posix-initgroups.php                      18-Jun-2024 14:06                3734
function.posix-isatty.php                          18-Jun-2024 14:06                5294
function.posix-kill.php                            18-Jun-2024 14:06                4017
function.posix-mkfifo.php                          18-Jun-2024 14:06                4115
function.posix-mknod.php                           18-Jun-2024 14:06                8082
function.posix-pathconf.php                        18-Jun-2024 14:06                7184
function.posix-setegid.php                         18-Jun-2024 14:06                6088
function.posix-seteuid.php                         18-Jun-2024 14:06                4293
function.posix-setgid.php                          18-Jun-2024 14:06                6304
function.posix-setpgid.php                         18-Jun-2024 14:06                3910
function.posix-setrlimit.php                       18-Jun-2024 14:06                5430
function.posix-setsid.php                          18-Jun-2024 14:06                2934
function.posix-setuid.php                          18-Jun-2024 14:06                6446
function.posix-strerror.php                        18-Jun-2024 14:06                5605
function.posix-sysconf.php                         18-Jun-2024 14:06                4584
function.posix-times.php                           18-Jun-2024 14:06                5545
function.posix-ttyname.php                         18-Jun-2024 14:06                6533
function.posix-uname.php                           18-Jun-2024 14:06                5702
function.pow.php                                   18-Jun-2024 14:06                7544
function.preg-filter.php                           18-Jun-2024 14:06               11474
function.preg-grep.php                             18-Jun-2024 14:06                7041
function.preg-last-error-msg.php                   18-Jun-2024 14:06                4603
function.preg-last-error.php                       18-Jun-2024 14:06                5732
function.preg-match-all.php                        18-Jun-2024 14:06               29405
function.preg-match.php                            18-Jun-2024 14:06               27386
function.preg-quote.php                            18-Jun-2024 14:06                9771
function.preg-replace-callback-array.php           18-Jun-2024 14:06               12202
function.preg-replace-callback.php                 18-Jun-2024 14:06               19793
function.preg-replace.php                          18-Jun-2024 14:06               30173
function.preg-split.php                            18-Jun-2024 14:06               15138
function.prev.php                                  18-Jun-2024 14:06               11131
function.print-r.php                               18-Jun-2024 14:06               10766
function.print.php                                 18-Jun-2024 14:06               15057
function.printf.php                                18-Jun-2024 14:06               33680
function.proc-close.php                            18-Jun-2024 14:06                4487
function.proc-get-status.php                       18-Jun-2024 14:06                8101
function.proc-nice.php                             18-Jun-2024 14:06                9056
function.proc-open.php                             18-Jun-2024 14:06               27011
function.proc-terminate.php                        18-Jun-2024 14:06                5935                       18-Jun-2024 14:06                9320                       18-Jun-2024 14:06                6308                     18-Jun-2024 14:06                6668                      18-Jun-2024 14:06                7595                           18-Jun-2024 14:06                8478                        18-Jun-2024 14:06                7988                        18-Jun-2024 14:06                6791                                18-Jun-2024 14:06                5961                               18-Jun-2024 14:06                5964                         18-Jun-2024 14:06                8879                      18-Jun-2024 14:06               14057                     18-Jun-2024 14:06               12121                             18-Jun-2024 14:06                5397                               18-Jun-2024 14:06                3547                        18-Jun-2024 14:06                4595                              18-Jun-2024 14:06                4238                   18-Jun-2024 14:06                3555                          18-Jun-2024 14:06                3777                      18-Jun-2024 14:06                4771                            18-Jun-2024 14:06                5810                             18-Jun-2024 14:06                4210                           18-Jun-2024 14:06                3943                        18-Jun-2024 14:06                3663                       18-Jun-2024 14:06                3681                        18-Jun-2024 14:06                3786                               18-Jun-2024 14:06                3707                           18-Jun-2024 14:06                8981                         18-Jun-2024 14:06                3844                      18-Jun-2024 14:06                9703                          18-Jun-2024 14:06               11135                          18-Jun-2024 14:06                8427                       18-Jun-2024 14:06                3551                             18-Jun-2024 14:06                8866                      18-Jun-2024 14:06               11200                             18-Jun-2024 14:06                4558                                18-Jun-2024 14:06                3498                          18-Jun-2024 14:06                4165                    18-Jun-2024 14:06                5640                         18-Jun-2024 14:06                8146                  18-Jun-2024 14:06                3134                        18-Jun-2024 14:06                6100                               18-Jun-2024 14:06                5732                            18-Jun-2024 14:06                3976                             18-Jun-2024 14:06               13221                               18-Jun-2024 14:06                3693                              18-Jun-2024 14:06                4402                   18-Jun-2024 14:06                5600                    18-Jun-2024 14:06                5157                   18-Jun-2024 14:06                5240                           18-Jun-2024 14:06                7280                      18-Jun-2024 14:06                4537                       18-Jun-2024 14:06               10115                          18-Jun-2024 14:06                5559                           18-Jun-2024 14:06                7278                            18-Jun-2024 14:06                4139                            18-Jun-2024 14:06                3547                            18-Jun-2024 14:06                4699                            18-Jun-2024 14:06                3817                         18-Jun-2024 14:06                4395                        18-Jun-2024 14:06                4415                       18-Jun-2024 14:06                4273                      18-Jun-2024 14:06                5057                   18-Jun-2024 14:06                3569                        18-Jun-2024 14:06                8471                    18-Jun-2024 14:06                4838                            18-Jun-2024 14:06                8081                             18-Jun-2024 14:06                4596                         18-Jun-2024 14:06               16246                            18-Jun-2024 14:06                4768                           18-Jun-2024 14:06                3487                               18-Jun-2024 14:06                6986                              18-Jun-2024 14:06                3729                    18-Jun-2024 14:06                5518                        18-Jun-2024 14:06                4936                             18-Jun-2024 14:06                3926                        18-Jun-2024 14:06                4310                       18-Jun-2024 14:06                4942                             18-Jun-2024 14:06                4186                          18-Jun-2024 14:06               15444
function.pspell-add-to-personal.php                18-Jun-2024 14:06                7098
function.pspell-add-to-session.php                 18-Jun-2024 14:06                4557
function.pspell-check.php                          18-Jun-2024 14:06                5476
function.pspell-clear-session.php                  18-Jun-2024 14:06                6371
function.pspell-config-create.php                  18-Jun-2024 14:06                9350
function.pspell-config-data-dir.php                18-Jun-2024 14:06                3796
function.pspell-config-dict-dir.php                18-Jun-2024 14:06                3787
function.pspell-config-ignore.php                  18-Jun-2024 14:06                6355
function.pspell-config-mode.php                    18-Jun-2024 14:06                7404
function.pspell-config-personal.php                18-Jun-2024 14:06                7446
function.pspell-config-repl.php                    18-Jun-2024 14:06                7708
function.pspell-config-runtogether.php             18-Jun-2024 14:06                7314
function.pspell-config-save-repl.php               18-Jun-2024 14:06                6115
function.pspell-new-config.php                     18-Jun-2024 14:06                7107
function.pspell-new-personal.php                   18-Jun-2024 14:06               13166
function.pspell-new.php                            18-Jun-2024 14:06               11312
function.pspell-save-wordlist.php                  18-Jun-2024 14:06                6640
function.pspell-store-replacement.php              18-Jun-2024 14:06                8571
function.pspell-suggest.php                        18-Jun-2024 14:06                6044
function.putenv.php                                18-Jun-2024 14:06                4624
function.quoted-printable-decode.php               18-Jun-2024 14:06                5778
function.quoted-printable-encode.php               18-Jun-2024 14:06                5670
function.quotemeta.php                             18-Jun-2024 14:06                6642
function.rad2deg.php                               18-Jun-2024 14:06                3970
function.radius-acct-open.php                      18-Jun-2024 14:06                3649
function.radius-add-server.php                     18-Jun-2024 14:06                8796
function.radius-auth-open.php                      18-Jun-2024 14:06                3667
function.radius-close.php                          18-Jun-2024 14:06                2959
function.radius-config.php                         18-Jun-2024 14:06                4685
function.radius-create-request.php                 18-Jun-2024 14:06                5906
function.radius-cvt-addr.php                       18-Jun-2024 14:06                6668
function.radius-cvt-int.php                        18-Jun-2024 14:06                6156
function.radius-cvt-string.php                     18-Jun-2024 14:06                6187
function.radius-demangle-mppe-key.php              18-Jun-2024 14:06                3661
function.radius-demangle.php                       18-Jun-2024 14:06                3393
function.radius-get-attr.php                       18-Jun-2024 14:06                7122
function.radius-get-tagged-attr-data.php           18-Jun-2024 14:06                7021
function.radius-get-tagged-attr-tag.php            18-Jun-2024 14:06                7070
function.radius-get-vendor-attr.php                18-Jun-2024 14:06                8742
function.radius-put-addr.php                       18-Jun-2024 14:06                6141
function.radius-put-attr.php                       18-Jun-2024 14:06                9635
function.radius-put-int.php                        18-Jun-2024 14:06                8361
function.radius-put-string.php                     18-Jun-2024 14:06                8967
function.radius-put-vendor-addr.php                18-Jun-2024 14:06                6146
function.radius-put-vendor-attr.php                18-Jun-2024 14:06                8633
function.radius-put-vendor-int.php                 18-Jun-2024 14:06                7053
function.radius-put-vendor-string.php              18-Jun-2024 14:06                7781
function.radius-request-authenticator.php          18-Jun-2024 14:06                3530
function.radius-salt-encrypt-attr.php              18-Jun-2024 14:06                4884
function.radius-send-request.php                   18-Jun-2024 14:06                4437
function.radius-server-secret.php                  18-Jun-2024 14:06                2982
function.radius-strerror.php                       18-Jun-2024 14:06                2978
function.rand.php                                  18-Jun-2024 14:06               13006
function.random-bytes.php                          18-Jun-2024 14:06               11223
function.random-int.php                            18-Jun-2024 14:06               10892
function.range.php                                 18-Jun-2024 14:06               22084
function.rar-wrapper-cache-stats.php               18-Jun-2024 14:06                2538
function.rawurldecode.php                          18-Jun-2024 14:06                5179
function.rawurlencode.php                          18-Jun-2024 14:06                7129                        18-Jun-2024 14:06                2611
function.readdir.php                               18-Jun-2024 14:06               12180
function.readfile.php                              18-Jun-2024 14:06               11302
function.readgzfile.php                            18-Jun-2024 14:06                5294
function.readline-add-history.php                  18-Jun-2024 14:06                3061
function.readline-callback-handler-install.php     18-Jun-2024 14:06               10560
function.readline-callback-handler-remove.php      18-Jun-2024 14:06                4435
function.readline-callback-read-char.php           18-Jun-2024 14:06                4451
function.readline-clear-history.php                18-Jun-2024 14:06                2765
function.readline-completion-function.php          18-Jun-2024 14:06                3441
function.readline-info.php                         18-Jun-2024 14:06                5606
function.readline-list-history.php                 18-Jun-2024 14:06                2518
function.readline-on-new-line.php                  18-Jun-2024 14:06                3064
function.readline-read-history.php                 18-Jun-2024 14:06                3783
function.readline-redisplay.php                    18-Jun-2024 14:06                2444
function.readline-write-history.php                18-Jun-2024 14:06                3763
function.readline.php                              18-Jun-2024 14:06                5727
function.readlink.php                              18-Jun-2024 14:06                5185
function.realpath-cache-get.php                    18-Jun-2024 14:06                4745
function.realpath-cache-size.php                   18-Jun-2024 14:06                4063
function.realpath.php                              18-Jun-2024 14:06               10417
function.recode-file.php                           18-Jun-2024 14:06                6545
function.recode-string.php                         18-Jun-2024 14:06                5804
function.recode.php                                18-Jun-2024 14:06                1800
function.register-shutdown-function.php            18-Jun-2024 14:06                9605
function.register-tick-function.php                18-Jun-2024 14:06                6032
function.rename.php                                18-Jun-2024 14:06                6771
function.require-once.php                          18-Jun-2024 14:06                2027
function.require.php                               18-Jun-2024 14:06                2521
function.reset.php                                 18-Jun-2024 14:06               11818
function.restore-error-handler.php                 18-Jun-2024 14:06                6634
function.restore-exception-handler.php             18-Jun-2024 14:06                7243
function.restore-include-path.php                  18-Jun-2024 14:06                5850
function.return.php                                18-Jun-2024 14:06                5834
function.rewind.php                                18-Jun-2024 14:06                7346
function.rewinddir.php                             18-Jun-2024 14:06                4157
function.rmdir.php                                 18-Jun-2024 14:06                5774
function.rnp-backend-string.php                    18-Jun-2024 14:06                2486
function.rnp-backend-version.php                   18-Jun-2024 14:06                2395
function.rnp-decrypt.php                           18-Jun-2024 14:06                3705
function.rnp-dump-packets-to-json.php              18-Jun-2024 14:06                3416
function.rnp-dump-packets.php                      18-Jun-2024 14:06                3442
function.rnp-ffi-create.php                        18-Jun-2024 14:06                3494
function.rnp-ffi-destroy.php                       18-Jun-2024 14:06                2640
function.rnp-ffi-set-pass-provider.php             18-Jun-2024 14:06                7687
function.rnp-import-keys.php                       18-Jun-2024 14:06                3951
function.rnp-import-signatures.php                 18-Jun-2024 14:06                3939
function.rnp-key-export-autocrypt.php              18-Jun-2024 14:06                5306
function.rnp-key-export-revocation.php             18-Jun-2024 14:06                5886
function.rnp-key-export.php                        18-Jun-2024 14:06                3832
function.rnp-key-get-info.php                      18-Jun-2024 14:06                9813
function.rnp-key-remove.php                        18-Jun-2024 14:06                4030
function.rnp-key-revoke.php                        18-Jun-2024 14:06                5495
function.rnp-list-keys.php                         18-Jun-2024 14:06                3492
function.rnp-load-keys-from-path.php               18-Jun-2024 14:06                4241
function.rnp-load-keys.php                         18-Jun-2024 14:06                4262
function.rnp-locate-key.php                        18-Jun-2024 14:06                4154
function.rnp-op-encrypt.php                        18-Jun-2024 14:06                9799
function.rnp-op-generate-key.php                   18-Jun-2024 14:06                9521
function.rnp-op-sign-cleartext.php                 18-Jun-2024 14:06                6225
function.rnp-op-sign-detached.php                  18-Jun-2024 14:06                6048
function.rnp-op-sign.php                           18-Jun-2024 14:06                7622
function.rnp-op-verify-detached.php                18-Jun-2024 14:06                8673
function.rnp-op-verify.php                         18-Jun-2024 14:06                8325
function.rnp-save-keys-to-path.php                 18-Jun-2024 14:06                4300
function.rnp-save-keys.php                         18-Jun-2024 14:06                4281
function.rnp-supported-features.php                18-Jun-2024 14:06                3330
function.rnp-version-string-full.php               18-Jun-2024 14:06                2468
function.rnp-version-string.php                    18-Jun-2024 14:06                2362
function.round.php                                 18-Jun-2024 14:06               27338
function.rpmaddtag.php                             18-Jun-2024 14:06                3744
function.rpmdbinfo.php                             18-Jun-2024 14:06                5745
function.rpmdbsearch.php                           18-Jun-2024 14:06                6693
function.rpmgetsymlink.php                         18-Jun-2024 14:06                3439
function.rpminfo.php                               18-Jun-2024 14:06                6001
function.rpmvercmp.php                             18-Jun-2024 14:06                5466
function.rrd-create.php                            18-Jun-2024 14:06                3191
function.rrd-error.php                             18-Jun-2024 14:06                2322
function.rrd-fetch.php                             18-Jun-2024 14:06                3211
function.rrd-first.php                             18-Jun-2024 14:06                3241
function.rrd-graph.php                             18-Jun-2024 14:06                3706
function.rrd-info.php                              18-Jun-2024 14:06                2746
function.rrd-last.php                              18-Jun-2024 14:06                2745
function.rrd-lastupdate.php                        18-Jun-2024 14:06                2952
function.rrd-restore.php                           18-Jun-2024 14:06                3706
function.rrd-tune.php                              18-Jun-2024 14:06                3495
function.rrd-update.php                            18-Jun-2024 14:06                3593
function.rrd-version.php                           18-Jun-2024 14:06                2395
function.rrd-xport.php                             18-Jun-2024 14:06                3076
function.rrdc-disconnect.php                       18-Jun-2024 14:06                3034
function.rsort.php                                 18-Jun-2024 14:06               10697
function.rtrim.php                                 18-Jun-2024 14:06               10407
function.runkit7-constant-add.php                  18-Jun-2024 14:06                4939
function.runkit7-constant-redefine.php             18-Jun-2024 14:06                4846
function.runkit7-constant-remove.php               18-Jun-2024 14:06                4052
function.runkit7-function-add.php                  18-Jun-2024 14:06               10562
function.runkit7-function-copy.php                 18-Jun-2024 14:06                6006
function.runkit7-function-redefine.php             18-Jun-2024 14:06               11138
function.runkit7-function-remove.php               18-Jun-2024 14:06                4568
function.runkit7-function-rename.php               18-Jun-2024 14:06                4863
function.runkit7-import.php                        18-Jun-2024 14:06                4375
function.runkit7-method-add.php                    18-Jun-2024 14:06               12742
function.runkit7-method-copy.php                   18-Jun-2024 14:06                7708
function.runkit7-method-redefine.php               18-Jun-2024 14:06               13279
function.runkit7-method-remove.php                 18-Jun-2024 14:06                7039
function.runkit7-method-rename.php                 18-Jun-2024 14:06                7273
function.runkit7-object-id.php                     18-Jun-2024 14:06                4489
function.runkit7-superglobals.php                  18-Jun-2024 14:06                2999
function.runkit7-zval-inspect.php                  18-Jun-2024 14:06                5528
function.sapi-windows-cp-conv.php                  18-Jun-2024 14:06                5499
function.sapi-windows-cp-get.php                   18-Jun-2024 14:06                4035
function.sapi-windows-cp-is-utf8.php               18-Jun-2024 14:06                3035
function.sapi-windows-cp-set.php                   18-Jun-2024 14:06                3435
function.sapi-windows-generate-ctrl-event.php      18-Jun-2024 14:06                8558
function.sapi-windows-set-ctrl-handler.php         18-Jun-2024 14:06                8441
function.sapi-windows-vt100-support.php            18-Jun-2024 14:06               13175
function.scandir.php                               18-Jun-2024 14:06               10629
function.scoutapm-get-calls.php                    18-Jun-2024 14:06                4872
function.scoutapm-list-instrumented-functions.php  18-Jun-2024 14:06                4173
function.seaslog-get-author.php                    18-Jun-2024 14:06                3358
function.seaslog-get-version.php                   18-Jun-2024 14:06                3349
function.sem-acquire.php                           18-Jun-2024 14:06                5953
function.sem-get.php                               18-Jun-2024 14:06                8550
function.sem-release.php                           18-Jun-2024 14:06                4838
function.sem-remove.php                            18-Jun-2024 14:06                4725
function.serialize.php                             18-Jun-2024 14:06               13112
function.session-abort.php                         18-Jun-2024 14:06                4798
function.session-cache-expire.php                  18-Jun-2024 14:06                8565
function.session-cache-limiter.php                 18-Jun-2024 14:06               10756
function.session-commit.php                        18-Jun-2024 14:06                1902
function.session-create-id.php                     18-Jun-2024 14:06               12226
function.session-decode.php                        18-Jun-2024 14:06                4475
function.session-destroy.php                       18-Jun-2024 14:06               11024
function.session-encode.php                        18-Jun-2024 14:06                4597
function.session-gc.php                            18-Jun-2024 14:06                9701
function.session-get-cookie-params.php             18-Jun-2024 14:06                6004
function.session-id.php                            18-Jun-2024 14:06                7487
function.session-module-name.php                   18-Jun-2024 14:06                5091
function.session-name.php                          18-Jun-2024 14:06                9087
function.session-regenerate-id.php                 18-Jun-2024 14:06               19305
function.session-register-shutdown.php             18-Jun-2024 14:06                3122
function.session-reset.php                         18-Jun-2024 14:06                4985
function.session-save-path.php                     18-Jun-2024 14:06                5546
function.session-set-cookie-params.php             18-Jun-2024 14:06               12745
function.session-set-save-handler.php              18-Jun-2024 14:06               29208
function.session-start.php                         18-Jun-2024 14:06               16971
function.session-status.php                        18-Jun-2024 14:06                3685
function.session-unset.php                         18-Jun-2024 14:06                5791
function.session-write-close.php                   18-Jun-2024 14:06                5061
function.set-error-handler.php                     18-Jun-2024 14:06               30934
function.set-exception-handler.php                 18-Jun-2024 14:06                7964
function.set-file-buffer.php                       18-Jun-2024 14:06                1856
function.set-include-path.php                      18-Jun-2024 14:06                7029
function.set-time-limit.php                        18-Jun-2024 14:06                5612
function.setcookie.php                             18-Jun-2024 14:06               33094
function.setlocale.php                             18-Jun-2024 14:06               18798
function.setrawcookie.php                          18-Jun-2024 14:06                6989
function.settype.php                               18-Jun-2024 14:06                7185
function.sha1-file.php                             18-Jun-2024 14:06                6189
function.sha1.php                                  18-Jun-2024 14:06                6686                            18-Jun-2024 14:06                6831
function.shm-attach.php                            18-Jun-2024 14:06                7023
function.shm-detach.php                            18-Jun-2024 14:06                5128
function.shm-get-var.php                           18-Jun-2024 14:06                4866
function.shm-has-var.php                           18-Jun-2024 14:06                4891
function.shm-put-var.php                           18-Jun-2024 14:06                6251
function.shm-remove-var.php                        18-Jun-2024 14:06                4713
function.shm-remove.php                            18-Jun-2024 14:06                4419
function.shmop-close.php                           18-Jun-2024 14:06                5615
function.shmop-delete.php                          18-Jun-2024 14:06                4791
function.shmop-open.php                            18-Jun-2024 14:06               12446
function.shmop-read.php                            18-Jun-2024 14:06                7934
function.shmop-size.php                            18-Jun-2024 14:06                4877
function.shmop-write.php                           18-Jun-2024 14:06                7270                           18-Jun-2024 14:06                1799
function.shuffle.php                               18-Jun-2024 14:06                8237
function.simdjson-decode.php                       18-Jun-2024 14:06               19601
function.simdjson-is-valid.php                     18-Jun-2024 14:06               12057
function.simdjson-key-count.php                    18-Jun-2024 14:06                5659
function.simdjson-key-exists.php                   18-Jun-2024 14:06                5547
function.simdjson-key-value.php                    18-Jun-2024 14:06                8762
function.similar-text.php                          18-Jun-2024 14:06                8488
function.simplexml-import-dom.php                  18-Jun-2024 14:06                7050
function.simplexml-load-file.php                   18-Jun-2024 14:06               11792
function.simplexml-load-string.php                 18-Jun-2024 14:06               11368
function.sin.php                                   18-Jun-2024 14:06                5032
function.sinh.php                                  18-Jun-2024 14:06                3683
function.sizeof.php                                18-Jun-2024 14:06                1719
function.sleep.php                                 18-Jun-2024 14:06                8490
function.snmp-get-quick-print.php                  18-Jun-2024 14:06                4100
function.snmp-get-valueretrieval.php               18-Jun-2024 14:06                4721
function.snmp-read-mib.php                         18-Jun-2024 14:06                5553
function.snmp-set-enum-print.php                   18-Jun-2024 14:06                5993
function.snmp-set-oid-numeric-print.php            18-Jun-2024 14:06                2416
function.snmp-set-oid-output-format.php            18-Jun-2024 14:06                8167
function.snmp-set-quick-print.php                  18-Jun-2024 14:06                8244
function.snmp-set-valueretrieval.php               18-Jun-2024 14:06               10180
function.snmp2-get.php                             18-Jun-2024 14:06                6239
function.snmp2-getnext.php                         18-Jun-2024 14:06                6815
function.snmp2-real-walk.php                       18-Jun-2024 14:06                7266
function.snmp2-set.php                             18-Jun-2024 14:06               12528
function.snmp2-walk.php                            18-Jun-2024 14:06                7698
function.snmp3-get.php                             18-Jun-2024 14:06                9626
function.snmp3-getnext.php                         18-Jun-2024 14:06               10065
function.snmp3-real-walk.php                       18-Jun-2024 14:06               10737
function.snmp3-set.php                             18-Jun-2024 14:06               15572
function.snmp3-walk.php                            18-Jun-2024 14:06               11332
function.snmpget.php                               18-Jun-2024 14:06                6238
function.snmpgetnext.php                           18-Jun-2024 14:06                6781
function.snmprealwalk.php                          18-Jun-2024 14:06                7287
function.snmpset.php                               18-Jun-2024 14:06               12576
function.snmpwalk.php                              18-Jun-2024 14:06                7732
function.snmpwalkoid.php                           18-Jun-2024 14:06                8654
function.socket-accept.php                         18-Jun-2024 14:06                8327
function.socket-addrinfo-bind.php                  18-Jun-2024 14:06                6127
function.socket-addrinfo-connect.php               18-Jun-2024 14:06                5924
function.socket-addrinfo-explain.php               18-Jun-2024 14:06                4915
function.socket-addrinfo-lookup.php                18-Jun-2024 14:06                6987
function.socket-atmark.php                         18-Jun-2024 14:06                5527
function.socket-bind.php                           18-Jun-2024 14:06               12622
function.socket-clear-error.php                    18-Jun-2024 14:06                5343
function.socket-close.php                          18-Jun-2024 14:06                5121
function.socket-cmsg-space.php                     18-Jun-2024 14:06                4100
function.socket-connect.php                        18-Jun-2024 14:06                9045
function.socket-create-listen.php                  18-Jun-2024 14:06                8497
function.socket-create-pair.php                    18-Jun-2024 14:06               21876
function.socket-create.php                         18-Jun-2024 14:06               16780
function.socket-export-stream.php                  18-Jun-2024 14:06                3846
function.socket-get-option.php                     18-Jun-2024 14:06               38510
function.socket-get-status.php                     18-Jun-2024 14:06                1875
function.socket-getopt.php                         18-Jun-2024 14:06                1854
function.socket-getpeername.php                    18-Jun-2024 14:06                9920
function.socket-getsockname.php                    18-Jun-2024 14:06                9096
function.socket-import-stream.php                  18-Jun-2024 14:06                5593
function.socket-last-error.php                     18-Jun-2024 14:06                8170
function.socket-listen.php                         18-Jun-2024 14:06                8662
function.socket-read.php                           18-Jun-2024 14:06                9259
function.socket-recv.php                           18-Jun-2024 14:06               18759
function.socket-recvfrom.php                       18-Jun-2024 14:06               16322
function.socket-recvmsg.php                        18-Jun-2024 14:06                4767
function.socket-select.php                         18-Jun-2024 14:06               18847
function.socket-send.php                           18-Jun-2024 14:06                7938
function.socket-sendmsg.php                        18-Jun-2024 14:06                4967
function.socket-sendto.php                         18-Jun-2024 14:06               11312
function.socket-set-block.php                      18-Jun-2024 14:06                7114
function.socket-set-blocking.php                   18-Jun-2024 14:06                1893
function.socket-set-nonblock.php                   18-Jun-2024 14:06                7770
function.socket-set-option.php                     18-Jun-2024 14:06               12573
function.socket-set-timeout.php                    18-Jun-2024 14:06                1862
function.socket-setopt.php                         18-Jun-2024 14:06                1848
function.socket-shutdown.php                       18-Jun-2024 14:06                5707
function.socket-strerror.php                       18-Jun-2024 14:06                8115
function.socket-write.php                          18-Jun-2024 14:06                8648
function.socket-wsaprotocol-info-export.php        18-Jun-2024 14:06                5755
function.socket-wsaprotocol-info-import.php        18-Jun-2024 14:06                4889
function.socket-wsaprotocol-info-release.php       18-Jun-2024 14:06                3991
function.sodium-add.php                            18-Jun-2024 14:06                3771
function.sodium-base642bin.php                     18-Jun-2024 14:06                5436
function.sodium-bin2base64.php                     18-Jun-2024 14:06                4794
function.sodium-bin2hex.php                        18-Jun-2024 14:06                3380
function.sodium-compare.php                        18-Jun-2024 14:06                3890
function.sodium-crypto-aead-aes256gcm-decrypt.php  18-Jun-2024 14:06                5573
function.sodium-crypto-aead-aes256gcm-encrypt.php  18-Jun-2024 14:06                5375
function.sodium-crypto-aead-aes256gcm-is-availa..> 18-Jun-2024 14:06                3161
function.sodium-crypto-aead-aes256gcm-keygen.php   18-Jun-2024 14:06                3031
function.sodium-crypto-aead-chacha20poly1305-de..> 18-Jun-2024 14:06                5357
function.sodium-crypto-aead-chacha20poly1305-en..> 18-Jun-2024 14:06                5184
function.sodium-crypto-aead-chacha20poly1305-ie..> 18-Jun-2024 14:06                5788
function.sodium-crypto-aead-chacha20poly1305-ie..> 18-Jun-2024 14:06                5459
function.sodium-crypto-aead-chacha20poly1305-ie..> 18-Jun-2024 14:06                3485
function.sodium-crypto-aead-chacha20poly1305-ke..> 18-Jun-2024 14:06                3159
function.sodium-crypto-aead-xchacha20poly1305-i..> 18-Jun-2024 14:06                5967
function.sodium-crypto-aead-xchacha20poly1305-i..> 18-Jun-2024 14:06                5714
function.sodium-crypto-aead-xchacha20poly1305-i..> 18-Jun-2024 14:06                3199
function.sodium-crypto-auth-keygen.php             18-Jun-2024 14:06                2843
function.sodium-crypto-auth-verify.php             18-Jun-2024 14:06                4619
function.sodium-crypto-auth.php                    18-Jun-2024 14:06                3944
function.sodium-crypto-box-keypair-from-secretk..> 18-Jun-2024 14:06                3893
function.sodium-crypto-box-keypair.php             18-Jun-2024 14:06                3600
function.sodium-crypto-box-open.php                18-Jun-2024 14:06                4827
function.sodium-crypto-box-publickey-from-secre..> 18-Jun-2024 14:06                3887
function.sodium-crypto-box-publickey.php           18-Jun-2024 14:06                3359
function.sodium-crypto-box-seal-open.php           18-Jun-2024 14:06                6823
function.sodium-crypto-box-seal.php                18-Jun-2024 14:06                8532
function.sodium-crypto-box-secretkey.php           18-Jun-2024 14:06                3329
function.sodium-crypto-box-seed-keypair.php        18-Jun-2024 14:06                3641
function.sodium-crypto-box.php                     18-Jun-2024 14:06                5368
function.sodium-crypto-core-ristretto255-add.php   18-Jun-2024 14:06                6558
function.sodium-crypto-core-ristretto255-from-h..> 18-Jun-2024 14:06                6068
function.sodium-crypto-core-ristretto255-is-val..> 18-Jun-2024 14:06                6250
function.sodium-crypto-core-ristretto255-random..> 18-Jun-2024 14:06                6086
function.sodium-crypto-core-ristretto255-scalar..> 18-Jun-2024 14:06                6902
function.sodium-crypto-core-ristretto255-scalar..> 18-Jun-2024 14:06                3989
function.sodium-crypto-core-ristretto255-scalar..> 18-Jun-2024 14:06                5952
function.sodium-crypto-core-ristretto255-scalar..> 18-Jun-2024 14:06                4278
function.sodium-crypto-core-ristretto255-scalar..> 18-Jun-2024 14:06                5924
function.sodium-crypto-core-ristretto255-scalar..> 18-Jun-2024 14:06                6279
function.sodium-crypto-core-ristretto255-scalar..> 18-Jun-2024 14:06                3940
function.sodium-crypto-core-ristretto255-scalar..> 18-Jun-2024 14:06                6909
function.sodium-crypto-core-ristretto255-sub.php   18-Jun-2024 14:06                6583
function.sodium-crypto-generichash-final.php       18-Jun-2024 14:06                7290
function.sodium-crypto-generichash-init.php        18-Jun-2024 14:06                7372
function.sodium-crypto-generichash-keygen.php      18-Jun-2024 14:06                2652
function.sodium-crypto-generichash-update.php      18-Jun-2024 14:06                7006
function.sodium-crypto-generichash.php             18-Jun-2024 14:06                4243
function.sodium-crypto-kdf-derive-from-key.php     18-Jun-2024 14:06                4570
function.sodium-crypto-kdf-keygen.php              18-Jun-2024 14:06                2821
function.sodium-crypto-kx-client-session-keys.php  18-Jun-2024 14:06                3850
function.sodium-crypto-kx-keypair.php              18-Jun-2024 14:06                5633
function.sodium-crypto-kx-publickey.php            18-Jun-2024 14:06                3159
function.sodium-crypto-kx-secretkey.php            18-Jun-2024 14:06                3175
function.sodium-crypto-kx-seed-keypair.php         18-Jun-2024 14:06                3011
function.sodium-crypto-kx-server-session-keys.php  18-Jun-2024 14:06                3921
function.sodium-crypto-pwhash-scryptsalsa208sha..> 18-Jun-2024 14:06                3635
function.sodium-crypto-pwhash-scryptsalsa208sha..> 18-Jun-2024 14:06                3807
function.sodium-crypto-pwhash-scryptsalsa208sha..> 18-Jun-2024 14:06                8025
function.sodium-crypto-pwhash-str-needs-rehash.php 18-Jun-2024 14:06                4398
function.sodium-crypto-pwhash-str-verify.php       18-Jun-2024 14:06                5496
function.sodium-crypto-pwhash-str.php              18-Jun-2024 14:06               10347
function.sodium-crypto-pwhash.php                  18-Jun-2024 14:06               12742
function.sodium-crypto-scalarmult-base.php         18-Jun-2024 14:06                2096
function.sodium-crypto-scalarmult-ristretto255-..> 18-Jun-2024 14:06                3923
function.sodium-crypto-scalarmult-ristretto255.php 18-Jun-2024 14:06                4342
function.sodium-crypto-scalarmult.php              18-Jun-2024 14:06                3556
function.sodium-crypto-secretbox-keygen.php        18-Jun-2024 14:06                6765
function.sodium-crypto-secretbox-open.php          18-Jun-2024 14:06               10279
function.sodium-crypto-secretbox.php               18-Jun-2024 14:06               10166
function.sodium-crypto-secretstream-xchacha20po..> 18-Jun-2024 14:06               11730
function.sodium-crypto-secretstream-xchacha20po..> 18-Jun-2024 14:06               10979
function.sodium-crypto-secretstream-xchacha20po..> 18-Jun-2024 14:06                2899
function.sodium-crypto-secretstream-xchacha20po..> 18-Jun-2024 14:06                6952
function.sodium-crypto-secretstream-xchacha20po..> 18-Jun-2024 14:06                6991
function.sodium-crypto-secretstream-xchacha20po..> 18-Jun-2024 14:06                3213
function.sodium-crypto-shorthash-keygen.php        18-Jun-2024 14:06                2958
function.sodium-crypto-shorthash.php               18-Jun-2024 14:06                3643
function.sodium-crypto-sign-detached.php           18-Jun-2024 14:06                3724
function.sodium-crypto-sign-ed25519-pk-to-curve..> 18-Jun-2024 14:06                3299
function.sodium-crypto-sign-ed25519-sk-to-curve..> 18-Jun-2024 14:06                3462
function.sodium-crypto-sign-keypair-from-secret..> 18-Jun-2024 14:06                3550
function.sodium-crypto-sign-keypair.php            18-Jun-2024 14:06                2781
function.sodium-crypto-sign-open.php               18-Jun-2024 14:06                3763
function.sodium-crypto-sign-publickey-from-secr..> 18-Jun-2024 14:06                3117
function.sodium-crypto-sign-publickey.php          18-Jun-2024 14:06                3165
function.sodium-crypto-sign-secretkey.php          18-Jun-2024 14:06                3146
function.sodium-crypto-sign-seed-keypair.php       18-Jun-2024 14:06                3692
function.sodium-crypto-sign-verify-detached.php    18-Jun-2024 14:06                3973
function.sodium-crypto-sign.php                    18-Jun-2024 14:06                3879
function.sodium-crypto-stream-keygen.php           18-Jun-2024 14:06                2814
function.sodium-crypto-stream-xchacha20-keygen.php 18-Jun-2024 14:06                3103
function.sodium-crypto-stream-xchacha20-xor-ic.php 18-Jun-2024 14:06               10819
function.sodium-crypto-stream-xchacha20-xor.php    18-Jun-2024 14:06                5630
function.sodium-crypto-stream-xchacha20.php        18-Jun-2024 14:06                4290
function.sodium-crypto-stream-xor.php              18-Jun-2024 14:06                4208
function.sodium-crypto-stream.php                  18-Jun-2024 14:06                4112
function.sodium-hex2bin.php                        18-Jun-2024 14:06                3988
function.sodium-increment.php                      18-Jun-2024 14:06                2914
function.sodium-memcmp.php                         18-Jun-2024 14:06                4343
function.sodium-memzero.php                        18-Jun-2024 14:06                2835
function.sodium-pad.php                            18-Jun-2024 14:06                3205
function.sodium-unpad.php                          18-Jun-2024 14:06                3161
function.solr-get-version.php                      18-Jun-2024 14:06                4367
function.sort.php                                  18-Jun-2024 14:06               14486
function.soundex.php                               18-Jun-2024 14:06                8242
function.spl-autoload-call.php                     18-Jun-2024 14:06                2990
function.spl-autoload-extensions.php               18-Jun-2024 14:06                6038
function.spl-autoload-functions.php                18-Jun-2024 14:06                4024
function.spl-autoload-register.php                 18-Jun-2024 14:06               15313
function.spl-autoload-unregister.php               18-Jun-2024 14:06                3698
function.spl-autoload.php                          18-Jun-2024 14:06                5555
function.spl-classes.php                           18-Jun-2024 14:06                4139
function.spl-object-hash.php                       18-Jun-2024 14:06                5991
function.spl-object-id.php                         18-Jun-2024 14:06                4923
function.sprintf.php                               18-Jun-2024 14:06               34660
function.sqlsrv-begin-transaction.php              18-Jun-2024 14:06               12255
function.sqlsrv-cancel.php                         18-Jun-2024 14:06               11226
function.sqlsrv-client-info.php                    18-Jun-2024 14:06                7240
function.sqlsrv-close.php                          18-Jun-2024 14:06                6124
function.sqlsrv-commit.php                         18-Jun-2024 14:06               12173
function.sqlsrv-configure.php                      18-Jun-2024 14:06                5406
function.sqlsrv-connect.php                        18-Jun-2024 14:06               14177
function.sqlsrv-errors.php                         18-Jun-2024 14:06               11849
function.sqlsrv-execute.php                        18-Jun-2024 14:06               11464
function.sqlsrv-fetch-array.php                    18-Jun-2024 14:06               17330
function.sqlsrv-fetch-object.php                   18-Jun-2024 14:06               14815
function.sqlsrv-fetch.php                          18-Jun-2024 14:06               12187
function.sqlsrv-field-metadata.php                 18-Jun-2024 14:06                9912
function.sqlsrv-free-stmt.php                      18-Jun-2024 14:06                8749
function.sqlsrv-get-config.php                     18-Jun-2024 14:06                3750
function.sqlsrv-get-field.php                      18-Jun-2024 14:06               11489
function.sqlsrv-has-rows.php                       18-Jun-2024 14:06                6777
function.sqlsrv-next-result.php                    18-Jun-2024 14:06               10323
function.sqlsrv-num-fields.php                     18-Jun-2024 14:06                8813
function.sqlsrv-num-rows.php                       18-Jun-2024 14:06                9000
function.sqlsrv-prepare.php                        18-Jun-2024 14:06               17086
function.sqlsrv-query.php                          18-Jun-2024 14:06               13604
function.sqlsrv-rollback.php                       18-Jun-2024 14:06               11315
function.sqlsrv-rows-affected.php                  18-Jun-2024 14:06                8738
function.sqlsrv-send-stream-data.php               18-Jun-2024 14:06                9263
function.sqlsrv-server-info.php                    18-Jun-2024 14:06                6535
function.sqrt.php                                  18-Jun-2024 14:06                5129
function.srand.php                                 18-Jun-2024 14:06                9378
function.sscanf.php                                18-Jun-2024 14:06               13629
function.ssdeep-fuzzy-compare.php                  18-Jun-2024 14:06                3732
function.ssdeep-fuzzy-hash-filename.php            18-Jun-2024 14:06                3323
function.ssdeep-fuzzy-hash.php                     18-Jun-2024 14:06                3162
function.ssh2-auth-agent.php                       18-Jun-2024 14:06                5224
function.ssh2-auth-hostbased-file.php              18-Jun-2024 14:06                8376
function.ssh2-auth-none.php                        18-Jun-2024 14:06                5361
function.ssh2-auth-password.php                    18-Jun-2024 14:06                5562
function.ssh2-auth-pubkey-file.php                 18-Jun-2024 14:06                8114
function.ssh2-connect.php                          18-Jun-2024 14:06               18248
function.ssh2-disconnect.php                       18-Jun-2024 14:06                3460
function.ssh2-exec.php                             18-Jun-2024 14:06                8305
function.ssh2-fetch-stream.php                     18-Jun-2024 14:06                6015
function.ssh2-fingerprint.php                      18-Jun-2024 14:06                5899
function.ssh2-forward-accept.php                   18-Jun-2024 14:06                3401
function.ssh2-forward-listen.php                   18-Jun-2024 14:06                4938
function.ssh2-methods-negotiated.php               18-Jun-2024 14:06                8433
function.ssh2-poll.php                             18-Jun-2024 14:06                4306
function.ssh2-publickey-add.php                    18-Jun-2024 14:06                9468
function.ssh2-publickey-init.php                   18-Jun-2024 14:06                5517
function.ssh2-publickey-list.php                   18-Jun-2024 14:06                9960
function.ssh2-publickey-remove.php                 18-Jun-2024 14:06                5390
function.ssh2-scp-recv.php                         18-Jun-2024 14:06                5860
function.ssh2-scp-send.php                         18-Jun-2024 14:06                6549
function.ssh2-send-eof.php                         18-Jun-2024 14:06                4062
function.ssh2-sftp-chmod.php                       18-Jun-2024 14:06                6518
function.ssh2-sftp-lstat.php                       18-Jun-2024 14:06                7797
function.ssh2-sftp-mkdir.php                       18-Jun-2024 14:06                7362
function.ssh2-sftp-readlink.php                    18-Jun-2024 14:06                5821
function.ssh2-sftp-realpath.php                    18-Jun-2024 14:06                6047
function.ssh2-sftp-rename.php                      18-Jun-2024 14:06                5916
function.ssh2-sftp-rmdir.php                       18-Jun-2024 14:06                5905
function.ssh2-sftp-stat.php                        18-Jun-2024 14:06                7608
function.ssh2-sftp-symlink.php                     18-Jun-2024 14:06                6253
function.ssh2-sftp-unlink.php                      18-Jun-2024 14:06                5341
function.ssh2-sftp.php                             18-Jun-2024 14:06                5846
function.ssh2-shell.php                            18-Jun-2024 14:06                8855
function.ssh2-tunnel.php                           18-Jun-2024 14:06                5737
function.stat.php                                  18-Jun-2024 14:06               19624
function.stats-absolute-deviation.php              18-Jun-2024 14:06                3097
function.stats-cdf-beta.php                        18-Jun-2024 14:06                5860
function.stats-cdf-binomial.php                    18-Jun-2024 14:06                5898
function.stats-cdf-cauchy.php                      18-Jun-2024 14:06                5800
function.stats-cdf-chisquare.php                   18-Jun-2024 14:06                5106
function.stats-cdf-exponential.php                 18-Jun-2024 14:06                5226
function.stats-cdf-f.php                           18-Jun-2024 14:06                5718
function.stats-cdf-gamma.php                       18-Jun-2024 14:06                5772
function.stats-cdf-laplace.php                     18-Jun-2024 14:06                5785
function.stats-cdf-logistic.php                    18-Jun-2024 14:06                5845
function.stats-cdf-negative-binomial.php           18-Jun-2024 14:06                6091
function.stats-cdf-noncentral-chisquare.php        18-Jun-2024 14:06                6065
function.stats-cdf-noncentral-f.php                18-Jun-2024 14:06                6663
function.stats-cdf-noncentral-t.php                18-Jun-2024 14:06                6026
function.stats-cdf-normal.php                      18-Jun-2024 14:06                5867
function.stats-cdf-poisson.php                     18-Jun-2024 14:06                5113
function.stats-cdf-t.php                           18-Jun-2024 14:06                5049
function.stats-cdf-uniform.php                     18-Jun-2024 14:06                5815
function.stats-cdf-weibull.php                     18-Jun-2024 14:06                5820
function.stats-covariance.php                      18-Jun-2024 14:06                3246
function.stats-dens-beta.php                       18-Jun-2024 14:06                3836
function.stats-dens-cauchy.php                     18-Jun-2024 14:06                3887
function.stats-dens-chisquare.php                  18-Jun-2024 14:06                3453
function.stats-dens-exponential.php                18-Jun-2024 14:06                3527
function.stats-dens-f.php                          18-Jun-2024 14:06                3720
function.stats-dens-gamma.php                      18-Jun-2024 14:06                3863
function.stats-dens-laplace.php                    18-Jun-2024 14:06                3854
function.stats-dens-logistic.php                   18-Jun-2024 14:06                3904
function.stats-dens-normal.php                     18-Jun-2024 14:06                4006
function.stats-dens-pmf-binomial.php               18-Jun-2024 14:06                3941
function.stats-dens-pmf-hypergeometric.php         18-Jun-2024 14:06                4611
function.stats-dens-pmf-negative-binomial.php      18-Jun-2024 14:06                4051
function.stats-dens-pmf-poisson.php                18-Jun-2024 14:06                3531
function.stats-dens-t.php                          18-Jun-2024 14:06                3399
function.stats-dens-uniform.php                    18-Jun-2024 14:06                3851
function.stats-dens-weibull.php                    18-Jun-2024 14:06                3875
function.stats-harmonic-mean.php                   18-Jun-2024 14:06                3017
function.stats-kurtosis.php                        18-Jun-2024 14:06                2966
function.stats-rand-gen-beta.php                   18-Jun-2024 14:06                3260
function.stats-rand-gen-chisquare.php              18-Jun-2024 14:06                2993
function.stats-rand-gen-exponential.php            18-Jun-2024 14:06                3027
function.stats-rand-gen-f.php                      18-Jun-2024 14:06                3449
function.stats-rand-gen-funiform.php               18-Jun-2024 14:06                3416
function.stats-rand-gen-gamma.php                  18-Jun-2024 14:06                3426
function.stats-rand-gen-ibinomial-negative.php     18-Jun-2024 14:06                3649
function.stats-rand-gen-ibinomial.php              18-Jun-2024 14:06                3461
function.stats-rand-gen-int.php                    18-Jun-2024 14:06                2512
function.stats-rand-gen-ipoisson.php               18-Jun-2024 14:06                2930
function.stats-rand-gen-iuniform.php               18-Jun-2024 14:06                3392
function.stats-rand-gen-noncentral-chisquare.php   18-Jun-2024 14:06                3542
function.stats-rand-gen-noncentral-f.php           18-Jun-2024 14:06                3959
function.stats-rand-gen-noncentral-t.php           18-Jun-2024 14:06                3515
function.stats-rand-gen-normal.php                 18-Jun-2024 14:06                3433
function.stats-rand-gen-t.php                      18-Jun-2024 14:06                2829
function.stats-rand-get-seeds.php                  18-Jun-2024 14:06                2590
function.stats-rand-phrase-to-seeds.php            18-Jun-2024 14:06                2957
function.stats-rand-ranf.php                       18-Jun-2024 14:06                2604
function.stats-rand-setall.php                     18-Jun-2024 14:06                3460
function.stats-skew.php                            18-Jun-2024 14:06                2910
function.stats-standard-deviation.php              18-Jun-2024 14:06                4440
function.stats-stat-binomial-coef.php              18-Jun-2024 14:06                3276
function.stats-stat-correlation.php                18-Jun-2024 14:06                3488
function.stats-stat-factorial.php                  18-Jun-2024 14:06                2713
function.stats-stat-independent-t.php              18-Jun-2024 14:06                3781
function.stats-stat-innerproduct.php               18-Jun-2024 14:06                3451
function.stats-stat-paired-t.php                   18-Jun-2024 14:06                3443
function.stats-stat-percentile.php                 18-Jun-2024 14:06                3167
function.stats-stat-powersum.php                   18-Jun-2024 14:06                3197
function.stats-variance.php                        18-Jun-2024 14:06                3845
function.stomp-connect-error.php                   18-Jun-2024 14:06                4096
function.stomp-version.php                         18-Jun-2024 14:06                3414
function.str-contains.php                          18-Jun-2024 14:06                9644
function.str-decrement.php                         18-Jun-2024 14:06                7560
function.str-ends-with.php                         18-Jun-2024 14:06                9553
function.str-getcsv.php                            18-Jun-2024 14:06               10950
function.str-increment.php                         18-Jun-2024 14:06                7142
function.str-ireplace.php                          18-Jun-2024 14:06               11988
function.str-pad.php                               18-Jun-2024 14:06                9215
function.str-repeat.php                            18-Jun-2024 14:06                5228
function.str-replace.php                           18-Jun-2024 14:06               19612
function.str-rot13.php                             18-Jun-2024 14:06                4175
function.str-shuffle.php                           18-Jun-2024 14:06                7138
function.str-split.php                             18-Jun-2024 14:06               10078
function.str-starts-with.php                       18-Jun-2024 14:06                9622
function.str-word-count.php                        18-Jun-2024 14:06               10618
function.strcasecmp.php                            18-Jun-2024 14:06                7422
function.strchr.php                                18-Jun-2024 14:06                1740
function.strcmp.php                                18-Jun-2024 14:06                7031
function.strcoll.php                               18-Jun-2024 14:06                6301
function.strcspn.php                               18-Jun-2024 14:06               13326                  18-Jun-2024 14:06                2497          18-Jun-2024 14:06                4995                     18-Jun-2024 14:06                2518                 18-Jun-2024 14:06                6816                 18-Jun-2024 14:06                8693            18-Jun-2024 14:06                9846            18-Jun-2024 14:06                4918             18-Jun-2024 14:06                6104            18-Jun-2024 14:06                7204             18-Jun-2024 14:06                6220            18-Jun-2024 14:06                7132             18-Jun-2024 14:06                5416                 18-Jun-2024 14:06                8477                  18-Jun-2024 14:06               13058                 18-Jun-2024 14:06               10011                18-Jun-2024 14:06               20794                  18-Jun-2024 14:06                7375                   18-Jun-2024 14:06               10267                    18-Jun-2024 14:06                4655                       18-Jun-2024 14:06                6031                  18-Jun-2024 14:06               16809                 18-Jun-2024 14:06                4649                   18-Jun-2024 14:06                5516                       18-Jun-2024 14:06                4807                         18-Jun-2024 14:06                4659          18-Jun-2024 14:06               24587               18-Jun-2024 14:06                2004           18-Jun-2024 14:06                4931                         18-Jun-2024 14:06               20787                   18-Jun-2024 14:06                5918                 18-Jun-2024 14:06                5004                18-Jun-2024 14:06                4452                    18-Jun-2024 14:06                9205               18-Jun-2024 14:06                6798                  18-Jun-2024 14:06                8858                  18-Jun-2024 14:06               21157           18-Jun-2024 14:06               14476                18-Jun-2024 14:06                4519                    18-Jun-2024 14:06               10850                18-Jun-2024 14:06               12316                  18-Jun-2024 14:06                8537                  18-Jun-2024 14:06               17785                18-Jun-2024 14:06                7430                  18-Jun-2024 14:06                3676               18-Jun-2024 14:06               10611                18-Jun-2024 14:06                3306             18-Jun-2024 14:06                3567
function.strftime.php                              18-Jun-2024 14:06               66415
function.strip-tags.php                            18-Jun-2024 14:06               11350
function.stripcslashes.php                         18-Jun-2024 14:06                4510
function.stripos.php                               18-Jun-2024 14:06               14204
function.stripslashes.php                          18-Jun-2024 14:06                8347
function.stristr.php                               18-Jun-2024 14:06               12555
function.strlen.php                                18-Jun-2024 14:06                5585
function.strnatcasecmp.php                         18-Jun-2024 14:06                8817
function.strnatcmp.php                             18-Jun-2024 14:06               10309
function.strncasecmp.php                           18-Jun-2024 14:06                7980
function.strncmp.php                               18-Jun-2024 14:06                8011
function.strpbrk.php                               18-Jun-2024 14:06                5993
function.strpos.php                                18-Jun-2024 14:06               16081
function.strptime.php                              18-Jun-2024 14:06               13923
function.strrchr.php                               18-Jun-2024 14:06                9729
function.strrev.php                                18-Jun-2024 14:06                3522
function.strripos.php                              18-Jun-2024 14:06               12983
function.strrpos.php                               18-Jun-2024 14:06               13467
function.strspn.php                                18-Jun-2024 14:06               12475
function.strstr.php                                18-Jun-2024 14:06               10430
function.strtok.php                                18-Jun-2024 14:06               15613
function.strtolower.php                            18-Jun-2024 14:06                7116
function.strtotime.php                             18-Jun-2024 14:06               15345
function.strtoupper.php                            18-Jun-2024 14:06                7122
function.strtr.php                                 18-Jun-2024 14:06               14411
function.strval.php                                18-Jun-2024 14:06                7402
function.substr-compare.php                        18-Jun-2024 14:06               12179
function.substr-count.php                          18-Jun-2024 14:06               10842
function.substr-replace.php                        18-Jun-2024 14:06               17889
function.substr.php                                18-Jun-2024 14:06               25321
function.svn-add.php                               18-Jun-2024 14:06                7899
function.svn-auth-get-parameter.php                18-Jun-2024 14:06                4671
function.svn-auth-set-parameter.php                18-Jun-2024 14:06                6407
function.svn-blame.php                             18-Jun-2024 14:06                5481
function.svn-cat.php                               18-Jun-2024 14:06                5670
function.svn-checkout.php                          18-Jun-2024 14:06                8783
function.svn-cleanup.php                           18-Jun-2024 14:06                6285
function.svn-client-version.php                    18-Jun-2024 14:06                3950
function.svn-commit.php                            18-Jun-2024 14:06                9765
function.svn-delete.php                            18-Jun-2024 14:06                5754
function.svn-diff.php                              18-Jun-2024 14:06               15753
function.svn-export.php                            18-Jun-2024 14:06                5939
function.svn-fs-abort-txn.php                      18-Jun-2024 14:06                3705
function.svn-fs-apply-text.php                     18-Jun-2024 14:06                3241
function.svn-fs-begin-txn2.php                     18-Jun-2024 14:06                3104
function.svn-fs-change-node-prop.php               18-Jun-2024 14:06                4074
function.svn-fs-check-path.php                     18-Jun-2024 14:06                3240
function.svn-fs-contents-changed.php               18-Jun-2024 14:06                4065
function.svn-fs-copy.php                           18-Jun-2024 14:06                4693
function.svn-fs-delete.php                         18-Jun-2024 14:06                3987
function.svn-fs-dir-entries.php                    18-Jun-2024 14:06                3367
function.svn-fs-file-contents.php                  18-Jun-2024 14:06                3318
function.svn-fs-file-length.php                    18-Jun-2024 14:06                3187
function.svn-fs-is-dir.php                         18-Jun-2024 14:06                4096
function.svn-fs-is-file.php                        18-Jun-2024 14:06                4075
function.svn-fs-make-dir.php                       18-Jun-2024 14:06                4026
function.svn-fs-make-file.php                      18-Jun-2024 14:06                4028
function.svn-fs-node-created-rev.php               18-Jun-2024 14:06                3290
function.svn-fs-node-prop.php                      18-Jun-2024 14:06                3318
function.svn-fs-props-changed.php                  18-Jun-2024 14:06                4029
function.svn-fs-revision-prop.php                  18-Jun-2024 14:06                3338
function.svn-fs-revision-root.php                  18-Jun-2024 14:06                3308
function.svn-fs-txn-root.php                       18-Jun-2024 14:06                2975
function.svn-fs-youngest-rev.php                   18-Jun-2024 14:06                3037
function.svn-import.php                            18-Jun-2024 14:06                7343
function.svn-log.php                               18-Jun-2024 14:06               10852
function.svn-ls.php                                18-Jun-2024 14:06                8894
function.svn-mkdir.php                             18-Jun-2024 14:06                3687
function.svn-repos-create.php                      18-Jun-2024 14:06                3407
function.svn-repos-fs-begin-txn-for-commit.php     18-Jun-2024 14:06                3696
function.svn-repos-fs-commit-txn.php               18-Jun-2024 14:06                3097
function.svn-repos-fs.php                          18-Jun-2024 14:06                3015
function.svn-repos-hotcopy.php                     18-Jun-2024 14:06                3454
function.svn-repos-open.php                        18-Jun-2024 14:06                2964
function.svn-repos-recover.php                     18-Jun-2024 14:06                3053
function.svn-revert.php                            18-Jun-2024 14:06                4083
function.svn-status.php                            18-Jun-2024 14:06               18062
function.svn-update.php                            18-Jun-2024 14:06                7447
function.swoole-async-dns-lookup.php               18-Jun-2024 14:06                4126
function.swoole-async-read.php                     18-Jun-2024 14:06                4722
function.swoole-async-readfile.php                 18-Jun-2024 14:06                4118
function.swoole-async-set.php                      18-Jun-2024 14:06                2624
function.swoole-async-write.php                    18-Jun-2024 14:06                4067
function.swoole-async-writefile.php                18-Jun-2024 14:06                4066
function.swoole-clear-error.php                    18-Jun-2024 14:06                2572
function.swoole-client-select.php                  18-Jun-2024 14:06                3619
function.swoole-cpu-num.php                        18-Jun-2024 14:06                2280
function.swoole-errno.php                          18-Jun-2024 14:06                2274
function.swoole-error-log.php                      18-Jun-2024 14:06                3894
function.swoole-event-add.php                      18-Jun-2024 14:06                3612
function.swoole-event-defer.php                    18-Jun-2024 14:06                2872
function.swoole-event-del.php                      18-Jun-2024 14:06                2807
function.swoole-event-exit.php                     18-Jun-2024 14:06                2346
function.swoole-event-set.php                      18-Jun-2024 14:06                3587
function.swoole-event-wait.php                     18-Jun-2024 14:06                2286
function.swoole-event-write.php                    18-Jun-2024 14:06                3083
function.swoole-get-local-ip.php                   18-Jun-2024 14:06                2390
function.swoole-last-error.php                     18-Jun-2024 14:06                2319
function.swoole-load-module.php                    18-Jun-2024 14:06                2449
function.swoole-select.php                         18-Jun-2024 14:06                3603
function.swoole-set-process-name.php               18-Jun-2024 14:06                2753
function.swoole-strerror.php                       18-Jun-2024 14:06                2724
function.swoole-timer-after.php                    18-Jun-2024 14:06                3115
function.swoole-timer-exists.php                   18-Jun-2024 14:06                2559
function.swoole-timer-tick.php                     18-Jun-2024 14:06                3061
function.swoole-version.php                        18-Jun-2024 14:06                2267
function.symlink.php                               18-Jun-2024 14:06                6149
function.sys-get-temp-dir.php                      18-Jun-2024 14:06                4674
function.sys-getloadavg.php                        18-Jun-2024 14:06                4663
function.syslog.php                                18-Jun-2024 14:06               10547
function.system.php                                18-Jun-2024 14:06                9149
function.taint.php                                 18-Jun-2024 14:06                3078
function.tan.php                                   18-Jun-2024 14:06                4753
function.tanh.php                                  18-Jun-2024 14:06                3707
function.tcpwrap-check.php                         18-Jun-2024 14:06                6478
function.tempnam.php                               18-Jun-2024 14:06                8169
function.textdomain.php                            18-Jun-2024 14:06                3765
function.tidy-access-count.php                     18-Jun-2024 14:06                7082
function.tidy-config-count.php                     18-Jun-2024 14:06                4622
function.tidy-error-count.php                      18-Jun-2024 14:06                5807
function.tidy-get-output.php                       18-Jun-2024 14:06                4604
function.tidy-warning-count.php                    18-Jun-2024 14:06                5349
function.time-nanosleep.php                        18-Jun-2024 14:06                9754
function.time-sleep-until.php                      18-Jun-2024 14:06                6645
function.time.php                                  18-Jun-2024 14:06                5386
function.timezone-abbreviations-list.php           18-Jun-2024 14:06                1987
function.timezone-identifiers-list.php             18-Jun-2024 14:06                2003
function.timezone-location-get.php                 18-Jun-2024 14:06                1959
function.timezone-name-from-abbr.php               18-Jun-2024 14:06                7063
function.timezone-name-get.php                     18-Jun-2024 14:06                1903
function.timezone-offset-get.php                   18-Jun-2024 14:06                1901
function.timezone-open.php                         18-Jun-2024 14:06                1889
function.timezone-transitions-get.php              18-Jun-2024 14:06                1962
function.timezone-version-get.php                  18-Jun-2024 14:06                5151
function.tmpfile.php                               18-Jun-2024 14:06                6379
function.token-get-all.php                         18-Jun-2024 14:06               13403
function.token-name.php                            18-Jun-2024 14:06                4599
function.touch.php                                 18-Jun-2024 14:06                9247
function.trader-acos.php                           18-Jun-2024 14:06                2902
function.trader-ad.php                             18-Jun-2024 14:06                3873
function.trader-add.php                            18-Jun-2024 14:06                3280
function.trader-adosc.php                          18-Jun-2024 14:06                4902
function.trader-adx.php                            18-Jun-2024 14:06                3891
function.trader-adxr.php                           18-Jun-2024 14:06                3912
function.trader-apo.php                            18-Jun-2024 14:06                4205
function.trader-aroon.php                          18-Jun-2024 14:06                3425
function.trader-aroonosc.php                       18-Jun-2024 14:06                3474
function.trader-asin.php                           18-Jun-2024 14:06                2901
function.trader-atan.php                           18-Jun-2024 14:06                2843
function.trader-atr.php                            18-Jun-2024 14:06                3874
function.trader-avgprice.php                       18-Jun-2024 14:06                3837
function.trader-bbands.php                         18-Jun-2024 14:06                4960
function.trader-beta.php                           18-Jun-2024 14:06                3400
function.trader-bop.php                            18-Jun-2024 14:06                3779
function.trader-cci.php                            18-Jun-2024 14:06                3870
function.trader-cdl2crows.php                      18-Jun-2024 14:06                3918
function.trader-cdl3blackcrows.php                 18-Jun-2024 14:06                3985
function.trader-cdl3inside.php                     18-Jun-2024 14:06                4011
function.trader-cdl3linestrike.php                 18-Jun-2024 14:06                3980
function.trader-cdl3outside.php                    18-Jun-2024 14:06                4025
function.trader-cdl3starsinsouth.php               18-Jun-2024 14:06                4021
function.trader-cdl3whitesoldiers.php              18-Jun-2024 14:06                4042
function.trader-cdlabandonedbaby.php               18-Jun-2024 14:06                4481
function.trader-cdladvanceblock.php                18-Jun-2024 14:06                4016
function.trader-cdlbelthold.php                    18-Jun-2024 14:06                3965
function.trader-cdlbreakaway.php                   18-Jun-2024 14:06                3963
function.trader-cdlclosingmarubozu.php             18-Jun-2024 14:06                4050
function.trader-cdlconcealbabyswall.php            18-Jun-2024 14:06                4070
function.trader-cdlcounterattack.php               18-Jun-2024 14:06                4027
function.trader-cdldarkcloudcover.php              18-Jun-2024 14:06                4491
function.trader-cdldoji.php                        18-Jun-2024 14:06                3909
function.trader-cdldojistar.php                    18-Jun-2024 14:06                3952
function.trader-cdldragonflydoji.php               18-Jun-2024 14:06                4006
function.trader-cdlengulfing.php                   18-Jun-2024 14:06                3983
function.trader-cdleveningdojistar.php             18-Jun-2024 14:06                4500
function.trader-cdleveningstar.php                 18-Jun-2024 14:06                4473
function.trader-cdlgapsidesidewhite.php            18-Jun-2024 14:06                4063
function.trader-cdlgravestonedoji.php              18-Jun-2024 14:06                4028
function.trader-cdlhammer.php                      18-Jun-2024 14:06                3935
function.trader-cdlhangingman.php                  18-Jun-2024 14:06                3959
function.trader-cdlharami.php                      18-Jun-2024 14:06                3931
function.trader-cdlharamicross.php                 18-Jun-2024 14:06                3978
function.trader-cdlhighwave.php                    18-Jun-2024 14:06                3958
function.trader-cdlhikkake.php                     18-Jun-2024 14:06                3931
function.trader-cdlhikkakemod.php                  18-Jun-2024 14:06                3996
function.trader-cdlhomingpigeon.php                18-Jun-2024 14:06                4016
function.trader-cdlidentical3crows.php             18-Jun-2024 14:06                4043
function.trader-cdlinneck.php                      18-Jun-2024 14:06                3957
function.trader-cdlinvertedhammer.php              18-Jun-2024 14:06                4022
function.trader-cdlkicking.php                     18-Jun-2024 14:06                3972
function.trader-cdlkickingbylength.php             18-Jun-2024 14:06                4125
function.trader-cdlladderbottom.php                18-Jun-2024 14:06                4024
function.trader-cdllongleggeddoji.php              18-Jun-2024 14:06                4028
function.trader-cdllongline.php                    18-Jun-2024 14:06                3966
function.trader-cdlmarubozu.php                    18-Jun-2024 14:06                3951
function.trader-cdlmatchinglow.php                 18-Jun-2024 14:06                4010
function.trader-cdlmathold.php                     18-Jun-2024 14:06                4430
function.trader-cdlmorningdojistar.php             18-Jun-2024 14:06                4496
function.trader-cdlmorningstar.php                 18-Jun-2024 14:06                4453
function.trader-cdlonneck.php                      18-Jun-2024 14:06                3935
function.trader-cdlpiercing.php                    18-Jun-2024 14:06                3963
function.trader-cdlrickshawman.php                 18-Jun-2024 14:06                4006
function.trader-cdlrisefall3methods.php            18-Jun-2024 14:06                4059
function.trader-cdlseparatinglines.php             18-Jun-2024 14:06                4043
function.trader-cdlshootingstar.php                18-Jun-2024 14:06                4014
function.trader-cdlshortline.php                   18-Jun-2024 14:06                3991
function.trader-cdlspinningtop.php                 18-Jun-2024 14:06                3985
function.trader-cdlstalledpattern.php              18-Jun-2024 14:06                4025
function.trader-cdlsticksandwich.php               18-Jun-2024 14:06                4020
function.trader-cdltakuri.php                      18-Jun-2024 14:06                4018
function.trader-cdltasukigap.php                   18-Jun-2024 14:06                3962
function.trader-cdlthrusting.php                   18-Jun-2024 14:06                3951
function.trader-cdltristar.php                     18-Jun-2024 14:06                3943
function.trader-cdlunique3river.php                18-Jun-2024 14:06                4024
function.trader-cdlupsidegap2crows.php             18-Jun-2024 14:06                4068
function.trader-cdlxsidegap3methods.php            18-Jun-2024 14:06                4070
function.trader-ceil.php                           18-Jun-2024 14:06                2948
function.trader-cmo.php                            18-Jun-2024 14:06                3049
function.trader-correl.php                         18-Jun-2024 14:06                3490
function.trader-cos.php                            18-Jun-2024 14:06                2879
function.trader-cosh.php                           18-Jun-2024 14:06                2947
function.trader-dema.php                           18-Jun-2024 14:06                3095
function.trader-div.php                            18-Jun-2024 14:06                3264
function.trader-dx.php                             18-Jun-2024 14:06                3860
function.trader-ema.php                            18-Jun-2024 14:06                3069
function.trader-errno.php                          18-Jun-2024 14:06                2482
function.trader-exp.php                            18-Jun-2024 14:06                2971
function.trader-floor.php                          18-Jun-2024 14:06                2924
function.trader-get-compat.php                     18-Jun-2024 14:06                2715
function.trader-get-unstable-period.php            18-Jun-2024 14:06                3108
function.trader-ht-dcperiod.php                    18-Jun-2024 14:06                2820
function.trader-ht-dcphase.php                     18-Jun-2024 14:06                2790
function.trader-ht-phasor.php                      18-Jun-2024 14:06                2832
function.trader-ht-sine.php                        18-Jun-2024 14:06                2807
function.trader-ht-trendline.php                   18-Jun-2024 14:06                2858
function.trader-ht-trendmode.php                   18-Jun-2024 14:06                2842
function.trader-kama.php                           18-Jun-2024 14:06                3118
function.trader-linearreg-angle.php                18-Jun-2024 14:06                3199
function.trader-linearreg-intercept.php            18-Jun-2024 14:06                3253
function.trader-linearreg-slope.php                18-Jun-2024 14:06                3213
function.trader-linearreg.php                      18-Jun-2024 14:06                3110
function.trader-ln.php                             18-Jun-2024 14:06                2876
function.trader-log10.php                          18-Jun-2024 14:06                2903
function.trader-ma.php                             18-Jun-2024 14:06                3516
function.trader-macd.php                           18-Jun-2024 14:06                4211
function.trader-macdext.php                        18-Jun-2024 14:06                6096
function.trader-macdfix.php                        18-Jun-2024 14:06                3224
function.trader-mama.php                           18-Jun-2024 14:06                3663
function.trader-mavp.php                           18-Jun-2024 14:06                4644
function.trader-max.php                            18-Jun-2024 14:06                3060
function.trader-maxindex.php                       18-Jun-2024 14:06                3123
function.trader-medprice.php                       18-Jun-2024 14:06                3026
function.trader-mfi.php                            18-Jun-2024 14:06                4263
function.trader-midpoint.php                       18-Jun-2024 14:06                3102
function.trader-midprice.php                       18-Jun-2024 14:06                3450
function.trader-min.php                            18-Jun-2024 14:06                3074
function.trader-minindex.php                       18-Jun-2024 14:06                3119
function.trader-minmax.php                         18-Jun-2024 14:06                3136
function.trader-minmaxindex.php                    18-Jun-2024 14:06                3191
function.trader-minus-di.php                       18-Jun-2024 14:06                3944
function.trader-minus-dm.php                       18-Jun-2024 14:06                3461
function.trader-mom.php                            18-Jun-2024 14:06                3026
function.trader-mult.php                           18-Jun-2024 14:06                3277
function.trader-natr.php                           18-Jun-2024 14:06                3905
function.trader-obv.php                            18-Jun-2024 14:06                3025
function.trader-plus-di.php                        18-Jun-2024 14:06                3914
function.trader-plus-dm.php                        18-Jun-2024 14:06                3447
function.trader-ppo.php                            18-Jun-2024 14:06                4200
function.trader-roc.php                            18-Jun-2024 14:06                3100
function.trader-rocp.php                           18-Jun-2024 14:06                3123
function.trader-rocr.php                           18-Jun-2024 14:06                3120
function.trader-rocr100.php                        18-Jun-2024 14:06                3163
function.trader-rsi.php                            18-Jun-2024 14:06                3043
function.trader-sar.php                            18-Jun-2024 14:06                4311
function.trader-sarext.php                         18-Jun-2024 14:06                8980
function.trader-set-compat.php                     18-Jun-2024 14:06                2982
function.trader-set-unstable-period.php            18-Jun-2024 14:06                3784
function.trader-sin.php                            18-Jun-2024 14:06                2903
function.trader-sinh.php                           18-Jun-2024 14:06                2924
function.trader-sma.php                            18-Jun-2024 14:06                3054
function.trader-sqrt.php                           18-Jun-2024 14:06                2882
function.trader-stddev.php                         18-Jun-2024 14:06                3387
function.trader-stoch.php                          18-Jun-2024 14:06                6049
function.trader-stochf.php                         18-Jun-2024 14:06                5055
function.trader-stochrsi.php                       18-Jun-2024 14:06                4751
function.trader-sub.php                            18-Jun-2024 14:06                3238
function.trader-sum.php                            18-Jun-2024 14:06                2990
function.trader-t3.php                             18-Jun-2024 14:06                3475
function.trader-tan.php                            18-Jun-2024 14:06                2875
function.trader-tanh.php                           18-Jun-2024 14:06                2904
function.trader-tema.php                           18-Jun-2024 14:06                3099
function.trader-trange.php                         18-Jun-2024 14:06                3364
function.trader-trima.php                          18-Jun-2024 14:06                3079
function.trader-trix.php                           18-Jun-2024 14:06                3112
function.trader-tsf.php                            18-Jun-2024 14:06                3041
function.trader-typprice.php                       18-Jun-2024 14:06                3376
function.trader-ultosc.php                         18-Jun-2024 14:06                4966
function.trader-var.php                            18-Jun-2024 14:06                3334
function.trader-wclprice.php                       18-Jun-2024 14:06                3401
function.trader-willr.php                          18-Jun-2024 14:06                3898
function.trader-wma.php                            18-Jun-2024 14:06                3115
function.trait-exists.php                          18-Jun-2024 14:06                3405
function.trigger-error.php                         18-Jun-2024 14:06                9118
function.trim.php                                  18-Jun-2024 14:06               14872
function.uasort.php                                18-Jun-2024 14:06               12129
function.ucfirst.php                               18-Jun-2024 14:06                6935
function.ucwords.php                               18-Jun-2024 14:06               11046
function.ui-draw-text-font-fontfamilies.php        18-Jun-2024 14:06                2691
function.ui-quit.php                               18-Jun-2024 14:06                2213
function.ui-run.php                                18-Jun-2024 14:06                2653
function.uksort.php                                18-Jun-2024 14:06               11413
function.umask.php                                 18-Jun-2024 14:06                6723
function.uniqid.php                                18-Jun-2024 14:06               10401
function.unixtojd.php                              18-Jun-2024 14:06                4501
function.unlink.php                                18-Jun-2024 14:06                6992
function.unpack.php                                18-Jun-2024 14:06               12632
function.unregister-tick-function.php              18-Jun-2024 14:06                3659
function.unserialize.php                           18-Jun-2024 14:06               21394
function.unset.php                                 18-Jun-2024 14:06               17418
function.untaint.php                               18-Jun-2024 14:06                2689
function.uopz-add-function.php                     18-Jun-2024 14:06                7849
function.uopz-allow-exit.php                       18-Jun-2024 14:06                5227
function.uopz-backup.php                           18-Jun-2024 14:06                4985
function.uopz-compose.php                          18-Jun-2024 14:06                7415
function.uopz-copy.php                             18-Jun-2024 14:06                5553
function.uopz-del-function.php                     18-Jun-2024 14:06                7196
function.uopz-delete.php                           18-Jun-2024 14:06                6287
function.uopz-extend.php                           18-Jun-2024 14:06                5533
function.uopz-flags.php                            18-Jun-2024 14:06               11837
function.uopz-function.php                         18-Jun-2024 14:06                7824
function.uopz-get-exit-status.php                  18-Jun-2024 14:06                4761
function.uopz-get-hook.php                         18-Jun-2024 14:06                5889
function.uopz-get-mock.php                         18-Jun-2024 14:06                5428
function.uopz-get-property.php                     18-Jun-2024 14:06                6811
function.uopz-get-return.php                       18-Jun-2024 14:06                4869
function.uopz-get-static.php                       18-Jun-2024 14:06                5812
function.uopz-implement.php                        18-Jun-2024 14:06                5437
function.uopz-overload.php                         18-Jun-2024 14:06                4307
function.uopz-redefine.php                         18-Jun-2024 14:06                5625
function.uopz-rename.php                           18-Jun-2024 14:06                7292
function.uopz-restore.php                          18-Jun-2024 14:06                5275
function.uopz-set-hook.php                         18-Jun-2024 14:06                6271
function.uopz-set-mock.php                         18-Jun-2024 14:06               11858
function.uopz-set-property.php                     18-Jun-2024 14:06                8182
function.uopz-set-return.php                       18-Jun-2024 14:06               10510
function.uopz-set-static.php                       18-Jun-2024 14:06                6382
function.uopz-undefine.php                         18-Jun-2024 14:06                5111
function.uopz-unset-hook.php                       18-Jun-2024 14:06                6081
function.uopz-unset-mock.php                       18-Jun-2024 14:06                5835
function.uopz-unset-return.php                     18-Jun-2024 14:06                5298
function.urldecode.php                             18-Jun-2024 14:06                6959
function.urlencode.php                             18-Jun-2024 14:06               11520
function.use-soap-error-handler.php                18-Jun-2024 14:06                4656
function.user-error.php                            18-Jun-2024 14:06                1781
function.usleep.php                                18-Jun-2024 14:06                7972
function.usort.php                                 18-Jun-2024 14:06               29748
function.utf8-decode.php                           18-Jun-2024 14:06               21006
function.utf8-encode.php                           18-Jun-2024 14:06               17608
function.var-dump.php                              18-Jun-2024 14:06                7999
function.var-export.php                            18-Jun-2024 14:06               18698
function.var-representation.php                    18-Jun-2024 14:06               14362
function.variant-abs.php                           18-Jun-2024 14:06                5082
function.variant-add.php                           18-Jun-2024 14:06                6588
function.variant-and.php                           18-Jun-2024 14:06                8468
function.variant-cast.php                          18-Jun-2024 14:06                3891
function.variant-cat.php                           18-Jun-2024 14:06                5534
function.variant-cmp.php                           18-Jun-2024 14:06                9203
function.variant-date-from-timestamp.php           18-Jun-2024 14:06                4128
function.variant-date-to-timestamp.php             18-Jun-2024 14:06                4272
function.variant-div.php                           18-Jun-2024 14:06                7507
function.variant-eqv.php                           18-Jun-2024 14:06                5472
function.variant-fix.php                           18-Jun-2024 14:06                6794
function.variant-get-type.php                      18-Jun-2024 14:06                3961
function.variant-idiv.php                          18-Jun-2024 14:06                6840
function.variant-imp.php                           18-Jun-2024 14:06                7987
function.variant-int.php                           18-Jun-2024 14:06                6116
function.variant-mod.php                           18-Jun-2024 14:06                5593
function.variant-mul.php                           18-Jun-2024 14:06                6862
function.variant-neg.php                           18-Jun-2024 14:06                4640
function.variant-not.php                           18-Jun-2024 14:06                5094
function.variant-or.php                            18-Jun-2024 14:06                8699
function.variant-pow.php                           18-Jun-2024 14:06                5487
function.variant-round.php                         18-Jun-2024 14:06                5317
function.variant-set-type.php                      18-Jun-2024 14:06                4015
function.variant-set.php                           18-Jun-2024 14:06                3241
function.variant-sub.php                           18-Jun-2024 14:06                6435
function.variant-xor.php                           18-Jun-2024 14:06                7350
function.version-compare.php                       18-Jun-2024 14:06               13078
function.vfprintf.php                              18-Jun-2024 14:06               25137
function.virtual.php                               18-Jun-2024 14:06                6927
function.vprintf.php                               18-Jun-2024 14:06               24598
function.vsprintf.php                              18-Jun-2024 14:06               24471
function.wddx-add-vars.php                         18-Jun-2024 14:06                4295
function.wddx-deserialize.php                      18-Jun-2024 14:06                4245
function.wddx-packet-end.php                       18-Jun-2024 14:06                3088
function.wddx-packet-start.php                     18-Jun-2024 14:06                3497
function.wddx-serialize-value.php                  18-Jun-2024 14:06                3615
function.wddx-serialize-vars.php                   18-Jun-2024 14:06                6550
function.win32-continue-service.php                18-Jun-2024 14:06                7913
function.win32-create-service.php                  18-Jun-2024 14:06               33776
function.win32-delete-service.php                  18-Jun-2024 14:06                8302
function.win32-get-last-control-message.php        18-Jun-2024 14:06                9692
function.win32-pause-service.php                   18-Jun-2024 14:06                7851
function.win32-query-service-status.php            18-Jun-2024 14:06               10392
function.win32-send-custom-control.php             18-Jun-2024 14:06                8493
function.win32-set-service-exit-code.php           18-Jun-2024 14:06                6851
function.win32-set-service-exit-mode.php           18-Jun-2024 14:06                6846
function.win32-set-service-status.php              18-Jun-2024 14:06               10940
function.win32-start-service-ctrl-dispatcher.php   18-Jun-2024 14:06               13326
function.win32-start-service.php                   18-Jun-2024 14:06                7942
function.win32-stop-service.php                    18-Jun-2024 14:06                7847
function.wincache-fcache-fileinfo.php              18-Jun-2024 14:06               10868
function.wincache-fcache-meminfo.php               18-Jun-2024 14:06                8433
function.wincache-lock.php                         18-Jun-2024 14:06               10331
function.wincache-ocache-fileinfo.php              18-Jun-2024 14:06               11768
function.wincache-ocache-meminfo.php               18-Jun-2024 14:06                8595
function.wincache-refresh-if-changed.php           18-Jun-2024 14:06                9375
function.wincache-rplist-fileinfo.php              18-Jun-2024 14:06                8879
function.wincache-rplist-meminfo.php               18-Jun-2024 14:06                8687
function.wincache-scache-info.php                  18-Jun-2024 14:06               11318
function.wincache-scache-meminfo.php               18-Jun-2024 14:06                7865
function.wincache-ucache-add.php                   18-Jun-2024 14:06               16379
function.wincache-ucache-cas.php                   18-Jun-2024 14:06                7260
function.wincache-ucache-clear.php                 18-Jun-2024 14:06                8521
function.wincache-ucache-dec.php                   18-Jun-2024 14:06                7319
function.wincache-ucache-delete.php                18-Jun-2024 14:06               12896
function.wincache-ucache-exists.php                18-Jun-2024 14:06                7173
function.wincache-ucache-get.php                   18-Jun-2024 14:06               12447
function.wincache-ucache-inc.php                   18-Jun-2024 14:06                7314
function.wincache-ucache-info.php                  18-Jun-2024 14:06               13486
function.wincache-ucache-meminfo.php               18-Jun-2024 14:06                8272
function.wincache-ucache-set.php                   18-Jun-2024 14:06               16360
function.wincache-unlock.php                       18-Jun-2024 14:06                9242
function.wordwrap.php                              18-Jun-2024 14:06               10374
function.xattr-get.php                             18-Jun-2024 14:06                7078
function.xattr-list.php                            18-Jun-2024 14:06                7503
function.xattr-remove.php                          18-Jun-2024 14:06                7320
function.xattr-set.php                             18-Jun-2024 14:06                9214
function.xattr-supported.php                       18-Jun-2024 14:06                6017
function.xdiff-file-bdiff-size.php                 18-Jun-2024 14:06                5441
function.xdiff-file-bdiff.php                      18-Jun-2024 14:06                6658
function.xdiff-file-bpatch.php                     18-Jun-2024 14:06                7250
function.xdiff-file-diff-binary.php                18-Jun-2024 14:06                7151
function.xdiff-file-diff.php                       18-Jun-2024 14:06                8451
function.xdiff-file-merge3.php                     18-Jun-2024 14:06                7432
function.xdiff-file-patch-binary.php               18-Jun-2024 14:06                7304
function.xdiff-file-patch.php                      18-Jun-2024 14:06                9841
function.xdiff-file-rabdiff.php                    18-Jun-2024 14:06                7375
function.xdiff-string-bdiff-size.php               18-Jun-2024 14:06                5844
function.xdiff-string-bdiff.php                    18-Jun-2024 14:06                4464
function.xdiff-string-bpatch.php                   18-Jun-2024 14:06                4384
function.xdiff-string-diff-binary.php              18-Jun-2024 14:06                5069
function.xdiff-string-diff.php                     18-Jun-2024 14:06                8507
function.xdiff-string-merge3.php                   18-Jun-2024 14:06                5410
function.xdiff-string-patch-binary.php             18-Jun-2024 14:06                4955
function.xdiff-string-patch.php                    18-Jun-2024 14:06                9129
function.xdiff-string-rabdiff.php                  18-Jun-2024 14:06                5213
function.xhprof-disable.php                        18-Jun-2024 14:06                4230
function.xhprof-enable.php                         18-Jun-2024 14:06                7950
function.xhprof-sample-disable.php                 18-Jun-2024 14:06                4895
function.xhprof-sample-enable.php                  18-Jun-2024 14:06                4099
function.xml-error-string.php                      18-Jun-2024 14:06                3851
function.xml-get-current-byte-index.php            18-Jun-2024 14:06                5188
function.xml-get-current-column-number.php         18-Jun-2024 14:06                4880
function.xml-get-current-line-number.php           18-Jun-2024 14:06                4630
function.xml-get-error-code.php                    18-Jun-2024 14:06                4198
function.xml-parse-into-struct.php                 18-Jun-2024 14:06               21265
function.xml-parse.php                             18-Jun-2024 14:06                9548
function.xml-parser-create-ns.php                  18-Jun-2024 14:06                6586
function.xml-parser-create.php                     18-Jun-2024 14:06                5842
function.xml-parser-free.php                       18-Jun-2024 14:06                4771
function.xml-parser-get-option.php                 18-Jun-2024 14:06                6917
function.xml-parser-set-option.php                 18-Jun-2024 14:06                9268
function.xml-set-character-data-handler.php        18-Jun-2024 14:06                6607
function.xml-set-default-handler.php               18-Jun-2024 14:06                6469
function.xml-set-element-handler.php               18-Jun-2024 14:06               10955
function.xml-set-end-namespace-decl-handler.php    18-Jun-2024 14:06                7786
function.xml-set-external-entity-ref-handler.php   18-Jun-2024 14:06                9991
function.xml-set-notation-decl-handler.php         18-Jun-2024 14:06                8806
function.xml-set-object.php                        18-Jun-2024 14:06                9926
function.xml-set-processing-instruction-handler..> 18-Jun-2024 14:06                7667
function.xml-set-start-namespace-decl-handler.php  18-Jun-2024 14:06                8043
function.xml-set-unparsed-entity-decl-handler.php  18-Jun-2024 14:06                9707
function.xmlrpc-decode-request.php                 18-Jun-2024 14:06                3123
function.xmlrpc-decode.php                         18-Jun-2024 14:06                4660
function.xmlrpc-encode-request.php                 18-Jun-2024 14:06                9192
function.xmlrpc-encode.php                         18-Jun-2024 14:06                2697
function.xmlrpc-get-type.php                       18-Jun-2024 14:06                6748
function.xmlrpc-is-fault.php                       18-Jun-2024 14:06                4400
function.xmlrpc-parse-method-descriptions.php      18-Jun-2024 14:06                2897
function.xmlrpc-server-add-introspection-data.php  18-Jun-2024 14:06                3103
function.xmlrpc-server-call-method.php             18-Jun-2024 14:06                3515
function.xmlrpc-server-create.php                  18-Jun-2024 14:06                2602
function.xmlrpc-server-destroy.php                 18-Jun-2024 14:06                2828
function.xmlrpc-server-register-introspection-c..> 18-Jun-2024 14:06                3198
function.xmlrpc-server-register-method.php         18-Jun-2024 14:06                3287
function.xmlrpc-set-type.php                       18-Jun-2024 14:06                6167
function.yaml-emit-file.php                        18-Jun-2024 14:06                7613
function.yaml-emit.php                             18-Jun-2024 14:06               13334
function.yaml-parse-file.php                       18-Jun-2024 14:06                7255
function.yaml-parse-url.php                        18-Jun-2024 14:06                7953
function.yaml-parse.php                            18-Jun-2024 14:06               10940
function.yaz-addinfo.php                           18-Jun-2024 14:06                4055
function.yaz-ccl-conf.php                          18-Jun-2024 14:06                6491
function.yaz-ccl-parse.php                         18-Jun-2024 14:06                7562
function.yaz-close.php                             18-Jun-2024 14:06                4005
function.yaz-connect.php                           18-Jun-2024 14:06               11642
function.yaz-database.php                          18-Jun-2024 14:06                3932
function.yaz-element.php                           18-Jun-2024 14:06                4395
function.yaz-errno.php                             18-Jun-2024 14:06                4274
function.yaz-error.php                             18-Jun-2024 14:06                3928
function.yaz-es-result.php                         18-Jun-2024 14:06                3656
function.yaz-es.php                                18-Jun-2024 14:06                7831
function.yaz-get-option.php                        18-Jun-2024 14:06                3758
function.yaz-hits.php                              18-Jun-2024 14:06                5946
function.yaz-itemorder.php                         18-Jun-2024 14:06                7514
function.yaz-present.php                           18-Jun-2024 14:06                3401
function.yaz-range.php                             18-Jun-2024 14:06                4004
function.yaz-record.php                            18-Jun-2024 14:06               17198
function.yaz-scan-result.php                       18-Jun-2024 14:06                4605
function.yaz-scan.php                              18-Jun-2024 14:06               10333
function.yaz-schema.php                            18-Jun-2024 14:06                3937
function.yaz-search.php                            18-Jun-2024 14:06               10964
function.yaz-set-option.php                        18-Jun-2024 14:06                8236
function.yaz-sort.php                              18-Jun-2024 14:06                6791
function.yaz-syntax.php                            18-Jun-2024 14:06                3943
function.yaz-wait.php                              18-Jun-2024 14:06                4973
function.zend-thread-id.php                        18-Jun-2024 14:06                4403
function.zend-version.php                          18-Jun-2024 14:06                4350                             18-Jun-2024 14:06                4317                       18-Jun-2024 14:06                4658              18-Jun-2024 14:06                4912           18-Jun-2024 14:06                4936                    18-Jun-2024 14:06                4850                        18-Jun-2024 14:06                4688                        18-Jun-2024 14:06                6788                        18-Jun-2024 14:06                5843                              18-Jun-2024 14:06                4828                              18-Jun-2024 14:06                5210
function.zlib-decode.php                           18-Jun-2024 14:06                3810
function.zlib-encode.php                           18-Jun-2024 14:06                5817
function.zlib-get-coding-type.php                  18-Jun-2024 14:06                3162
function.zookeeper-dispatch.php                    18-Jun-2024 14:06                9445
functional.parallel.php                            18-Jun-2024 14:06                3252
functions.anonymous.php                            18-Jun-2024 14:06               27304
functions.arguments.php                            18-Jun-2024 14:06               50271
functions.arrow.php                                18-Jun-2024 14:06               11816
functions.first_class_callable_syntax.php          18-Jun-2024 14:06               12751
functions.internal.php                             18-Jun-2024 14:06               10025
functions.returning-values.php                     18-Jun-2024 14:06                7215
functions.user-defined.php                         18-Jun-2024 14:06               11209
functions.variable-functions.php                   18-Jun-2024 14:06               12430
gearman.configuration.php                          18-Jun-2024 14:06                1439
gearman.constants.php                              18-Jun-2024 14:06               27707
gearman.examples-reverse-bg.php                    18-Jun-2024 14:06               11704
gearman.examples-reverse-task.php                  18-Jun-2024 14:06               18452
gearman.examples-reverse.php                       18-Jun-2024 14:06               13714
gearman.examples.php                               18-Jun-2024 14:06                1817
gearman.installation.php                           18-Jun-2024 14:06                1821
gearman.requirements.php                           18-Jun-2024 14:06                1624
gearman.resources.php                              18-Jun-2024 14:06                1415
gearman.setup.php                                  18-Jun-2024 14:06                1745
gearmanclient.addoptions.php                       18-Jun-2024 14:06                3609
gearmanclient.addserver.php                        18-Jun-2024 14:06                6134
gearmanclient.addservers.php                       18-Jun-2024 14:06                5642
gearmanclient.addtask.php                          18-Jun-2024 14:06               16945
gearmanclient.addtaskbackground.php                18-Jun-2024 14:06               24085
gearmanclient.addtaskhigh.php                      18-Jun-2024 14:06               13364
gearmanclient.addtaskhighbackground.php            18-Jun-2024 14:06                7705
gearmanclient.addtasklow.php                       18-Jun-2024 14:06               13301
gearmanclient.addtasklowbackground.php             18-Jun-2024 14:06                7696
gearmanclient.addtaskstatus.php                    18-Jun-2024 14:06               11347
gearmanclient.clearcallbacks.php                   18-Jun-2024 14:06                5359
gearmanclient.clone.php                            18-Jun-2024 14:06                2852
gearmanclient.construct.php                        18-Jun-2024 14:06                3102
gearmanclient.context.php                          18-Jun-2024 14:06                3191                             18-Jun-2024 14:06                3530                               18-Jun-2024 14:06               24625
gearmanclient.dobackground.php                     18-Jun-2024 14:06               11149
gearmanclient.dohigh.php                           18-Jun-2024 14:06                6115
gearmanclient.dohighbackground.php                 18-Jun-2024 14:06                5960
gearmanclient.dojobhandle.php                      18-Jun-2024 14:06                3414
gearmanclient.dolow.php                            18-Jun-2024 14:06                6290
gearmanclient.dolowbackground.php                  18-Jun-2024 14:06                5914
gearmanclient.donormal.php                         18-Jun-2024 14:06               25539
gearmanclient.dostatus.php                         18-Jun-2024 14:06                9414
gearmanclient.echo.php                             18-Jun-2024 14:06                3366
gearmanclient.error.php                            18-Jun-2024 14:06                3196
gearmanclient.geterrno.php                         18-Jun-2024 14:06                2909
gearmanclient.jobstatus.php                        18-Jun-2024 14:06                9561                             18-Jun-2024 14:06                3446
gearmanclient.removeoptions.php                    18-Jun-2024 14:06                2893
gearmanclient.returncode.php                       18-Jun-2024 14:06                2512
gearmanclient.runtasks.php                         18-Jun-2024 14:06                4162
gearmanclient.setclientcallback.php                18-Jun-2024 14:06                6640
gearmanclient.setcompletecallback.php              18-Jun-2024 14:06                6537
gearmanclient.setcontext.php                       18-Jun-2024 14:06                3587
gearmanclient.setcreatedcallback.php               18-Jun-2024 14:06                5975
gearmanclient.setdata.php                          18-Jun-2024 14:06                3796
gearmanclient.setdatacallback.php                  18-Jun-2024 14:06                5845
gearmanclient.setexceptioncallback.php             18-Jun-2024 14:06                5810
gearmanclient.setfailcallback.php                  18-Jun-2024 14:06                5834
gearmanclient.setoptions.php                       18-Jun-2024 14:06                2890
gearmanclient.setstatuscallback.php                18-Jun-2024 14:06                5925
gearmanclient.settimeout.php                       18-Jun-2024 14:06                2981
gearmanclient.setwarningcallback.php               18-Jun-2024 14:06                5904
gearmanclient.setworkloadcallback.php              18-Jun-2024 14:06                6382
gearmanclient.timeout.php                          18-Jun-2024 14:06                3148
gearmanclient.wait.php                             18-Jun-2024 14:06                3182
gearmanjob.complete.php                            18-Jun-2024 14:06                4110
gearmanjob.construct.php                           18-Jun-2024 14:06                2523                                18-Jun-2024 14:06                3949
gearmanjob.exception.php                           18-Jun-2024 14:06                4167                                18-Jun-2024 14:06                4321
gearmanjob.functionname.php                        18-Jun-2024 14:06                3265
gearmanjob.handle.php                              18-Jun-2024 14:06                3128
gearmanjob.returncode.php                          18-Jun-2024 14:06                2916
gearmanjob.sendcomplete.php                        18-Jun-2024 14:06                3773
gearmanjob.senddata.php                            18-Jun-2024 14:06                3673
gearmanjob.sendexception.php                       18-Jun-2024 14:06                3880
gearmanjob.sendfail.php                            18-Jun-2024 14:06                3988
gearmanjob.sendstatus.php                          18-Jun-2024 14:06                4454
gearmanjob.sendwarning.php                         18-Jun-2024 14:06                3918
gearmanjob.setreturn.php                           18-Jun-2024 14:06                2857
gearmanjob.status.php                              18-Jun-2024 14:06                4795
gearmanjob.unique.php                              18-Jun-2024 14:06                3454
gearmanjob.warning.php                             18-Jun-2024 14:06                4246
gearmanjob.workload.php                            18-Jun-2024 14:06                3244
gearmanjob.workloadsize.php                        18-Jun-2024 14:06                2935
gearmantask.construct.php                          18-Jun-2024 14:06                2619
gearmantask.create.php                             18-Jun-2024 14:06                3049                               18-Jun-2024 14:06                3163
gearmantask.datasize.php                           18-Jun-2024 14:06                3141
gearmantask.function.php                           18-Jun-2024 14:06                2950
gearmantask.functionname.php                       18-Jun-2024 14:06                2824
gearmantask.isknown.php                            18-Jun-2024 14:06                2695
gearmantask.isrunning.php                          18-Jun-2024 14:06                2707
gearmantask.jobhandle.php                          18-Jun-2024 14:06                3252
gearmantask.recvdata.php                           18-Jun-2024 14:06                4042
gearmantask.returncode.php                         18-Jun-2024 14:06                2916
gearmantask.senddata.php                           18-Jun-2024 14:06                3746
gearmantask.sendworkload.php                       18-Jun-2024 14:06                3874
gearmantask.taskdenominator.php                    18-Jun-2024 14:06                3382
gearmantask.tasknumerator.php                      18-Jun-2024 14:06                3354
gearmantask.unique.php                             18-Jun-2024 14:06                3772
gearmantask.uuid.php                               18-Jun-2024 14:06                4000
gearmanworker.addfunction.php                      18-Jun-2024 14:06                9030
gearmanworker.addoptions.php                       18-Jun-2024 14:06                3738
gearmanworker.addserver.php                        18-Jun-2024 14:06                5922
gearmanworker.addservers.php                       18-Jun-2024 14:06                5473
gearmanworker.clone.php                            18-Jun-2024 14:06                2492
gearmanworker.construct.php                        18-Jun-2024 14:06                3097
gearmanworker.echo.php                             18-Jun-2024 14:06                3459
gearmanworker.error.php                            18-Jun-2024 14:06                3181
gearmanworker.geterrno.php                         18-Jun-2024 14:06                2926
gearmanworker.options.php                          18-Jun-2024 14:06                2924
gearmanworker.register.php                         18-Jun-2024 14:06                4420
gearmanworker.removeoptions.php                    18-Jun-2024 14:06                3787
gearmanworker.returncode.php                       18-Jun-2024 14:06                3147
gearmanworker.setid.php                            18-Jun-2024 14:06                4574
gearmanworker.setoptions.php                       18-Jun-2024 14:06                3977
gearmanworker.settimeout.php                       18-Jun-2024 14:06                8760
gearmanworker.timeout.php                          18-Jun-2024 14:06                3261
gearmanworker.unregister.php                       18-Jun-2024 14:06                3830
gearmanworker.unregisterall.php                    18-Jun-2024 14:06                3525
gearmanworker.wait.php                             18-Jun-2024 14:06                8732                             18-Jun-2024 14:06                6270
gender-gender.connect.php                          18-Jun-2024 14:06                2949
gender-gender.construct.php                        18-Jun-2024 14:06                2695                          18-Jun-2024 14:06                4224
gender-gender.get.php                              18-Jun-2024 14:06                3027
gender-gender.isnick.php                           18-Jun-2024 14:06                3781
gender-gender.similarnames.php                     18-Jun-2024 14:06                3228
gender.example.admin.php                           18-Jun-2024 14:06                8517
gender.examples.php                                18-Jun-2024 14:06                1477
gender.installation.php                            18-Jun-2024 14:06                2254
gender.setup.php                                   18-Jun-2024 14:06                1475
generator.current.php                              18-Jun-2024 14:06                2301
generator.getreturn.php                            18-Jun-2024 14:06                4235
generator.key.php                                  18-Jun-2024 14:06                4368                                 18-Jun-2024 14:06                2743
generator.rewind.php                               18-Jun-2024 14:06                2417
generator.send.php                                 18-Jun-2024 14:06                6314
generator.throw.php                                18-Jun-2024 14:06                5650
generator.valid.php                                18-Jun-2024 14:06                2473
generator.wakeup.php                               18-Jun-2024 14:06                2518
geoip.configuration.php                            18-Jun-2024 14:06                2873
geoip.constants.php                                18-Jun-2024 14:06                6625
geoip.installation.php                             18-Jun-2024 14:06                1982
geoip.requirements.php                             18-Jun-2024 14:06                2092
geoip.resources.php                                18-Jun-2024 14:06                1371
geoip.setup.php                                    18-Jun-2024 14:06                1707
gettext.configuration.php                          18-Jun-2024 14:06                1439
gettext.constants.php                              18-Jun-2024 14:06                1323
gettext.installation.php                           18-Jun-2024 14:06                1576
gettext.requirements.php                           18-Jun-2024 14:06                1586
gettext.resources.php                              18-Jun-2024 14:06                1385
gettext.setup.php                                  18-Jun-2024 14:06                1750
getting-started.php                                18-Jun-2024 14:06                2142
globiterator.construct.php                         18-Jun-2024 14:06                8493
globiterator.count.php                             18-Jun-2024 14:06                4999
gmagick.addimage.php                               18-Jun-2024 14:06                3202
gmagick.addnoiseimage.php                          18-Jun-2024 14:06                3145
gmagick.annotateimage.php                          18-Jun-2024 14:06                4802
gmagick.blurimage.php                              18-Jun-2024 14:06                3535
gmagick.borderimage.php                            18-Jun-2024 14:06                4030
gmagick.charcoalimage.php                          18-Jun-2024 14:06                3532
gmagick.chopimage.php                              18-Jun-2024 14:06                4287
gmagick.clear.php                                  18-Jun-2024 14:06                2827
gmagick.commentimage.php                           18-Jun-2024 14:06                3059
gmagick.compositeimage.php                         18-Jun-2024 14:06                4433
gmagick.configuration.php                          18-Jun-2024 14:06                1465
gmagick.constants.php                              18-Jun-2024 14:06              105553
gmagick.construct.php                              18-Jun-2024 14:06                2793
gmagick.cropimage.php                              18-Jun-2024 14:06                4267
gmagick.cropthumbnailimage.php                     18-Jun-2024 14:06                3692
gmagick.current.php                                18-Jun-2024 14:06                2852
gmagick.cyclecolormapimage.php                     18-Jun-2024 14:06                3380
gmagick.deconstructimages.php                      18-Jun-2024 14:06                3202
gmagick.despeckleimage.php                         18-Jun-2024 14:06                3817
gmagick.destroy.php                                18-Jun-2024 14:06                3032
gmagick.drawimage.php                              18-Jun-2024 14:06                3234
gmagick.edgeimage.php                              18-Jun-2024 14:06                3206
gmagick.embossimage.php                            18-Jun-2024 14:06                3936
gmagick.enhanceimage.php                           18-Jun-2024 14:06                2866
gmagick.equalizeimage.php                          18-Jun-2024 14:06                2803
gmagick.examples.php                               18-Jun-2024 14:06                3834
gmagick.flipimage.php                              18-Jun-2024 14:06                3278
gmagick.flopimage.php                              18-Jun-2024 14:06                3257
gmagick.frameimage.php                             18-Jun-2024 14:06                5053
gmagick.gammaimage.php                             18-Jun-2024 14:06                3667
gmagick.getcopyright.php                           18-Jun-2024 14:06                2797
gmagick.getfilename.php                            18-Jun-2024 14:06                2840
gmagick.getimagebackgroundcolor.php                18-Jun-2024 14:06                2910
gmagick.getimageblueprimary.php                    18-Jun-2024 14:06                3320
gmagick.getimagebordercolor.php                    18-Jun-2024 14:06                2958
gmagick.getimagechanneldepth.php                   18-Jun-2024 14:06                3063
gmagick.getimagecolors.php                         18-Jun-2024 14:06                2848
gmagick.getimagecolorspace.php                     18-Jun-2024 14:06                2827
gmagick.getimagecompose.php                        18-Jun-2024 14:06                2899
gmagick.getimagedelay.php                          18-Jun-2024 14:06                2773
gmagick.getimagedepth.php                          18-Jun-2024 14:06                2703
gmagick.getimagedispose.php                        18-Jun-2024 14:06                2840
gmagick.getimageextrema.php                        18-Jun-2024 14:06                3025
gmagick.getimagefilename.php                       18-Jun-2024 14:06                2930
gmagick.getimageformat.php                         18-Jun-2024 14:06                2928
gmagick.getimagegamma.php                          18-Jun-2024 14:06                2787
gmagick.getimagegreenprimary.php                   18-Jun-2024 14:06                2980
gmagick.getimageheight.php                         18-Jun-2024 14:06                2777
gmagick.getimagehistogram.php                      18-Jun-2024 14:06                3273
gmagick.getimageindex.php                          18-Jun-2024 14:06                2965
gmagick.getimageinterlacescheme.php                18-Jun-2024 14:06                2960
gmagick.getimageiterations.php                     18-Jun-2024 14:06                2837
gmagick.getimagematte.php                          18-Jun-2024 14:06                3304
gmagick.getimagemattecolor.php                     18-Jun-2024 14:06                2999
gmagick.getimageprofile.php                        18-Jun-2024 14:06                3008
gmagick.getimageredprimary.php                     18-Jun-2024 14:06                2984
gmagick.getimagerenderingintent.php                18-Jun-2024 14:06                2940
gmagick.getimageresolution.php                     18-Jun-2024 14:06                2879
gmagick.getimagescene.php                          18-Jun-2024 14:06                2728
gmagick.getimagesignature.php                      18-Jun-2024 14:06                2855
gmagick.getimagetype.php                           18-Jun-2024 14:06                2784
gmagick.getimageunits.php                          18-Jun-2024 14:06                2510
gmagick.getimagewhitepoint.php                     18-Jun-2024 14:06                3031
gmagick.getimagewidth.php                          18-Jun-2024 14:06                2755
gmagick.getpackagename.php                         18-Jun-2024 14:06                2766
gmagick.getquantumdepth.php                        18-Jun-2024 14:06                3101
gmagick.getreleasedate.php                         18-Jun-2024 14:06                2831
gmagick.getsamplingfactors.php                     18-Jun-2024 14:06                3033
gmagick.getsize.php                                18-Jun-2024 14:06                3075
gmagick.getversion.php                             18-Jun-2024 14:06                2745
gmagick.hasnextimage.php                           18-Jun-2024 14:06                3142
gmagick.haspreviousimage.php                       18-Jun-2024 14:06                3213
gmagick.implodeimage.php                           18-Jun-2024 14:06                3212
gmagick.installation.php                           18-Jun-2024 14:06                2192
gmagick.labelimage.php                             18-Jun-2024 14:06                2958
gmagick.levelimage.php                             18-Jun-2024 14:06                5640
gmagick.magnifyimage.php                           18-Jun-2024 14:06                2873
gmagick.mapimage.php                               18-Jun-2024 14:06                3629
gmagick.medianfilterimage.php                      18-Jun-2024 14:06                3388
gmagick.minifyimage.php                            18-Jun-2024 14:06                2958
gmagick.modulateimage.php                          18-Jun-2024 14:06                4441
gmagick.motionblurimage.php                        18-Jun-2024 14:06                4508
gmagick.newimage.php                               18-Jun-2024 14:06                4349
gmagick.nextimage.php                              18-Jun-2024 14:06                3113
gmagick.normalizeimage.php                         18-Jun-2024 14:06                3364
gmagick.oilpaintimage.php                          18-Jun-2024 14:06                3482
gmagick.previousimage.php                          18-Jun-2024 14:06                3187
gmagick.profileimage.php                           18-Jun-2024 14:06                4147
gmagick.quantizeimage.php                          18-Jun-2024 14:06                6860
gmagick.quantizeimages.php                         18-Jun-2024 14:06                6914
gmagick.queryfontmetrics.php                       18-Jun-2024 14:06                3257
gmagick.queryfonts.php                             18-Jun-2024 14:06                3110
gmagick.queryformats.php                           18-Jun-2024 14:06                3383
gmagick.radialblurimage.php                        18-Jun-2024 14:06                3554
gmagick.raiseimage.php                             18-Jun-2024 14:06                4951                                   18-Jun-2024 14:06                2970
gmagick.readimage.php                              18-Jun-2024 14:06                3021
gmagick.readimageblob.php                          18-Jun-2024 14:06                3515
gmagick.readimagefile.php                          18-Jun-2024 14:06                3498
gmagick.reducenoiseimage.php                       18-Jun-2024 14:06                3636
gmagick.removeimage.php                            18-Jun-2024 14:06                2814
gmagick.removeimageprofile.php                     18-Jun-2024 14:06                3179
gmagick.requirements.php                           18-Jun-2024 14:06                1905
gmagick.resampleimage.php                          18-Jun-2024 14:06                4513
gmagick.resizeimage.php                            18-Jun-2024 14:06                4853
gmagick.rollimage.php                              18-Jun-2024 14:06                3344
gmagick.rotateimage.php                            18-Jun-2024 14:06                3620
gmagick.scaleimage.php                             18-Jun-2024 14:06                4004
gmagick.separateimagechannel.php                   18-Jun-2024 14:06                3546
gmagick.setcompressionquality.php                  18-Jun-2024 14:06                4523
gmagick.setfilename.php                            18-Jun-2024 14:06                3224
gmagick.setimagebackgroundcolor.php                18-Jun-2024 14:06                3268
gmagick.setimageblueprimary.php                    18-Jun-2024 14:06                3683
gmagick.setimagebordercolor.php                    18-Jun-2024 14:06                3216
gmagick.setimagechanneldepth.php                   18-Jun-2024 14:06                3776
gmagick.setimagecolorspace.php                     18-Jun-2024 14:06                3430
gmagick.setimagecompose.php                        18-Jun-2024 14:06                3147
gmagick.setimagedelay.php                          18-Jun-2024 14:06                3152
gmagick.setimagedepth.php                          18-Jun-2024 14:06                3153
gmagick.setimagedispose.php                        18-Jun-2024 14:06                3193
gmagick.setimagefilename.php                       18-Jun-2024 14:06                3302
gmagick.setimageformat.php                         18-Jun-2024 14:06                3239
gmagick.setimagegamma.php                          18-Jun-2024 14:06                3124
gmagick.setimagegreenprimary.php                   18-Jun-2024 14:06                3663
gmagick.setimageindex.php                          18-Jun-2024 14:06                3306
gmagick.setimageinterlacescheme.php                18-Jun-2024 14:06                3521
gmagick.setimageiterations.php                     18-Jun-2024 14:06                3237
gmagick.setimageprofile.php                        18-Jun-2024 14:06                3769
gmagick.setimageredprimary.php                     18-Jun-2024 14:06                3581
gmagick.setimagerenderingintent.php                18-Jun-2024 14:06                3487
gmagick.setimageresolution.php                     18-Jun-2024 14:06                3493
gmagick.setimagescene.php                          18-Jun-2024 14:06                3125
gmagick.setimagetype.php                           18-Jun-2024 14:06                3254
gmagick.setimageunits.php                          18-Jun-2024 14:06                3330
gmagick.setimagewhitepoint.php                     18-Jun-2024 14:06                3597
gmagick.setsamplingfactors.php                     18-Jun-2024 14:06                3439
gmagick.setsize.php                                18-Jun-2024 14:06                3877
gmagick.setup.php                                  18-Jun-2024 14:06                1664
gmagick.shearimage.php                             18-Jun-2024 14:06                4556
gmagick.solarizeimage.php                          18-Jun-2024 14:06                3524
gmagick.spreadimage.php                            18-Jun-2024 14:06                3316
gmagick.stripimage.php                             18-Jun-2024 14:06                2850
gmagick.swirlimage.php                             18-Jun-2024 14:06                3462
gmagick.thumbnailimage.php                         18-Jun-2024 14:06                4485
gmagick.trimimage.php                              18-Jun-2024 14:06                3578
gmagick.write.php                                  18-Jun-2024 14:06                1768
gmagick.writeimage.php                             18-Jun-2024 14:06                3776
gmagickdraw.annotate.php                           18-Jun-2024 14:06                3430
gmagickdraw.arc.php                                18-Jun-2024 14:06                4800
gmagickdraw.bezier.php                             18-Jun-2024 14:06                2773
gmagickdraw.ellipse.php                            18-Jun-2024 14:06                4497
gmagickdraw.getfillcolor.php                       18-Jun-2024 14:06                2717
gmagickdraw.getfillopacity.php                     18-Jun-2024 14:06                2836
gmagickdraw.getfont.php                            18-Jun-2024 14:06                2773
gmagickdraw.getfontsize.php                        18-Jun-2024 14:06                2668
gmagickdraw.getfontstyle.php                       18-Jun-2024 14:06                2779
gmagickdraw.getfontweight.php                      18-Jun-2024 14:06                2756
gmagickdraw.getstrokecolor.php                     18-Jun-2024 14:06                2752
gmagickdraw.getstrokeopacity.php                   18-Jun-2024 14:06                2772
gmagickdraw.getstrokewidth.php                     18-Jun-2024 14:06                2829
gmagickdraw.gettextdecoration.php                  18-Jun-2024 14:06                2663
gmagickdraw.gettextencoding.php                    18-Jun-2024 14:06                2859
gmagickdraw.line.php                               18-Jun-2024 14:06                3880
gmagickdraw.point.php                              18-Jun-2024 14:06                3068
gmagickdraw.polygon.php                            18-Jun-2024 14:06                2955
gmagickdraw.polyline.php                           18-Jun-2024 14:06                2970
gmagickdraw.rectangle.php                          18-Jun-2024 14:06                3963
gmagickdraw.rotate.php                             18-Jun-2024 14:06                2898
gmagickdraw.roundrectangle.php                     18-Jun-2024 14:06                4871
gmagickdraw.scale.php                              18-Jun-2024 14:06                3383
gmagickdraw.setfillcolor.php                       18-Jun-2024 14:06                3368
gmagickdraw.setfillopacity.php                     18-Jun-2024 14:06                3107
gmagickdraw.setfont.php                            18-Jun-2024 14:06                2924
gmagickdraw.setfontsize.php                        18-Jun-2024 14:06                2945
gmagickdraw.setfontstyle.php                       18-Jun-2024 14:06                3097
gmagickdraw.setfontweight.php                      18-Jun-2024 14:06                2946
gmagickdraw.setstrokecolor.php                     18-Jun-2024 14:06                3266
gmagickdraw.setstrokeopacity.php                   18-Jun-2024 14:06                3028
gmagickdraw.setstrokewidth.php                     18-Jun-2024 14:06                3023
gmagickdraw.settextdecoration.php                  18-Jun-2024 14:06                3084
gmagickdraw.settextencoding.php                    18-Jun-2024 14:06                3614
gmagickpixel.construct.php                         18-Jun-2024 14:06                2740
gmagickpixel.getcolor.php                          18-Jun-2024 14:06                4817
gmagickpixel.getcolorcount.php                     18-Jun-2024 14:06                2951
gmagickpixel.getcolorvalue.php                     18-Jun-2024 14:06                3360
gmagickpixel.setcolor.php                          18-Jun-2024 14:06                3185
gmagickpixel.setcolorvalue.php                     18-Jun-2024 14:06                3846
gmp.configuration.php                              18-Jun-2024 14:06                1437
gmp.constants.php                                  18-Jun-2024 14:06                4776
gmp.construct.php                                  18-Jun-2024 14:06                4510
gmp.examples.php                                   18-Jun-2024 14:06                3267
gmp.installation.php                               18-Jun-2024 14:06                1523
gmp.requirements.php                               18-Jun-2024 14:06                1945
gmp.serialize.php                                  18-Jun-2024 14:06                2527
gmp.setup.php                                      18-Jun-2024 14:06                1626
gmp.unserialize.php                                18-Jun-2024 14:06                2838
gnupg.configuration.php                            18-Jun-2024 14:06                1423
gnupg.constants.php                                18-Jun-2024 14:06                9505
gnupg.examples-clearsign.php                       18-Jun-2024 14:06                7100
gnupg.examples.php                                 18-Jun-2024 14:06                1545
gnupg.installation.php                             18-Jun-2024 14:06                1802
gnupg.requirements.php                             18-Jun-2024 14:06                1395
gnupg.resources.php                                18-Jun-2024 14:06                1371
gnupg.setup.php                                    18-Jun-2024 14:06                1724
hash.configuration.php                             18-Jun-2024 14:06                1418
hash.constants.php                                 18-Jun-2024 14:06                1986
hash.installation.php                              18-Jun-2024 14:06                1904
hash.requirements.php                              18-Jun-2024 14:06                1399
hash.resources.php                                 18-Jun-2024 14:06                1494
hash.setup.php                                     18-Jun-2024 14:06                1706
hashcontext.construct.php                          18-Jun-2024 14:06                2070
hashcontext.serialize.php                          18-Jun-2024 14:06                2656
hashcontext.unserialize.php                        18-Jun-2024 14:06                2969
history.php                                        18-Jun-2024 14:06                2507
history.php.books.php                              18-Jun-2024 14:06                3617
history.php.php                                    18-Jun-2024 14:06               16402
history.php.publications.php                       18-Jun-2024 14:06                2250
history.php.related.php                            18-Jun-2024 14:06                8809
hrtime-performancecounter.getfrequency.php         18-Jun-2024 14:06                3054
hrtime-performancecounter.getticks.php             18-Jun-2024 14:06                2837
hrtime-performancecounter.gettickssince.php        18-Jun-2024 14:06                3172
hrtime-stopwatch.getelapsedticks.php               18-Jun-2024 14:06                2832
hrtime-stopwatch.getelapsedtime.php                18-Jun-2024 14:06                3199
hrtime-stopwatch.getlastelapsedticks.php           18-Jun-2024 14:06                2815
hrtime-stopwatch.getlastelapsedtime.php            18-Jun-2024 14:06                3232
hrtime-stopwatch.isrunning.php                     18-Jun-2024 14:06                2814
hrtime-stopwatch.start.php                         18-Jun-2024 14:06                2672
hrtime-stopwatch.stop.php                          18-Jun-2024 14:06                2454
hrtime.example.basic.php                           18-Jun-2024 14:06                5768
hrtime.examples.php                                18-Jun-2024 14:06                1477
hrtime.installation.php                            18-Jun-2024 14:06                2254
hrtime.setup.php                                   18-Jun-2024 14:06                1472
ibase.configuration.php                            18-Jun-2024 14:06                8965
ibase.constants.php                                18-Jun-2024 14:06               23210
ibase.installation.php                             18-Jun-2024 14:06                4176
ibase.requirements.php                             18-Jun-2024 14:06                1310
ibase.resources.php                                18-Jun-2024 14:06                1371
ibase.setup.php                                    18-Jun-2024 14:06                1744
ibm-db2.configuration.php                          18-Jun-2024 14:06               27651
ibm-db2.constants.php                              18-Jun-2024 14:06               10910
ibm-db2.installation.php                           18-Jun-2024 14:06                4784
ibm-db2.requirements.php                           18-Jun-2024 14:06                3933
ibm-db2.resources.php                              18-Jun-2024 14:06                1501
ibm-db2.setup.php                                  18-Jun-2024 14:06                1755
iconv.configuration.php                            18-Jun-2024 14:06                5606
iconv.constants.php                                18-Jun-2024 14:06                4044
iconv.installation.php                             18-Jun-2024 14:06                1881
iconv.requirements.php                             18-Jun-2024 14:06                1682
iconv.resources.php                                18-Jun-2024 14:06                1371
iconv.setup.php                                    18-Jun-2024 14:06                1730
igbinary.configuration.php                         18-Jun-2024 14:06                4018
igbinary.installation.php                          18-Jun-2024 14:06                2270
igbinary.requirements.php                          18-Jun-2024 14:06                1331
igbinary.setup.php                                 18-Jun-2024 14:06                1671
image.configuration.php                            18-Jun-2024 14:06                3972
image.constants.php                                18-Jun-2024 14:06               64243
image.examples-png.php                             18-Jun-2024 14:06                5260
image.examples-watermark.php                       18-Jun-2024 14:06                6757
image.examples.merged-watermark.php                18-Jun-2024 14:06                9620
image.examples.php                                 18-Jun-2024 14:06                1848
image.installation.php                             18-Jun-2024 14:06                7581
image.requirements.php                             18-Jun-2024 14:06                5330
image.resources.php                                18-Jun-2024 14:06                2301
image.setup.php                                    18-Jun-2024 14:06                1727
imagick.adaptiveblurimage.php                      18-Jun-2024 14:06                8099
imagick.adaptiveresizeimage.php                    18-Jun-2024 14:06               10797
imagick.adaptivesharpenimage.php                   18-Jun-2024 14:06                7285
imagick.adaptivethresholdimage.php                 18-Jun-2024 14:06                6802
imagick.addimage.php                               18-Jun-2024 14:06                3339
imagick.addnoiseimage.php                          18-Jun-2024 14:06                6093
imagick.affinetransformimage.php                   18-Jun-2024 14:06                6953
imagick.animateimages.php                          18-Jun-2024 14:06                3538
imagick.annotateimage.php                          18-Jun-2024 14:06                9752
imagick.appendimages.php                           18-Jun-2024 14:06                7405
imagick.autolevelimage.php                         18-Jun-2024 14:06                4901
imagick.averageimages.php                          18-Jun-2024 14:06                3082
imagick.blackthresholdimage.php                    18-Jun-2024 14:06                5869
imagick.blueshiftimage.php                         18-Jun-2024 14:06                4785
imagick.blurimage.php                              18-Jun-2024 14:06                6485
imagick.borderimage.php                            18-Jun-2024 14:06                6428
imagick.brightnesscontrastimage.php                18-Jun-2024 14:06                6046
imagick.charcoalimage.php                          18-Jun-2024 14:06                5261
imagick.chopimage.php                              18-Jun-2024 14:06                7643
imagick.clampimage.php                             18-Jun-2024 14:06                2988
imagick.clear.php                                  18-Jun-2024 14:06                2507
imagick.clipimage.php                              18-Jun-2024 14:06                2854
imagick.clipimagepath.php                          18-Jun-2024 14:06                3599
imagick.clippathimage.php                          18-Jun-2024 14:06                4309
imagick.clone.php                                  18-Jun-2024 14:06                4518
imagick.clutimage.php                              18-Jun-2024 14:06                6735
imagick.coalesceimages.php                         18-Jun-2024 14:06                3476
imagick.colorfloodfillimage.php                    18-Jun-2024 14:06                6365
imagick.colorizeimage.php                          18-Jun-2024 14:06                7512
imagick.colormatriximage.php                       18-Jun-2024 14:06                8387
imagick.combineimages.php                          18-Jun-2024 14:06                4095
imagick.commentimage.php                           18-Jun-2024 14:06                5550
imagick.compareimagechannels.php                   18-Jun-2024 14:06                4527
imagick.compareimagelayers.php                     18-Jun-2024 14:06                6336
imagick.compareimages.php                          18-Jun-2024 14:06                6244
imagick.compositeimage.php                         18-Jun-2024 14:06                9031
imagick.configuration.php                          18-Jun-2024 14:06                5232
imagick.constants.php                              18-Jun-2024 14:06              166423
imagick.construct.php                              18-Jun-2024 14:06                2908
imagick.contrastimage.php                          18-Jun-2024 14:06                5563
imagick.contraststretchimage.php                   18-Jun-2024 14:06                4513
imagick.convolveimage.php                          18-Jun-2024 14:06                6522
imagick.count.php                                  18-Jun-2024 14:06                3095
imagick.cropimage.php                              18-Jun-2024 14:06                6560
imagick.cropthumbnailimage.php                     18-Jun-2024 14:06                3903
imagick.current.php                                18-Jun-2024 14:06                2835
imagick.cyclecolormapimage.php                     18-Jun-2024 14:06                3448
imagick.decipherimage.php                          18-Jun-2024 14:06                3644
imagick.deconstructimages.php                      18-Jun-2024 14:06                3103
imagick.deleteimageartifact.php                    18-Jun-2024 14:06                4269
imagick.deleteimageproperty.php                    18-Jun-2024 14:06                2865
imagick.deskewimage.php                            18-Jun-2024 14:06               11560
imagick.despeckleimage.php                         18-Jun-2024 14:06                4623
imagick.destroy.php                                18-Jun-2024 14:06                2654
imagick.displayimage.php                           18-Jun-2024 14:06                3077
imagick.displayimages.php                          18-Jun-2024 14:06                3206
imagick.distortimage.php                           18-Jun-2024 14:06               13473
imagick.drawimage.php                              18-Jun-2024 14:06                2934
imagick.edgeimage.php                              18-Jun-2024 14:06                5074
imagick.embossimage.php                            18-Jun-2024 14:06                5973
imagick.encipherimage.php                          18-Jun-2024 14:06                3627
imagick.enhanceimage.php                           18-Jun-2024 14:06                4618
imagick.equalizeimage.php                          18-Jun-2024 14:06                4559
imagick.evaluateimage.php                          18-Jun-2024 14:06                6877
imagick.examples-1.php                             18-Jun-2024 14:06               33312
imagick.examples.php                               18-Jun-2024 14:06                1519
imagick.exportimagepixels.php                      18-Jun-2024 14:06                8790
imagick.extentimage.php                            18-Jun-2024 14:06                6276
imagick.filter.php                                 18-Jun-2024 14:06                8198
imagick.flattenimages.php                          18-Jun-2024 14:06                3274
imagick.flipimage.php                              18-Jun-2024 14:06                5001
imagick.floodfillpaintimage.php                    18-Jun-2024 14:06               12942
imagick.flopimage.php                              18-Jun-2024 14:06                5035
imagick.forwardfouriertransformimage.php           18-Jun-2024 14:06               12697
imagick.frameimage.php                             18-Jun-2024 14:06                9054
imagick.functionimage.php                          18-Jun-2024 14:06               14598
imagick.fximage.php                                18-Jun-2024 14:06                6792
imagick.gammaimage.php                             18-Jun-2024 14:06                6559
imagick.gaussianblurimage.php                      18-Jun-2024 14:06                7042
imagick.getcolorspace.php                          18-Jun-2024 14:06                2750
imagick.getcompression.php                         18-Jun-2024 14:06                2453
imagick.getcompressionquality.php                  18-Jun-2024 14:06                2554
imagick.getcopyright.php                           18-Jun-2024 14:06                2564
imagick.getfilename.php                            18-Jun-2024 14:06                2773
imagick.getfont.php                                18-Jun-2024 14:06                3519
imagick.getformat.php                              18-Jun-2024 14:06                2644
imagick.getgravity.php                             18-Jun-2024 14:06                2754
imagick.gethomeurl.php                             18-Jun-2024 14:06                2488
imagick.getimage.php                               18-Jun-2024 14:06                2797
imagick.getimagealphachannel.php                   18-Jun-2024 14:06                3983
imagick.getimageartifact.php                       18-Jun-2024 14:06                4023
imagick.getimageattribute.php                      18-Jun-2024 14:06                3051
imagick.getimagebackgroundcolor.php                18-Jun-2024 14:06                2893
imagick.getimageblob.php                           18-Jun-2024 14:06                3206
imagick.getimageblueprimary.php                    18-Jun-2024 14:06                3253
imagick.getimagebordercolor.php                    18-Jun-2024 14:06                2932
imagick.getimagechanneldepth.php                   18-Jun-2024 14:06                3685
imagick.getimagechanneldistortion.php              18-Jun-2024 14:06                4718
imagick.getimagechanneldistortions.php             18-Jun-2024 14:06                5249
imagick.getimagechannelextrema.php                 18-Jun-2024 14:06                4328
imagick.getimagechannelkurtosis.php                18-Jun-2024 14:06                4164
imagick.getimagechannelmean.php                    18-Jun-2024 14:06                3788
imagick.getimagechannelrange.php                   18-Jun-2024 14:06                4062
imagick.getimagechannelstatistics.php              18-Jun-2024 14:06                2952
imagick.getimageclipmask.php                       18-Jun-2024 14:06                3473
imagick.getimagecolormapcolor.php                  18-Jun-2024 14:06                3266
imagick.getimagecolors.php                         18-Jun-2024 14:06                2776
imagick.getimagecolorspace.php                     18-Jun-2024 14:06                2779
imagick.getimagecompose.php                        18-Jun-2024 14:06                2682
imagick.getimagecompression.php                    18-Jun-2024 14:06                2583
imagick.getimagecompressionquality.php             18-Jun-2024 14:06                2689
imagick.getimagedelay.php                          18-Jun-2024 14:06                2735
imagick.getimagedepth.php                          18-Jun-2024 14:06                2418
imagick.getimagedispose.php                        18-Jun-2024 14:06                2830
imagick.getimagedistortion.php                     18-Jun-2024 14:06                3722
imagick.getimageextrema.php                        18-Jun-2024 14:06                3270
imagick.getimagefilename.php                       18-Jun-2024 14:06                2904
imagick.getimageformat.php                         18-Jun-2024 14:06                2936
imagick.getimagegamma.php                          18-Jun-2024 14:06                2757
imagick.getimagegeometry.php                       18-Jun-2024 14:06                4576
imagick.getimagegravity.php                        18-Jun-2024 14:06                3147
imagick.getimagegreenprimary.php                   18-Jun-2024 14:06                3133
imagick.getimageheight.php                         18-Jun-2024 14:06                2750
imagick.getimagehistogram.php                      18-Jun-2024 14:06               17797
imagick.getimageindex.php                          18-Jun-2024 14:06                3428
imagick.getimageinterlacescheme.php                18-Jun-2024 14:06                2830
imagick.getimageinterpolatemethod.php              18-Jun-2024 14:06                3088
imagick.getimageiterations.php                     18-Jun-2024 14:06                2830
imagick.getimagelength.php                         18-Jun-2024 14:06                3732
imagick.getimagematte.php                          18-Jun-2024 14:06                3272
imagick.getimagemattecolor.php                     18-Jun-2024 14:06                3185
imagick.getimagemimetype.php                       18-Jun-2024 14:06                2438
imagick.getimageorientation.php                    18-Jun-2024 14:06                3002
imagick.getimagepage.php                           18-Jun-2024 14:06                3030
imagick.getimagepixelcolor.php                     18-Jun-2024 14:06                3429
imagick.getimageprofile.php                        18-Jun-2024 14:06                3125
imagick.getimageprofiles.php                       18-Jun-2024 14:06                4089
imagick.getimageproperties.php                     18-Jun-2024 14:06                6331
imagick.getimageproperty.php                       18-Jun-2024 14:06                5438
imagick.getimageredprimary.php                     18-Jun-2024 14:06                3148
imagick.getimageregion.php                         18-Jun-2024 14:06                4380
imagick.getimagerenderingintent.php                18-Jun-2024 14:06                2984
imagick.getimageresolution.php                     18-Jun-2024 14:06                2825
imagick.getimagesblob.php                          18-Jun-2024 14:06                3147
imagick.getimagescene.php                          18-Jun-2024 14:06                2699
imagick.getimagesignature.php                      18-Jun-2024 14:06                2787
imagick.getimagesize.php                           18-Jun-2024 14:06                3036
imagick.getimagetickspersecond.php                 18-Jun-2024 14:06                2948
imagick.getimagetotalinkdensity.php                18-Jun-2024 14:06                2783
imagick.getimagetype.php                           18-Jun-2024 14:06                5171
imagick.getimageunits.php                          18-Jun-2024 14:06                2851
imagick.getimagevirtualpixelmethod.php             18-Jun-2024 14:06                3002
imagick.getimagewhitepoint.php                     18-Jun-2024 14:06                3011
imagick.getimagewidth.php                          18-Jun-2024 14:06                2737
imagick.getinterlacescheme.php                     18-Jun-2024 14:06                2856
imagick.getiteratorindex.php                       18-Jun-2024 14:06                6720
imagick.getnumberimages.php                        18-Jun-2024 14:06                2859
imagick.getoption.php                              18-Jun-2024 14:06                3087
imagick.getpackagename.php                         18-Jun-2024 14:06                2747
imagick.getpage.php                                18-Jun-2024 14:06                2865
imagick.getpixeliterator.php                       18-Jun-2024 14:06                6482
imagick.getpixelregioniterator.php                 18-Jun-2024 14:06                7192
imagick.getpointsize.php                           18-Jun-2024 14:06                3102
imagick.getquantum.php                             18-Jun-2024 14:06                2489
imagick.getquantumdepth.php                        18-Jun-2024 14:06                2840
imagick.getquantumrange.php                        18-Jun-2024 14:06                3233
imagick.getregistry.php                            18-Jun-2024 14:06                2719
imagick.getreleasedate.php                         18-Jun-2024 14:06                2790
imagick.getresource.php                            18-Jun-2024 14:06                3316
imagick.getresourcelimit.php                       18-Jun-2024 14:06                3720
imagick.getsamplingfactors.php                     18-Jun-2024 14:06                2972
imagick.getsize.php                                18-Jun-2024 14:06                6480
imagick.getsizeoffset.php                          18-Jun-2024 14:06                2910
imagick.getversion.php                             18-Jun-2024 14:06                2749
imagick.haldclutimage.php                          18-Jun-2024 14:06                6775
imagick.hasnextimage.php                           18-Jun-2024 14:06                2995
imagick.haspreviousimage.php                       18-Jun-2024 14:06                3094
imagick.identifyformat.php                         18-Jun-2024 14:06                5210
imagick.identifyimage.php                          18-Jun-2024 14:06                4647
imagick.implodeimage.php                           18-Jun-2024 14:06                5037
imagick.importimagepixels.php                      18-Jun-2024 14:06               12676
imagick.installation.php                           18-Jun-2024 14:06                3686
imagick.inversefouriertransformimage.php           18-Jun-2024 14:06                4184
imagick.labelimage.php                             18-Jun-2024 14:06                2819
imagick.levelimage.php                             18-Jun-2024 14:06                8817
imagick.linearstretchimage.php                     18-Jun-2024 14:06                6003
imagick.liquidrescaleimage.php                     18-Jun-2024 14:06                5092
imagick.listregistry.php                           18-Jun-2024 14:06                2601
imagick.magnifyimage.php                           18-Jun-2024 14:06                4632
imagick.mapimage.php                               18-Jun-2024 14:06                3585
imagick.mattefloodfillimage.php                    18-Jun-2024 14:06                6617
imagick.medianfilterimage.php                      18-Jun-2024 14:06                5636
imagick.mergeimagelayers.php                       18-Jun-2024 14:06                7084
imagick.minifyimage.php                            18-Jun-2024 14:06                2705
imagick.modulateimage.php                          18-Jun-2024 14:06                6086
imagick.montageimage.php                           18-Jun-2024 14:06                5287
imagick.morphimages.php                            18-Jun-2024 14:06                3218
imagick.morphology.php                             18-Jun-2024 14:06               68398
imagick.mosaicimages.php                           18-Jun-2024 14:06                3257
imagick.motionblurimage.php                        18-Jun-2024 14:06                7690
imagick.negateimage.php                            18-Jun-2024 14:06                6313
imagick.newimage.php                               18-Jun-2024 14:06                6985
imagick.newpseudoimage.php                         18-Jun-2024 14:06                6291
imagick.nextimage.php                              18-Jun-2024 14:06                2590
imagick.normalizeimage.php                         18-Jun-2024 14:06                6971
imagick.oilpaintimage.php                          18-Jun-2024 14:06                4991
imagick.opaquepaintimage.php                       18-Jun-2024 14:06                5800
imagick.optimizeimagelayers.php                    18-Jun-2024 14:06                6317
imagick.orderedposterizeimage.php                  18-Jun-2024 14:06                7660
imagick.paintfloodfillimage.php                    18-Jun-2024 14:06                6623
imagick.paintopaqueimage.php                       18-Jun-2024 14:06                6368
imagick.painttransparentimage.php                  18-Jun-2024 14:06                5395
imagick.pingimage.php                              18-Jun-2024 14:06                3064
imagick.pingimageblob.php                          18-Jun-2024 14:06                6760
imagick.pingimagefile.php                          18-Jun-2024 14:06                6660
imagick.polaroidimage.php                          18-Jun-2024 14:06                5095
imagick.posterizeimage.php                         18-Jun-2024 14:06                5972
imagick.previewimages.php                          18-Jun-2024 14:06                3708
imagick.previousimage.php                          18-Jun-2024 14:06                2646
imagick.profileimage.php                           18-Jun-2024 14:06                3576
imagick.quantizeimage.php                          18-Jun-2024 14:06                7000
imagick.quantizeimages.php                         18-Jun-2024 14:06                4301
imagick.queryfontmetrics.php                       18-Jun-2024 14:06                6267
imagick.queryfonts.php                             18-Jun-2024 14:06                5065
imagick.queryformats.php                           18-Jun-2024 14:06                7435
imagick.radialblurimage.php                        18-Jun-2024 14:06                5912
imagick.raiseimage.php                             18-Jun-2024 14:06                6874
imagick.randomthresholdimage.php                   18-Jun-2024 14:06                7185
imagick.readimage.php                              18-Jun-2024 14:06                2755
imagick.readimageblob.php                          18-Jun-2024 14:06                5797
imagick.readimagefile.php                          18-Jun-2024 14:06                3544
imagick.readimages.php                             18-Jun-2024 14:06                2857
imagick.recolorimage.php                           18-Jun-2024 14:06                6967
imagick.reducenoiseimage.php                       18-Jun-2024 14:06                5750
imagick.remapimage.php                             18-Jun-2024 14:06                3915
imagick.removeimage.php                            18-Jun-2024 14:06                2840
imagick.removeimageprofile.php                     18-Jun-2024 14:06                3117
imagick.render.php                                 18-Jun-2024 14:06                2538
imagick.requirements.php                           18-Jun-2024 14:06                1836
imagick.resampleimage.php                          18-Jun-2024 14:06                5954
imagick.resetimagepage.php                         18-Jun-2024 14:06                3118
imagick.resizeimage.php                            18-Jun-2024 14:06               12541
imagick.resources.php                              18-Jun-2024 14:06                1385
imagick.rollimage.php                              18-Jun-2024 14:06                5122
imagick.rotateimage.php                            18-Jun-2024 14:06                6317
imagick.rotationalblurimage.php                    18-Jun-2024 14:06                6269
imagick.roundcorners.php                           18-Jun-2024 14:06                7388
imagick.sampleimage.php                            18-Jun-2024 14:06                3363
imagick.scaleimage.php                             18-Jun-2024 14:06                7936
imagick.segmentimage.php                           18-Jun-2024 14:06                7239
imagick.selectiveblurimage.php                     18-Jun-2024 14:06                7291
imagick.separateimagechannel.php                   18-Jun-2024 14:06                5965
imagick.sepiatoneimage.php                         18-Jun-2024 14:06                5400
imagick.setbackgroundcolor.php                     18-Jun-2024 14:06                3670
imagick.setcolorspace.php                          18-Jun-2024 14:06                3418
imagick.setcompression.php                         18-Jun-2024 14:06                3013
imagick.setcompressionquality.php                  18-Jun-2024 14:06                7456
imagick.setfilename.php                            18-Jun-2024 14:06                2911
imagick.setfirstiterator.php                       18-Jun-2024 14:06                2640
imagick.setfont.php                                18-Jun-2024 14:06                6345
imagick.setformat.php                              18-Jun-2024 14:06                2741
imagick.setgravity.php                             18-Jun-2024 14:06                3060
imagick.setimage.php                               18-Jun-2024 14:06                5164
imagick.setimagealphachannel.php                   18-Jun-2024 14:06                4150
imagick.setimageartifact.php                       18-Jun-2024 14:06                7965
imagick.setimageattribute.php                      18-Jun-2024 14:06                3446
imagick.setimagebackgroundcolor.php                18-Jun-2024 14:06                3975
imagick.setimagebias.php                           18-Jun-2024 14:06                7337
imagick.setimagebiasquantum.php                    18-Jun-2024 14:06                3210
imagick.setimageblueprimary.php                    18-Jun-2024 14:06                3516
imagick.setimagebordercolor.php                    18-Jun-2024 14:06                3938
imagick.setimagechanneldepth.php                   18-Jun-2024 14:06                3519
imagick.setimageclipmask.php                       18-Jun-2024 14:06                9196
imagick.setimagecolormapcolor.php                  18-Jun-2024 14:06                3528
imagick.setimagecolorspace.php                     18-Jun-2024 14:06                3744
imagick.setimagecompose.php                        18-Jun-2024 14:06                3340
imagick.setimagecompression.php                    18-Jun-2024 14:06                3180
imagick.setimagecompressionquality.php             18-Jun-2024 14:06                5288
imagick.setimagedelay.php                          18-Jun-2024 14:06                7080
imagick.setimagedepth.php                          18-Jun-2024 14:06                3068
imagick.setimagedispose.php                        18-Jun-2024 14:06                3118
imagick.setimageextent.php                         18-Jun-2024 14:06                3409
imagick.setimagefilename.php                       18-Jun-2024 14:06                3204
imagick.setimageformat.php                         18-Jun-2024 14:06                3094
imagick.setimagegamma.php                          18-Jun-2024 14:06                3064
imagick.setimagegravity.php                        18-Jun-2024 14:06                3354
imagick.setimagegreenprimary.php                   18-Jun-2024 14:06                3511
imagick.setimageindex.php                          18-Jun-2024 14:06                3817
imagick.setimageinterlacescheme.php                18-Jun-2024 14:06                3216
imagick.setimageinterpolatemethod.php              18-Jun-2024 14:06                3158
imagick.setimageiterations.php                     18-Jun-2024 14:06                5518
imagick.setimagematte.php                          18-Jun-2024 14:06                3094
imagick.setimagemattecolor.php                     18-Jun-2024 14:06                4256
imagick.setimageopacity.php                        18-Jun-2024 14:06                5842
imagick.setimageorientation.php                    18-Jun-2024 14:06                5030
imagick.setimagepage.php                           18-Jun-2024 14:06                4038
imagick.setimageprofile.php                        18-Jun-2024 14:06                3714
imagick.setimageproperty.php                       18-Jun-2024 14:06                5620
imagick.setimageredprimary.php                     18-Jun-2024 14:06                3507
imagick.setimagerenderingintent.php                18-Jun-2024 14:06                3262
imagick.setimageresolution.php                     18-Jun-2024 14:06                5360
imagick.setimagescene.php                          18-Jun-2024 14:06                3084
imagick.setimagetickspersecond.php                 18-Jun-2024 14:06                8997
imagick.setimagetype.php                           18-Jun-2024 14:06                2798
imagick.setimageunits.php                          18-Jun-2024 14:06                2900
imagick.setimagevirtualpixelmethod.php             18-Jun-2024 14:06                2964
imagick.setimagewhitepoint.php                     18-Jun-2024 14:06                3471
imagick.setinterlacescheme.php                     18-Jun-2024 14:06                2880
imagick.setiteratorindex.php                       18-Jun-2024 14:06                6854
imagick.setlastiterator.php                        18-Jun-2024 14:06                2660
imagick.setoption.php                              18-Jun-2024 14:06               11887
imagick.setpage.php                                18-Jun-2024 14:06                3695
imagick.setpointsize.php                           18-Jun-2024 14:06                5832
imagick.setprogressmonitor.php                     18-Jun-2024 14:06               11236
imagick.setregistry.php                            18-Jun-2024 14:06                3426
imagick.setresolution.php                          18-Jun-2024 14:06                4222
imagick.setresourcelimit.php                       18-Jun-2024 14:06                4061
imagick.setsamplingfactors.php                     18-Jun-2024 14:06                7076
imagick.setsize.php                                18-Jun-2024 14:06                3190
imagick.setsizeoffset.php                          18-Jun-2024 14:06                3812
imagick.settype.php                                18-Jun-2024 14:06                2758
imagick.setup.php                                  18-Jun-2024 14:06                1750
imagick.shadeimage.php                             18-Jun-2024 14:06                6288
imagick.shadowimage.php                            18-Jun-2024 14:06                5692
imagick.sharpenimage.php                           18-Jun-2024 14:06                6087
imagick.shaveimage.php                             18-Jun-2024 14:06                5120
imagick.shearimage.php                             18-Jun-2024 14:06                7141
imagick.sigmoidalcontrastimage.php                 18-Jun-2024 14:06                9231
imagick.sketchimage.php                            18-Jun-2024 14:06                6526
imagick.smushimages.php                            18-Jun-2024 14:06                6233
imagick.solarizeimage.php                          18-Jun-2024 14:06                5284
imagick.sparsecolorimage.php                       18-Jun-2024 14:06               27497
imagick.spliceimage.php                            18-Jun-2024 14:06                6078
imagick.spreadimage.php                            18-Jun-2024 14:06                5072
imagick.statisticimage.php                         18-Jun-2024 14:06                7036
imagick.steganoimage.php                           18-Jun-2024 14:06                3421
imagick.stereoimage.php                            18-Jun-2024 14:06                3210
imagick.stripimage.php                             18-Jun-2024 14:06                2847
imagick.subimagematch.php                          18-Jun-2024 14:06                8351
imagick.swirlimage.php                             18-Jun-2024 14:06                5202
imagick.textureimage.php                           18-Jun-2024 14:06                6618
imagick.thresholdimage.php                         18-Jun-2024 14:06                5659
imagick.thumbnailimage.php                         18-Jun-2024 14:06                8714
imagick.tintimage.php                              18-Jun-2024 14:06                8511
imagick.tostring.php                               18-Jun-2024 14:06                3632
imagick.transformimage.php                         18-Jun-2024 14:06                6777
imagick.transformimagecolorspace.php               18-Jun-2024 14:06                6480
imagick.transparentpaintimage.php                  18-Jun-2024 14:06                7961
imagick.transposeimage.php                         18-Jun-2024 14:06                5079
imagick.transverseimage.php                        18-Jun-2024 14:06                5063
imagick.trimimage.php                              18-Jun-2024 14:06                6671
imagick.uniqueimagecolors.php                      18-Jun-2024 14:06                5900
imagick.unsharpmaskimage.php                       18-Jun-2024 14:06                7256
imagick.valid.php                                  18-Jun-2024 14:06                2544
imagick.vignetteimage.php                          18-Jun-2024 14:06                7069
imagick.waveimage.php                              18-Jun-2024 14:06                6950
imagick.whitethresholdimage.php                    18-Jun-2024 14:06                5680
imagick.writeimage.php                             18-Jun-2024 14:06                3543
imagick.writeimagefile.php                         18-Jun-2024 14:06                4368
imagick.writeimages.php                            18-Jun-2024 14:06                3177
imagick.writeimagesfile.php                        18-Jun-2024 14:06                4571
imagickdraw.affine.php                             18-Jun-2024 14:06               17694
imagickdraw.annotation.php                         18-Jun-2024 14:06                3677
imagickdraw.arc.php                                18-Jun-2024 14:06               10483
imagickdraw.bezier.php                             18-Jun-2024 14:06               17330                             18-Jun-2024 14:06                9453
imagickdraw.clear.php                              18-Jun-2024 14:06                2618
imagickdraw.clone.php                              18-Jun-2024 14:06                2678
imagickdraw.color.php                              18-Jun-2024 14:06                3895
imagickdraw.comment.php                            18-Jun-2024 14:06                3074
imagickdraw.composite.php                          18-Jun-2024 14:06               12711
imagickdraw.construct.php                          18-Jun-2024 14:06                2472
imagickdraw.destroy.php                            18-Jun-2024 14:06                2604
imagickdraw.ellipse.php                            18-Jun-2024 14:06               12551
imagickdraw.getclippath.php                        18-Jun-2024 14:06                2727
imagickdraw.getcliprule.php                        18-Jun-2024 14:06                2791
imagickdraw.getclipunits.php                       18-Jun-2024 14:06                2714
imagickdraw.getfillcolor.php                       18-Jun-2024 14:06                2651
imagickdraw.getfillopacity.php                     18-Jun-2024 14:06                2712
imagickdraw.getfillrule.php                        18-Jun-2024 14:06                2662
imagickdraw.getfont.php                            18-Jun-2024 14:06                2601
imagickdraw.getfontfamily.php                      18-Jun-2024 14:06                2674
imagickdraw.getfontsize.php                        18-Jun-2024 14:06                2682
imagickdraw.getfontstretch.php                     18-Jun-2024 14:06                2610
imagickdraw.getfontstyle.php                       18-Jun-2024 14:06                2849
imagickdraw.getfontweight.php                      18-Jun-2024 14:06                2737
imagickdraw.getgravity.php                         18-Jun-2024 14:06                2831
imagickdraw.getstrokeantialias.php                 18-Jun-2024 14:06                3264
imagickdraw.getstrokecolor.php                     18-Jun-2024 14:06                3089
imagickdraw.getstrokedasharray.php                 18-Jun-2024 14:06                2947
imagickdraw.getstrokedashoffset.php                18-Jun-2024 14:06                2814
imagickdraw.getstrokelinecap.php                   18-Jun-2024 14:06                3005
imagickdraw.getstrokelinejoin.php                  18-Jun-2024 14:06                3019
imagickdraw.getstrokemiterlimit.php                18-Jun-2024 14:06                3124
imagickdraw.getstrokeopacity.php                   18-Jun-2024 14:06                2799
imagickdraw.getstrokewidth.php                     18-Jun-2024 14:06                2834
imagickdraw.gettextalignment.php                   18-Jun-2024 14:06                2781
imagickdraw.gettextantialias.php                   18-Jun-2024 14:06                2991
imagickdraw.gettextdecoration.php                  18-Jun-2024 14:06                2799
imagickdraw.gettextencoding.php                    18-Jun-2024 14:06                2840
imagickdraw.gettextinterlinespacing.php            18-Jun-2024 14:06                2598
imagickdraw.gettextinterwordspacing.php            18-Jun-2024 14:06                2618
imagickdraw.gettextkerning.php                     18-Jun-2024 14:06                2541
imagickdraw.gettextundercolor.php                  18-Jun-2024 14:06                2770
imagickdraw.getvectorgraphics.php                  18-Jun-2024 14:06                2916
imagickdraw.line.php                               18-Jun-2024 14:06                8781
imagickdraw.matte.php                              18-Jun-2024 14:06                8759
imagickdraw.pathclose.php                          18-Jun-2024 14:06                2874
imagickdraw.pathcurvetoabsolute.php                18-Jun-2024 14:06                5600
imagickdraw.pathcurvetoquadraticbezierabsolute.php 18-Jun-2024 14:06               12278
imagickdraw.pathcurvetoquadraticbezierrelative.php 18-Jun-2024 14:06                4829
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 18-Jun-2024 14:06               11578
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 18-Jun-2024 14:06               11800
imagickdraw.pathcurvetorelative.php                18-Jun-2024 14:06                5655
imagickdraw.pathcurvetosmoothabsolute.php          18-Jun-2024 14:06                5448
imagickdraw.pathcurvetosmoothrelative.php          18-Jun-2024 14:06                5462
imagickdraw.pathellipticarcabsolute.php            18-Jun-2024 14:06                6514
imagickdraw.pathellipticarcrelative.php            18-Jun-2024 14:06                6490
imagickdraw.pathfinish.php                         18-Jun-2024 14:06                2519
imagickdraw.pathlinetoabsolute.php                 18-Jun-2024 14:06                3610
imagickdraw.pathlinetohorizontalabsolute.php       18-Jun-2024 14:06                3446
imagickdraw.pathlinetohorizontalrelative.php       18-Jun-2024 14:06                3452
imagickdraw.pathlinetorelative.php                 18-Jun-2024 14:06                3666
imagickdraw.pathlinetoverticalabsolute.php         18-Jun-2024 14:06                3414
imagickdraw.pathlinetoverticalrelative.php         18-Jun-2024 14:06                3420
imagickdraw.pathmovetoabsolute.php                 18-Jun-2024 14:06                3704
imagickdraw.pathmovetorelative.php                 18-Jun-2024 14:06                3646
imagickdraw.pathstart.php                          18-Jun-2024 14:06               12209
imagickdraw.point.php                              18-Jun-2024 14:06                7212
imagickdraw.polygon.php                            18-Jun-2024 14:06                9409
imagickdraw.polyline.php                           18-Jun-2024 14:06                9393
imagickdraw.pop.php                                18-Jun-2024 14:06                3369
imagickdraw.popclippath.php                        18-Jun-2024 14:06                2562
imagickdraw.popdefs.php                            18-Jun-2024 14:06                8030
imagickdraw.poppattern.php                         18-Jun-2024 14:06                2710
imagickdraw.push.php                               18-Jun-2024 14:06                9053
imagickdraw.pushclippath.php                       18-Jun-2024 14:06                3418
imagickdraw.pushdefs.php                           18-Jun-2024 14:06                3043
imagickdraw.pushpattern.php                        18-Jun-2024 14:06               15435
imagickdraw.rectangle.php                          18-Jun-2024 14:06                9049
imagickdraw.render.php                             18-Jun-2024 14:06                2824
imagickdraw.resetvectorgraphics.php                18-Jun-2024 14:06                2644
imagickdraw.rotate.php                             18-Jun-2024 14:06                8149
imagickdraw.roundrectangle.php                     18-Jun-2024 14:06               10020
imagickdraw.scale.php                              18-Jun-2024 14:06                8691
imagickdraw.setclippath.php                        18-Jun-2024 14:06                8940
imagickdraw.setcliprule.php                        18-Jun-2024 14:06                9964
imagickdraw.setclipunits.php                       18-Jun-2024 14:06                9301
imagickdraw.setfillalpha.php                       18-Jun-2024 14:06                8282
imagickdraw.setfillcolor.php                       18-Jun-2024 14:06                8264
imagickdraw.setfillopacity.php                     18-Jun-2024 14:06                8341
imagickdraw.setfillpatternurl.php                  18-Jun-2024 14:06                3952
imagickdraw.setfillrule.php                        18-Jun-2024 14:06               13427
imagickdraw.setfont.php                            18-Jun-2024 14:06                9694
imagickdraw.setfontfamily.php                      18-Jun-2024 14:06               10347
imagickdraw.setfontsize.php                        18-Jun-2024 14:06                8714
imagickdraw.setfontstretch.php                     18-Jun-2024 14:06               10150
imagickdraw.setfontstyle.php                       18-Jun-2024 14:06                9453
imagickdraw.setfontweight.php                      18-Jun-2024 14:06                9458
imagickdraw.setgravity.php                         18-Jun-2024 14:06               10965
imagickdraw.setresolution.php                      18-Jun-2024 14:06                3092
imagickdraw.setstrokealpha.php                     18-Jun-2024 14:06                8816
imagickdraw.setstrokeantialias.php                 18-Jun-2024 14:06                9529
imagickdraw.setstrokecolor.php                     18-Jun-2024 14:06                8899
imagickdraw.setstrokedasharray.php                 18-Jun-2024 14:06               14194
imagickdraw.setstrokedashoffset.php                18-Jun-2024 14:06               10319
imagickdraw.setstrokelinecap.php                   18-Jun-2024 14:06                9056
imagickdraw.setstrokelinejoin.php                  18-Jun-2024 14:06               11890
imagickdraw.setstrokemiterlimit.php                18-Jun-2024 14:06               11728
imagickdraw.setstrokeopacity.php                   18-Jun-2024 14:06               10650
imagickdraw.setstrokepatternurl.php                18-Jun-2024 14:06                3334
imagickdraw.setstrokewidth.php                     18-Jun-2024 14:06                8907
imagickdraw.settextalignment.php                   18-Jun-2024 14:06                9831
imagickdraw.settextantialias.php                   18-Jun-2024 14:06                9192
imagickdraw.settextdecoration.php                  18-Jun-2024 14:06                7846
imagickdraw.settextencoding.php                    18-Jun-2024 14:06                3820
imagickdraw.settextinterlinespacing.php            18-Jun-2024 14:06                3248
imagickdraw.settextinterwordspacing.php            18-Jun-2024 14:06                2998
imagickdraw.settextkerning.php                     18-Jun-2024 14:06                3182
imagickdraw.settextundercolor.php                  18-Jun-2024 14:06                8162
imagickdraw.setvectorgraphics.php                  18-Jun-2024 14:06                9753
imagickdraw.setviewbox.php                         18-Jun-2024 14:06               11333
imagickdraw.skewx.php                              18-Jun-2024 14:06                8504
imagickdraw.skewy.php                              18-Jun-2024 14:06                8489
imagickdraw.translate.php                          18-Jun-2024 14:06                8916
imagickkernel.addkernel.php                        18-Jun-2024 14:06                7318
imagickkernel.addunitykernel.php                   18-Jun-2024 14:06               14254
imagickkernel.frombuiltin.php                      18-Jun-2024 14:06               26548
imagickkernel.frommatrix.php                       18-Jun-2024 14:06               24052
imagickkernel.getmatrix.php                        18-Jun-2024 14:06                7518
imagickkernel.scale.php                            18-Jun-2024 14:06               13631
imagickkernel.separate.php                         18-Jun-2024 14:06                9941
imagickpixel.clear.php                             18-Jun-2024 14:06                2687
imagickpixel.construct.php                         18-Jun-2024 14:06               12296
imagickpixel.destroy.php                           18-Jun-2024 14:06                2807
imagickpixel.getcolor.php                          18-Jun-2024 14:06                8873
imagickpixel.getcolorasstring.php                  18-Jun-2024 14:06                5244
imagickpixel.getcolorcount.php                     18-Jun-2024 14:06                5378
imagickpixel.getcolorquantum.php                   18-Jun-2024 14:06                3325
imagickpixel.getcolorvalue.php                     18-Jun-2024 14:06                9584
imagickpixel.getcolorvaluequantum.php              18-Jun-2024 14:06                6595
imagickpixel.gethsl.php                            18-Jun-2024 14:06                4853
imagickpixel.getindex.php                          18-Jun-2024 14:06                2484
imagickpixel.ispixelsimilar.php                    18-Jun-2024 14:06                4177
imagickpixel.ispixelsimilarquantum.php             18-Jun-2024 14:06                3625
imagickpixel.issimilar.php                         18-Jun-2024 14:06               17388
imagickpixel.setcolor.php                          18-Jun-2024 14:06                7892
imagickpixel.setcolorcount.php                     18-Jun-2024 14:06                2931
imagickpixel.setcolorvalue.php                     18-Jun-2024 14:06                5720
imagickpixel.setcolorvaluequantum.php              18-Jun-2024 14:06                9016
imagickpixel.sethsl.php                            18-Jun-2024 14:06                8312
imagickpixel.setindex.php                          18-Jun-2024 14:06                2868
imagickpixeliterator.clear.php                     18-Jun-2024 14:06                6745
imagickpixeliterator.construct.php                 18-Jun-2024 14:06                6395
imagickpixeliterator.destroy.php                   18-Jun-2024 14:06                2758
imagickpixeliterator.getcurrentiteratorrow.php     18-Jun-2024 14:06                2913
imagickpixeliterator.getiteratorrow.php            18-Jun-2024 14:06                2879
imagickpixeliterator.getnextiteratorrow.php        18-Jun-2024 14:06                7267
imagickpixeliterator.getpreviousiteratorrow.php    18-Jun-2024 14:06                3004
imagickpixeliterator.newpixeliterator.php          18-Jun-2024 14:06                3055
imagickpixeliterator.newpixelregioniterator.php    18-Jun-2024 14:06                4655
imagickpixeliterator.resetiterator.php             18-Jun-2024 14:06                9407
imagickpixeliterator.setiteratorfirstrow.php       18-Jun-2024 14:06                2930
imagickpixeliterator.setiteratorlastrow.php        18-Jun-2024 14:06                2937
imagickpixeliterator.setiteratorrow.php            18-Jun-2024 14:06                7629
imagickpixeliterator.synciterator.php              18-Jun-2024 14:06                2734
imap.configuration.php                             18-Jun-2024 14:06                3819
imap.constants.php                                 18-Jun-2024 14:06               27680
imap.installation.php                              18-Jun-2024 14:06                3397
imap.requirements.php                              18-Jun-2024 14:06                3972
imap.resources.php                                 18-Jun-2024 14:06                1535
imap.setup.php                                     18-Jun-2024 14:06                1717
index.php                                          18-Jun-2024 14:07               20425
indexes.examples.php                               18-Jun-2024 14:07              923565
indexes.functions.php                              18-Jun-2024 14:07             1506907
indexes.php                                        18-Jun-2024 14:07                1577
infiniteiterator.construct.php                     18-Jun-2024 14:06                5379                          18-Jun-2024 14:06                3702
info.configuration.php                             18-Jun-2024 14:06               16647
info.constants.php                                 18-Jun-2024 14:06               27277
info.installation.php                              18-Jun-2024 14:06                1420
info.requirements.php                              18-Jun-2024 14:06                1303
info.resources.php                                 18-Jun-2024 14:06                1364
info.setup.php                                     18-Jun-2024 14:06                1726
ini.core.php                                       18-Jun-2024 14:07               88379
ini.list.php                                       18-Jun-2024 14:07              106526
ini.php                                            18-Jun-2024 14:07                1709
ini.sections.php                                   18-Jun-2024 14:07                4865
inotify.configuration.php                          18-Jun-2024 14:06                1456
inotify.constants.php                              18-Jun-2024 14:06               12153
inotify.install.php                                18-Jun-2024 14:06                2034
inotify.requirements.php                           18-Jun-2024 14:06                1395
inotify.resources.php                              18-Jun-2024 14:06                1486
inotify.setup.php                                  18-Jun-2024 14:06                1762                            18-Jun-2024 14:06                5151                     18-Jun-2024 14:06                3636                              18-Jun-2024 14:06                1520                                  18-Jun-2024 14:06                1833
install.fpm.configuration.php                      18-Jun-2024 14:06               44701
install.fpm.install.php                            18-Jun-2024 14:06                3658
install.fpm.php                                    18-Jun-2024 14:06                4873
install.general.php                                18-Jun-2024 14:06                5956
install.macosx.bundled.php                         18-Jun-2024 14:06               13445
install.macosx.compile.php                         18-Jun-2024 14:06                1501
install.macosx.packages.php                        18-Jun-2024 14:06                3676
install.macosx.php                                 18-Jun-2024 14:06                2256
install.pecl.downloads.php                         18-Jun-2024 14:06                4314
install.pecl.intro.php                             18-Jun-2024 14:06                3882
install.pecl.pear.php                              18-Jun-2024 14:06                3598
install.pecl.php                                   18-Jun-2024 14:06                2185
install.pecl.php-config.php                        18-Jun-2024 14:06                5043
install.pecl.phpize.php                            18-Jun-2024 14:06                3930
install.pecl.static.php                            18-Jun-2024 14:06                4147                           18-Jun-2024 14:06               12659
install.php                                        18-Jun-2024 14:06                6498
install.problems.bugs.php                          18-Jun-2024 14:06                2439
install.problems.faq.php                           18-Jun-2024 14:06                1472
install.problems.php                               18-Jun-2024 14:06                1680                       18-Jun-2024 14:06                2894
install.unix.apache2.php                           18-Jun-2024 14:06               17379
install.unix.commandline.php                       18-Jun-2024 14:06                4697
install.unix.debian.php                            18-Jun-2024 14:06                8760
install.unix.lighttpd-14.php                       18-Jun-2024 14:06                7710
install.unix.litespeed.php                         18-Jun-2024 14:06               11538
install.unix.nginx.php                             18-Jun-2024 14:06               10600
install.unix.openbsd.php                           18-Jun-2024 14:06                7601
install.unix.php                                   18-Jun-2024 14:06                9880
install.unix.solaris.php                           18-Jun-2024 14:06                4835                        18-Jun-2024 14:06                8788                       18-Jun-2024 14:06                2005                    18-Jun-2024 14:06               10432                         18-Jun-2024 14:06                6252                           18-Jun-2024 14:06                1854                                18-Jun-2024 14:06                3876                    18-Jun-2024 14:06                6364                   18-Jun-2024 14:06                2691                          18-Jun-2024 14:06                2103                18-Jun-2024 14:06                2154
internaliterator.construct.php                     18-Jun-2024 14:06                2102
internaliterator.current.php                       18-Jun-2024 14:06                2456
internaliterator.key.php                           18-Jun-2024 14:06                2451                          18-Jun-2024 14:06                2504
internaliterator.rewind.php                        18-Jun-2024 14:06                2528
internaliterator.valid.php                         18-Jun-2024 14:06                2506
intl.configuration.php                             18-Jun-2024 14:06                6387
intl.constants.php                                 18-Jun-2024 14:06               77733
intl.examples.basic.php                            18-Jun-2024 14:06                4723
intl.examples.php                                  18-Jun-2024 14:06                1517
intl.installation.php                              18-Jun-2024 14:06                2093
intl.requirements.php                              18-Jun-2024 14:06                1554
intl.resources.php                                 18-Jun-2024 14:06                1364
intl.setup.php                                     18-Jun-2024 14:06                1716
intlbreakiterator.construct.php                    18-Jun-2024 14:06                4941
intlbreakiterator.createcharacterinstance.php      18-Jun-2024 14:06                3577
intlbreakiterator.createcodepointinstance.php      18-Jun-2024 14:06                3008
intlbreakiterator.createlineinstance.php           18-Jun-2024 14:06                3519
intlbreakiterator.createsentenceinstance.php       18-Jun-2024 14:06                3510
intlbreakiterator.createtitleinstance.php          18-Jun-2024 14:06                3484
intlbreakiterator.createwordinstance.php           18-Jun-2024 14:06                3434
intlbreakiterator.current.php                      18-Jun-2024 14:06                2684
intlbreakiterator.first.php                        18-Jun-2024 14:06                2677
intlbreakiterator.following.php                    18-Jun-2024 14:06                2955
intlbreakiterator.geterrorcode.php                 18-Jun-2024 14:06                3272
intlbreakiterator.geterrormessage.php              18-Jun-2024 14:06                3335
intlbreakiterator.getlocale.php                    18-Jun-2024 14:06                3049
intlbreakiterator.getpartsiterator.php             18-Jun-2024 14:06                4250
intlbreakiterator.gettext.php                      18-Jun-2024 14:06                2795
intlbreakiterator.isboundary.php                   18-Jun-2024 14:06                2921
intlbreakiterator.last.php                         18-Jun-2024 14:06                2692                         18-Jun-2024 14:06                3077
intlbreakiterator.preceding.php                    18-Jun-2024 14:06                2942
intlbreakiterator.previous.php                     18-Jun-2024 14:06                2754
intlbreakiterator.settext.php                      18-Jun-2024 14:06                3953
intlcalendar.add.php                               18-Jun-2024 14:06                9822
intlcalendar.after.php                             18-Jun-2024 14:06                7465
intlcalendar.before.php                            18-Jun-2024 14:06                4788
intlcalendar.clear.php                             18-Jun-2024 14:06               20492
intlcalendar.construct.php                         18-Jun-2024 14:06                2577
intlcalendar.createinstance.php                    18-Jun-2024 14:06               14906
intlcalendar.equals.php                            18-Jun-2024 14:06               11647
intlcalendar.fielddifference.php                   18-Jun-2024 14:06               12529
intlcalendar.fromdatetime.php                      18-Jun-2024 14:06                8894
intlcalendar.get.php                               18-Jun-2024 14:06                9268
intlcalendar.getactualmaximum.php                  18-Jun-2024 14:06                9922
intlcalendar.getactualminimum.php                  18-Jun-2024 14:06                6892
intlcalendar.getavailablelocales.php               18-Jun-2024 14:06                5027
intlcalendar.getdayofweektype.php                  18-Jun-2024 14:06               11375
intlcalendar.geterrorcode.php                      18-Jun-2024 14:06               10311
intlcalendar.geterrormessage.php                   18-Jun-2024 14:06                6975
intlcalendar.getfirstdayofweek.php                 18-Jun-2024 14:06                9425
intlcalendar.getgreatestminimum.php                18-Jun-2024 14:06                5419
intlcalendar.getkeywordvaluesforlocale.php         18-Jun-2024 14:06                8503
intlcalendar.getleastmaximum.php                   18-Jun-2024 14:06                9182
intlcalendar.getlocale.php                         18-Jun-2024 14:06                7297
intlcalendar.getmaximum.php                        18-Jun-2024 14:06                6163
intlcalendar.getminimaldaysinfirstweek.php         18-Jun-2024 14:06                9946
intlcalendar.getminimum.php                        18-Jun-2024 14:06                5368
intlcalendar.getnow.php                            18-Jun-2024 14:06                5860
intlcalendar.getrepeatedwalltimeoption.php         18-Jun-2024 14:06               11326
intlcalendar.getskippedwalltimeoption.php          18-Jun-2024 14:06               13817
intlcalendar.gettime.php                           18-Jun-2024 14:06                7200
intlcalendar.gettimezone.php                       18-Jun-2024 14:06                8164
intlcalendar.gettype.php                           18-Jun-2024 14:06                6177
intlcalendar.getweekendtransition.php              18-Jun-2024 14:06                6035
intlcalendar.indaylighttime.php                    18-Jun-2024 14:06                9459
intlcalendar.isequivalentto.php                    18-Jun-2024 14:06                9570
intlcalendar.islenient.php                         18-Jun-2024 14:06                9002
intlcalendar.isset.php                             18-Jun-2024 14:06                5544
intlcalendar.isweekend.php                         18-Jun-2024 14:06               10031
intlcalendar.roll.php                              18-Jun-2024 14:06               10390
intlcalendar.set.php                               18-Jun-2024 14:06               17305
intlcalendar.setdate.php                           18-Jun-2024 14:06                5309
intlcalendar.setdatetime.php                       18-Jun-2024 14:06                7440
intlcalendar.setfirstdayofweek.php                 18-Jun-2024 14:06                9669
intlcalendar.setlenient.php                        18-Jun-2024 14:06                5776
intlcalendar.setminimaldaysinfirstweek.php         18-Jun-2024 14:06                6392
intlcalendar.setrepeatedwalltimeoption.php         18-Jun-2024 14:06                7702
intlcalendar.setskippedwalltimeoption.php          18-Jun-2024 14:06                8746
intlcalendar.settime.php                           18-Jun-2024 14:06                9599
intlcalendar.settimezone.php                       18-Jun-2024 14:06               12194
intlcalendar.todatetime.php                        18-Jun-2024 14:06                8030
intlchar.charage.php                               18-Jun-2024 14:06                6636
intlchar.chardigitvalue.php                        18-Jun-2024 14:06                6237
intlchar.chardirection.php                         18-Jun-2024 14:06               11436
intlchar.charfromname.php                          18-Jun-2024 14:06                7989
intlchar.charmirror.php                            18-Jun-2024 14:06                7555
intlchar.charname.php                              18-Jun-2024 14:06                8426
intlchar.chartype.php                              18-Jun-2024 14:06               12042
intlchar.chr.php                                   18-Jun-2024 14:06                6248
intlchar.digit.php                                 18-Jun-2024 14:06                9894
intlchar.enumcharnames.php                         18-Jun-2024 14:06                9989
intlchar.enumchartypes.php                         18-Jun-2024 14:06                6579
intlchar.foldcase.php                              18-Jun-2024 14:06                4696
intlchar.fordigit.php                              18-Jun-2024 14:06                7940
intlchar.getbidipairedbracket.php                  18-Jun-2024 14:06                7074
intlchar.getblockcode.php                          18-Jun-2024 14:06                6045
intlchar.getcombiningclass.php                     18-Jun-2024 14:06                5466
intlchar.getfc-nfkc-closure.php                    18-Jun-2024 14:06                5380
intlchar.getintpropertymaxvalue.php                18-Jun-2024 14:06                6968
intlchar.getintpropertyminvalue.php                18-Jun-2024 14:06                6959
intlchar.getintpropertyvalue.php                   18-Jun-2024 14:06                9126
intlchar.getnumericvalue.php                       18-Jun-2024 14:06                6304
intlchar.getpropertyenum.php                       18-Jun-2024 14:06                7231
intlchar.getpropertyname.php                       18-Jun-2024 14:06                9958
intlchar.getpropertyvalueenum.php                  18-Jun-2024 14:06                8737
intlchar.getpropertyvaluename.php                  18-Jun-2024 14:06               12211
intlchar.getunicodeversion.php                     18-Jun-2024 14:06                4334
intlchar.hasbinaryproperty.php                     18-Jun-2024 14:06               10277
intlchar.isalnum.php                               18-Jun-2024 14:06                6567
intlchar.isalpha.php                               18-Jun-2024 14:06                6447
intlchar.isbase.php                                18-Jun-2024 14:06                6958
intlchar.isblank.php                               18-Jun-2024 14:06                7804
intlchar.iscntrl.php                               18-Jun-2024 14:06                7532
intlchar.isdefined.php                             18-Jun-2024 14:06                7663
intlchar.isdigit.php                               18-Jun-2024 14:06                6912
intlchar.isgraph.php                               18-Jun-2024 14:06                6898
intlchar.isidignorable.php                         18-Jun-2024 14:06                7201
intlchar.isidpart.php                              18-Jun-2024 14:06                7859
intlchar.isidstart.php                             18-Jun-2024 14:06                7205
intlchar.isisocontrol.php                          18-Jun-2024 14:06                6278
intlchar.isjavaidpart.php                          18-Jun-2024 14:06                7769
intlchar.isjavaidstart.php                         18-Jun-2024 14:06                7452
intlchar.isjavaspacechar.php                       18-Jun-2024 14:06                7666
intlchar.islower.php                               18-Jun-2024 14:06                8239
intlchar.ismirrored.php                            18-Jun-2024 14:06                6434
intlchar.isprint.php                               18-Jun-2024 14:06                6885
intlchar.ispunct.php                               18-Jun-2024 14:06                6555
intlchar.isspace.php                               18-Jun-2024 14:06                7382
intlchar.istitle.php                               18-Jun-2024 14:06                8722
intlchar.isualphabetic.php                         18-Jun-2024 14:06                6598
intlchar.isulowercase.php                          18-Jun-2024 14:06                7726
intlchar.isupper.php                               18-Jun-2024 14:06                8241
intlchar.isuuppercase.php                          18-Jun-2024 14:06                7796
intlchar.isuwhitespace.php                         18-Jun-2024 14:06                8263
intlchar.iswhitespace.php                          18-Jun-2024 14:06                8210
intlchar.isxdigit.php                              18-Jun-2024 14:06                8198
intlchar.ord.php                                   18-Jun-2024 14:06                6009
intlchar.tolower.php                               18-Jun-2024 14:06                8704
intlchar.totitle.php                               18-Jun-2024 14:06                8972
intlchar.toupper.php                               18-Jun-2024 14:06                8523
intlcodepointbreakiterator.getlastcodepoint.php    18-Jun-2024 14:06                2975
intldateformatter.create.php                       18-Jun-2024 14:06               31094
intldateformatter.format.php                       18-Jun-2024 14:06               28768
intldateformatter.formatobject.php                 18-Jun-2024 14:06               16082
intldateformatter.getcalendar.php                  18-Jun-2024 14:06               14106
intldateformatter.getcalendarobject.php            18-Jun-2024 14:06                8588
intldateformatter.getdatetype.php                  18-Jun-2024 14:06               12764
intldateformatter.geterrorcode.php                 18-Jun-2024 14:06                9231
intldateformatter.geterrormessage.php              18-Jun-2024 14:06                9162
intldateformatter.getlocale.php                    18-Jun-2024 14:06               13636
intldateformatter.getpattern.php                   18-Jun-2024 14:06               11477
intldateformatter.gettimetype.php                  18-Jun-2024 14:06               12671
intldateformatter.gettimezone.php                  18-Jun-2024 14:06                9492
intldateformatter.gettimezoneid.php                18-Jun-2024 14:06                9826
intldateformatter.islenient.php                    18-Jun-2024 14:06               16256
intldateformatter.localtime.php                    18-Jun-2024 14:06               12803
intldateformatter.parse.php                        18-Jun-2024 14:06               13976
intldateformatter.setcalendar.php                  18-Jun-2024 14:06               15993
intldateformatter.setlenient.php                   18-Jun-2024 14:06               17209
intldateformatter.setpattern.php                   18-Jun-2024 14:06               12736
intldateformatter.settimezone.php                  18-Jun-2024 14:06               13545
intldatepatterngenerator.create.php                18-Jun-2024 14:06                4693
intldatepatterngenerator.getbestpattern.php        18-Jun-2024 14:06                7368
intlgregoriancalendar.construct.php                18-Jun-2024 14:06                5787
intlgregoriancalendar.createfromdate.php           18-Jun-2024 14:06                8019
intlgregoriancalendar.createfromdatetime.php       18-Jun-2024 14:06                9826
intlgregoriancalendar.getgregorianchange.php       18-Jun-2024 14:06                2954
intlgregoriancalendar.isleapyear.php               18-Jun-2024 14:06                3393
intlgregoriancalendar.setgregorianchange.php       18-Jun-2024 14:06                3388
intliterator.current.php                           18-Jun-2024 14:06                2547
intliterator.key.php                               18-Jun-2024 14:06                2533                              18-Jun-2024 14:06                2532
intliterator.rewind.php                            18-Jun-2024 14:06                2546
intliterator.valid.php                             18-Jun-2024 14:06                2557
intlpartsiterator.getbreakiterator.php             18-Jun-2024 14:06                2774
intlrulebasedbreakiterator.construct.php           18-Jun-2024 14:06                3384
intlrulebasedbreakiterator.getbinaryrules.php      18-Jun-2024 14:06                3052
intlrulebasedbreakiterator.getrules.php            18-Jun-2024 14:06                3037
intlrulebasedbreakiterator.getrulestatus.php       18-Jun-2024 14:06                3013
intlrulebasedbreakiterator.getrulestatusvec.php    18-Jun-2024 14:06                3125
intltimezone.construct.php                         18-Jun-2024 14:06                2110
intltimezone.countequivalentids.php                18-Jun-2024 14:06                3997
intltimezone.createdefault.php                     18-Jun-2024 14:06                3310
intltimezone.createenumeration.php                 18-Jun-2024 14:06                5056
intltimezone.createtimezone.php                    18-Jun-2024 14:06                3930
intltimezone.createtimezoneidenumeration.php       18-Jun-2024 14:06                6181
intltimezone.fromdatetimezone.php                  18-Jun-2024 14:06                4015
intltimezone.getcanonicalid.php                    18-Jun-2024 14:06                4825
intltimezone.getdisplayname.php                    18-Jun-2024 14:06                5819
intltimezone.getdstsavings.php                     18-Jun-2024 14:06                3497
intltimezone.getequivalentid.php                   18-Jun-2024 14:06                4388
intltimezone.geterrorcode.php                      18-Jun-2024 14:06                3587
intltimezone.geterrormessage.php                   18-Jun-2024 14:06                3624
intltimezone.getgmt.php                            18-Jun-2024 14:06                3119
intltimezone.getid.php                             18-Jun-2024 14:06                3482
intltimezone.getidforwindowsid.php                 18-Jun-2024 14:06                6526
intltimezone.getoffset.php                         18-Jun-2024 14:06                5420
intltimezone.getrawoffset.php                      18-Jun-2024 14:06                3408
intltimezone.getregion.php                         18-Jun-2024 14:06                4038
intltimezone.gettzdataversion.php                  18-Jun-2024 14:06                3562
intltimezone.getunknown.php                        18-Jun-2024 14:06                3462
intltimezone.getwindowsid.php                      18-Jun-2024 14:06                4941
intltimezone.hassamerules.php                      18-Jun-2024 14:06                3854
intltimezone.todatetimezone.php                    18-Jun-2024 14:06                3700
intltimezone.usedaylighttime.php                   18-Jun-2024 14:06                3418
intro-whatcando.php                                18-Jun-2024 14:06               12306
intro-whatis.php                                   18-Jun-2024 14:06                5549
intro.apache.php                                   18-Jun-2024 14:06                1298
intro.apcu.php                                     18-Jun-2024 14:06                2386
intro.array.php                                    18-Jun-2024 14:06                2447
intro.bc.php                                       18-Jun-2024 14:06                5137
intro.bzip2.php                                    18-Jun-2024 14:06                1273
intro.calendar.php                                 18-Jun-2024 14:06                2656
intro.classobj.php                                 18-Jun-2024 14:06                2227
intro.cmark.php                                    18-Jun-2024 14:06                7684                                      18-Jun-2024 14:06                4711
intro.componere.php                                18-Jun-2024 14:06                7413
intro.ctype.php                                    18-Jun-2024 14:06                5541
intro.cubrid.php                                   18-Jun-2024 14:06                1610
intro.curl.php                                     18-Jun-2024 14:06                2093
intro.datetime.php                                 18-Jun-2024 14:06                3648
intro.dba.php                                      18-Jun-2024 14:06                1742
intro.dbase.php                                    18-Jun-2024 14:06                8528
intro.dio.php                                      18-Jun-2024 14:06                2109
intro.dom.php                                      18-Jun-2024 14:06                1850
intro.ds.php                                       18-Jun-2024 14:06                1700
intro.eio.php                                      18-Jun-2024 14:06               16281
intro.enchant.php                                  18-Jun-2024 14:06                3122
intro.errorfunc.php                                18-Jun-2024 14:06                2591
intro.ev.php                                       18-Jun-2024 14:06                3179
intro.event.php                                    18-Jun-2024 14:06                2480
intro.exec.php                                     18-Jun-2024 14:06                2021
intro.exif.php                                     18-Jun-2024 14:06                1707
intro.expect.php                                   18-Jun-2024 14:06                1645
intro.fann.php                                     18-Jun-2024 14:06                1670
intro.fdf.php                                      18-Jun-2024 14:06                4630
intro.ffi.php                                      18-Jun-2024 14:06                3640
intro.fileinfo.php                                 18-Jun-2024 14:06                1703
intro.filesystem.php                               18-Jun-2024 14:06                1707
intro.filter.php                                   18-Jun-2024 14:06                3840
intro.fpm.php                                      18-Jun-2024 14:06                1578
intro.ftp.php                                      18-Jun-2024 14:06                2007
intro.funchand.php                                 18-Jun-2024 14:06                1409
intro.gearman.php                                  18-Jun-2024 14:06                2068
intro.gender.php                                   18-Jun-2024 14:06                1516
intro.geoip.php                                    18-Jun-2024 14:06                1814
intro.gettext.php                                  18-Jun-2024 14:06                1683
intro.gmagick.php                                  18-Jun-2024 14:06                2062
intro.gmp.php                                      18-Jun-2024 14:06                3865
intro.gnupg.php                                    18-Jun-2024 14:06                1296
intro.hash.php                                     18-Jun-2024 14:06                1444
intro.hrtime.php                                   18-Jun-2024 14:06                2055
intro.ibase.php                                    18-Jun-2024 14:06                4163                                  18-Jun-2024 14:06                1381
intro.iconv.php                                    18-Jun-2024 14:06                2422
intro.igbinary.php                                 18-Jun-2024 14:06                2069
intro.image.php                                    18-Jun-2024 14:06                8499
intro.imagick.php                                  18-Jun-2024 14:06                2277
intro.imap.php                                     18-Jun-2024 14:06                1975                                     18-Jun-2024 14:06                1783
intro.inotify.php                                  18-Jun-2024 14:06                2598
intro.intl.php                                     18-Jun-2024 14:06                7406
intro.json.php                                     18-Jun-2024 14:06                1854
intro.ldap.php                                     18-Jun-2024 14:06                5195
intro.libxml.php                                   18-Jun-2024 14:06                1861
intro.lua.php                                      18-Jun-2024 14:06                1421
intro.luasandbox.php                               18-Jun-2024 14:06                2982
intro.lzf.php                                      18-Jun-2024 14:06                1739
intro.mail.php                                     18-Jun-2024 14:06                1313
intro.mailparse.php                                18-Jun-2024 14:06                2198
intro.math.php                                     18-Jun-2024 14:06                2338
intro.mbstring.php                                 18-Jun-2024 14:06                4395
intro.mcrypt.php                                   18-Jun-2024 14:06                2607
intro.memcache.php                                 18-Jun-2024 14:06                2035
intro.memcached.php                                18-Jun-2024 14:06                2263
intro.mhash.php                                    18-Jun-2024 14:06                3679
intro.misc.php                                     18-Jun-2024 14:06                1269
intro.mqseries.php                                 18-Jun-2024 14:06                2077
intro.mysql-xdevapi.php                            18-Jun-2024 14:06                2291
intro.mysql.php                                    18-Jun-2024 14:06                2102
intro.mysqli.php                                   18-Jun-2024 14:06                2615
intro.mysqlnd.php                                  18-Jun-2024 14:06                2446                                  18-Jun-2024 14:06                1255
intro.oauth.php                                    18-Jun-2024 14:06                1597
intro.oci8.php                                     18-Jun-2024 14:06                1924
intro.opcache.php                                  18-Jun-2024 14:06                1808
intro.openal.php                                   18-Jun-2024 14:06                1357
intro.openssl.php                                  18-Jun-2024 14:06                1939
intro.outcontrol.php                               18-Jun-2024 14:06                2188
intro.parallel.php                                 18-Jun-2024 14:06                9150
intro.parle.php                                    18-Jun-2024 14:06                5335
intro.password.php                                 18-Jun-2024 14:06                1635
intro.pcntl.php                                    18-Jun-2024 14:06                4062
intro.pcre.php                                     18-Jun-2024 14:06                3949
intro.pdo.php                                      18-Jun-2024 14:06                3049
intro.pgsql.php                                    18-Jun-2024 14:06                2021
intro.phar.php                                     18-Jun-2024 14:06               13517
intro.phpdbg.php                                   18-Jun-2024 14:06                7820
intro.posix.php                                    18-Jun-2024 14:06                1962                                       18-Jun-2024 14:06                2384
intro.pspell.php                                   18-Jun-2024 14:06                1305
intro.pthreads.php                                 18-Jun-2024 14:06               12871
intro.quickhash.php                                18-Jun-2024 14:06                1412
intro.radius.php                                   18-Jun-2024 14:06                2470
intro.random.php                                   18-Jun-2024 14:06                1146
intro.rar.php                                      18-Jun-2024 14:06                1800
intro.readline.php                                 18-Jun-2024 14:06                2477
intro.recode.php                                   18-Jun-2024 14:06                2679
intro.reflection.php                               18-Jun-2024 14:06                2211
intro.rnp.php                                      18-Jun-2024 14:06                1420
intro.rpminfo.php                                  18-Jun-2024 14:06                1576
intro.rrd.php                                      18-Jun-2024 14:06                1609
intro.runkit7.php                                  18-Jun-2024 14:06                1748
intro.scoutapm.php                                 18-Jun-2024 14:06                1718
intro.seaslog.php                                  18-Jun-2024 14:06                5897
intro.sem.php                                      18-Jun-2024 14:06                4594
intro.session.php                                  18-Jun-2024 14:06                6488
intro.shmop.php                                    18-Jun-2024 14:06                1516
intro.simdjson.php                                 18-Jun-2024 14:06                1341
intro.simplexml.php                                18-Jun-2024 14:06                1531
intro.snmp.php                                     18-Jun-2024 14:06                2025
intro.soap.php                                     18-Jun-2024 14:06                1602
intro.sockets.php                                  18-Jun-2024 14:06                3342
intro.sodium.php                                   18-Jun-2024 14:06                1726
intro.solr.php                                     18-Jun-2024 14:06                2199
intro.spl.php                                      18-Jun-2024 14:06                1873
intro.sqlite3.php                                  18-Jun-2024 14:06                1242
intro.sqlsrv.php                                   18-Jun-2024 14:06                2407
intro.ssdeep.php                                   18-Jun-2024 14:06                2149
intro.ssh2.php                                     18-Jun-2024 14:06                1594
intro.stats.php                                    18-Jun-2024 14:06                1822
intro.stomp.php                                    18-Jun-2024 14:06                1584                                   18-Jun-2024 14:06                5482
intro.strings.php                                  18-Jun-2024 14:06                1999
intro.svm.php                                      18-Jun-2024 14:06                1401
intro.svn.php                                      18-Jun-2024 14:06                2133
intro.swoole.php                                   18-Jun-2024 14:06                2026
intro.sync.php                                     18-Jun-2024 14:06                3395
intro.taint.php                                    18-Jun-2024 14:06                4675
intro.tcpwrap.php                                  18-Jun-2024 14:06                1382
intro.tidy.php                                     18-Jun-2024 14:06                1681
intro.tokenizer.php                                18-Jun-2024 14:06                1862
intro.trader.php                                   18-Jun-2024 14:06                3261
intro.ui.php                                       18-Jun-2024 14:06                1413
intro.uodbc.php                                    18-Jun-2024 14:06                3511
intro.uopz.php                                     18-Jun-2024 14:06                2973
intro.url.php                                      18-Jun-2024 14:06                1229
intro.v8js.php                                     18-Jun-2024 14:06                1267
intro.var.php                                      18-Jun-2024 14:06                1555
intro.var_representation.php                       18-Jun-2024 14:06                1569
intro.varnish.php                                  18-Jun-2024 14:06                1507
intro.wddx.php                                     18-Jun-2024 14:06                2461
intro.win32service.php                             18-Jun-2024 14:06                1601
intro.wincache.php                                 18-Jun-2024 14:06                6976
intro.wkhtmltox.php                                18-Jun-2024 14:06                1454
intro.xattr.php                                    18-Jun-2024 14:06                1308
intro.xdiff.php                                    18-Jun-2024 14:06                3246
intro.xhprof.php                                   18-Jun-2024 14:06                3906
intro.xlswriter.php                                18-Jun-2024 14:06                1266
intro.xml.php                                      18-Jun-2024 14:06                2958
intro.xmldiff.php                                  18-Jun-2024 14:06                1808
intro.xmlreader.php                                18-Jun-2024 14:06                1864
intro.xmlrpc.php                                   18-Jun-2024 14:06                2235
intro.xmlwriter.php                                18-Jun-2024 14:06                1957
intro.xsl.php                                      18-Jun-2024 14:06                1444
intro.yac.php                                      18-Jun-2024 14:06                1421
intro.yaconf.php                                   18-Jun-2024 14:06                3395
intro.yaf.php                                      18-Jun-2024 14:06                1701
intro.yaml.php                                     18-Jun-2024 14:06                1508
intro.yar.php                                      18-Jun-2024 14:06                1455
intro.yaz.php                                      18-Jun-2024 14:06                3437                                      18-Jun-2024 14:06                1299
intro.zlib.php                                     18-Jun-2024 14:06                1952
intro.zmq.php                                      18-Jun-2024 14:06                1625
intro.zookeeper.php                                18-Jun-2024 14:06                1751
introduction.php                                   18-Jun-2024 14:06                1557
iterator.current.php                               18-Jun-2024 14:06                2319
iterator.key.php                                   18-Jun-2024 14:06                2889                                  18-Jun-2024 14:06                2663
iterator.rewind.php                                18-Jun-2024 14:06                2845
iterator.valid.php                                 18-Jun-2024 14:06                3155
iteratoraggregate.getiterator.php                  18-Jun-2024 14:06                3153
iteratoriterator.construct.php                     18-Jun-2024 14:06                3822
iteratoriterator.current.php                       18-Jun-2024 14:06                2934
iteratoriterator.getinneriterator.php              18-Jun-2024 14:06                3443
iteratoriterator.key.php                           18-Jun-2024 14:06                2870                          18-Jun-2024 14:06                3187
iteratoriterator.rewind.php                        18-Jun-2024 14:06                3199
iteratoriterator.valid.php                         18-Jun-2024 14:06                3355
json.configuration.php                             18-Jun-2024 14:06                1418
json.constants.php                                 18-Jun-2024 14:06               19730
json.installation.php                              18-Jun-2024 14:06                2084
json.requirements.php                              18-Jun-2024 14:06                1399
json.resources.php                                 18-Jun-2024 14:06                1364
json.setup.php                                     18-Jun-2024 14:06                1690
jsonserializable.jsonserialize.php                 18-Jun-2024 14:06               13464
langref.php                                        18-Jun-2024 14:06               25455
language.attributes.classes.php                    18-Jun-2024 14:06                7775
language.attributes.overview.php                   18-Jun-2024 14:06               11290
language.attributes.php                            18-Jun-2024 14:06                1925
language.attributes.reflection.php                 18-Jun-2024 14:06                9187
language.attributes.syntax.php                     18-Jun-2024 14:06                6920
language.basic-syntax.comments.php                 18-Jun-2024 14:06                4572
language.basic-syntax.instruction-separation.php   18-Jun-2024 14:06                5302
language.basic-syntax.php                          18-Jun-2024 14:06                1803
language.basic-syntax.phpmode.php                  18-Jun-2024 14:06                6035
language.basic-syntax.phptags.php                  18-Jun-2024 14:06                6204
language.constants.magic.php                       18-Jun-2024 14:06                6529
language.constants.php                             18-Jun-2024 14:06                7862
language.constants.predefined.php                  18-Jun-2024 14:06                1922
language.constants.syntax.php                      18-Jun-2024 14:06               12657
language.control-structures.php                    18-Jun-2024 14:06                2885
language.enumerations.backed.php                   18-Jun-2024 14:06               13606
language.enumerations.basics.php                   18-Jun-2024 14:06                9905
language.enumerations.constants.php                18-Jun-2024 14:06                2782
language.enumerations.examples.php                 18-Jun-2024 14:06                8134
language.enumerations.expressions.php              18-Jun-2024 14:06                7842
language.enumerations.listing.php                  18-Jun-2024 14:06                2596
language.enumerations.methods.php                  18-Jun-2024 14:06               15241
language.enumerations.object-differences.inheri..> 18-Jun-2024 14:06                7056
language.enumerations.object-differences.php       18-Jun-2024 14:06                6188
language.enumerations.overview.php                 18-Jun-2024 14:06                3172
language.enumerations.php                          18-Jun-2024 14:06                2794
language.enumerations.serialization.php            18-Jun-2024 14:06                5811
language.enumerations.static-methods.php           18-Jun-2024 14:06                3721
language.enumerations.traits.php                   18-Jun-2024 14:06                4821
language.errors.basics.php                         18-Jun-2024 14:06                7049
language.errors.php                                18-Jun-2024 14:06                2240
language.errors.php7.php                           18-Jun-2024 14:06                6446
language.exceptions.extending.php                  18-Jun-2024 14:06               21716
language.exceptions.php                            18-Jun-2024 14:06               31865
language.expressions.php                           18-Jun-2024 14:06               21439
language.fibers.php                                18-Jun-2024 14:06                7722
language.functions.php                             18-Jun-2024 14:06                2191
language.generators.comparison.php                 18-Jun-2024 14:06                9574
language.generators.overview.php                   18-Jun-2024 14:06               10726
language.generators.php                            18-Jun-2024 14:06                1775
language.generators.syntax.php                     18-Jun-2024 14:06               27354
language.namespaces.basics.php                     18-Jun-2024 14:06               12797
language.namespaces.definition.php                 18-Jun-2024 14:06                5419
language.namespaces.definitionmultiple.php         18-Jun-2024 14:06               10220
language.namespaces.dynamic.php                    18-Jun-2024 14:06               10244
language.namespaces.fallback.php                   18-Jun-2024 14:06                6956
language.namespaces.faq.php                        18-Jun-2024 14:06               37480                     18-Jun-2024 14:06                3202
language.namespaces.importing.php                  18-Jun-2024 14:06               17599
language.namespaces.nested.php                     18-Jun-2024 14:06                3098
language.namespaces.nsconstants.php                18-Jun-2024 14:06               10047
language.namespaces.php                            18-Jun-2024 14:06                2699
language.namespaces.rationale.php                  18-Jun-2024 14:06                7789
language.namespaces.rules.php                      18-Jun-2024 14:06               15852
language.oop5.abstract.php                         18-Jun-2024 14:06               11801
language.oop5.anonymous.php                        18-Jun-2024 14:06               11485
language.oop5.autoload.php                         18-Jun-2024 14:06                7953
language.oop5.basic.php                            18-Jun-2024 14:06               57375
language.oop5.changelog.php                        18-Jun-2024 14:06               16881
language.oop5.cloning.php                          18-Jun-2024 14:06               10264
language.oop5.constants.php                        18-Jun-2024 14:06               10285
language.oop5.decon.php                            18-Jun-2024 14:06               36485                            18-Jun-2024 14:06                6887
language.oop5.inheritance.php                      18-Jun-2024 14:06               16066
language.oop5.interfaces.php                       18-Jun-2024 14:06               26465
language.oop5.iterations.php                       18-Jun-2024 14:06                6546
language.oop5.late-static-bindings.php             18-Jun-2024 14:06               17128
language.oop5.magic.php                            18-Jun-2024 14:06               48376
language.oop5.object-comparison.php                18-Jun-2024 14:06                9348
language.oop5.overloading.php                      18-Jun-2024 14:06               27158
language.oop5.paamayim-nekudotayim.php             18-Jun-2024 14:06                9809
language.oop5.php                                  18-Jun-2024 14:06                3796                       18-Jun-2024 14:06               30679
language.oop5.references.php                       18-Jun-2024 14:06                6595
language.oop5.serialization.php                    18-Jun-2024 14:06                8600
language.oop5.static.php                           18-Jun-2024 14:06               10428
language.oop5.traits.php                           18-Jun-2024 14:06               39559
language.oop5.variance.php                         18-Jun-2024 14:06               17311
language.oop5.visibility.php                       18-Jun-2024 14:06               26839
language.operators.arithmetic.php                  18-Jun-2024 14:06                7050
language.operators.array.php                       18-Jun-2024 14:06               10433
language.operators.assignment.php                  18-Jun-2024 14:06               13389
language.operators.bitwise.php                     18-Jun-2024 14:06               50173
language.operators.comparison.php                  18-Jun-2024 14:06               48388
language.operators.errorcontrol.php                18-Jun-2024 14:06                7337
language.operators.execution.php                   18-Jun-2024 14:06                3905
language.operators.increment.php                   18-Jun-2024 14:06               16378
language.operators.logical.php                     18-Jun-2024 14:06                8333
language.operators.php                             18-Jun-2024 14:06                4910
language.operators.precedence.php                  18-Jun-2024 14:06               23189
language.operators.string.php                      18-Jun-2024 14:06                3644
language.operators.type.php                        18-Jun-2024 14:06               20010
language.references.arent.php                      18-Jun-2024 14:06                3773
language.references.pass.php                       18-Jun-2024 14:06                7289
language.references.php                            18-Jun-2024 14:06                2172
language.references.return.php                     18-Jun-2024 14:06                8071                       18-Jun-2024 14:06                3043
language.references.unset.php                      18-Jun-2024 14:06                2545
language.references.whatare.php                    18-Jun-2024 14:06                2589
language.references.whatdo.php                     18-Jun-2024 14:06               20352
language.types.array.php                           18-Jun-2024 14:06              113281
language.types.boolean.php                         18-Jun-2024 14:06               10900
language.types.callable.php                        18-Jun-2024 14:06               13161
language.types.declarations.php                    18-Jun-2024 14:06               49894
language.types.enumerations.php                    18-Jun-2024 14:06                4257
language.types.float.php                           18-Jun-2024 14:06               12611
language.types.integer.php                         18-Jun-2024 14:06               25177
language.types.intro.php                           18-Jun-2024 14:06                9694
language.types.iterable.php                        18-Jun-2024 14:06                3502
language.types.mixed.php                           18-Jun-2024 14:06                1831
language.types.never.php                           18-Jun-2024 14:06                2419
language.types.null.php                            18-Jun-2024 14:06                4102
language.types.numeric-strings.php                 18-Jun-2024 14:06               12572
language.types.object.php                          18-Jun-2024 14:06                6279
language.types.php                                 18-Jun-2024 14:06                3077
language.types.relative-class-types.php            18-Jun-2024 14:06                2851
language.types.resource.php                        18-Jun-2024 14:06                3694
language.types.string.php                          18-Jun-2024 14:06               95862
language.types.type-juggling.php                   18-Jun-2024 14:06               34820
language.types.type-system.php                     18-Jun-2024 14:06                9851
language.types.value.php                           18-Jun-2024 14:06                2510
language.types.void.php                            18-Jun-2024 14:06                2286
language.variables.basics.php                      18-Jun-2024 14:06               16459
language.variables.external.php                    18-Jun-2024 14:06               21266
language.variables.php                             18-Jun-2024 14:06                1937
language.variables.predefined.php                  18-Jun-2024 14:06                4065
language.variables.scope.php                       18-Jun-2024 14:06               33220
language.variables.superglobals.php                18-Jun-2024 14:06                5182
language.variables.variable.php                    18-Jun-2024 14:06               11977
ldap.configuration.php                             18-Jun-2024 14:06                2765
ldap.constants.php                                 18-Jun-2024 14:06               37248
ldap.controls.php                                  18-Jun-2024 14:06               12574
ldap.examples-basic.php                            18-Jun-2024 14:06                8763
ldap.examples-controls.php                         18-Jun-2024 14:06               16744
ldap.examples.php                                  18-Jun-2024 14:06                1568
ldap.installation.php                              18-Jun-2024 14:06                3580
ldap.requirements.php                              18-Jun-2024 14:06                1760
ldap.resources.php                                 18-Jun-2024 14:06                1682
ldap.setup.php                                     18-Jun-2024 14:06                1716
ldap.using.php                                     18-Jun-2024 14:06                2979
libxml.configuration.php                           18-Jun-2024 14:06                1456
libxml.constants.php                               18-Jun-2024 14:06               15564
libxml.installation.php                            18-Jun-2024 14:06                2333
libxml.installation_old.php                        18-Jun-2024 14:06                3128
libxml.requirements.php                            18-Jun-2024 14:06                1479
libxml.resources.php                               18-Jun-2024 14:06                1378
libxml.setup.php                                   18-Jun-2024 14:06                1849
limititerator.construct.php                        18-Jun-2024 14:06                8252
limititerator.current.php                          18-Jun-2024 14:06                4002
limititerator.getposition.php                      18-Jun-2024 14:06                6090
limititerator.key.php                              18-Jun-2024 14:06                4079                             18-Jun-2024 14:06                3716
limititerator.rewind.php                           18-Jun-2024 14:06                3950                             18-Jun-2024 14:06                4683
limititerator.valid.php                            18-Jun-2024 14:06                3979
locale.acceptfromhttp.php                          18-Jun-2024 14:06                6847
locale.canonicalize.php                            18-Jun-2024 14:06                3479
locale.composelocale.php                           18-Jun-2024 14:06               15258
locale.filtermatches.php                           18-Jun-2024 14:06               10130
locale.getallvariants.php                          18-Jun-2024 14:06                7249
locale.getdefault.php                              18-Jun-2024 14:06                6480
locale.getdisplaylanguage.php                      18-Jun-2024 14:06               11006
locale.getdisplayname.php                          18-Jun-2024 14:06               10810
locale.getdisplayregion.php                        18-Jun-2024 14:06               10761
locale.getdisplayscript.php                        18-Jun-2024 14:06               10773
locale.getdisplayvariant.php                       18-Jun-2024 14:06               10803
locale.getkeywords.php                             18-Jun-2024 14:06                7911
locale.getprimarylanguage.php                      18-Jun-2024 14:06                6656
locale.getregion.php                               18-Jun-2024 14:06                6634
locale.getscript.php                               18-Jun-2024 14:06                6203
locale.lookup.php                                  18-Jun-2024 14:06               11082
locale.parselocale.php                             18-Jun-2024 14:06                8302
locale.setdefault.php                              18-Jun-2024 14:06                6006
lua.assign.php                                     18-Jun-2024 14:06                5001                                       18-Jun-2024 14:06                7949
lua.configuration.php                              18-Jun-2024 14:06                1411
lua.construct.php                                  18-Jun-2024 14:06                2569
lua.eval.php                                       18-Jun-2024 14:06                4139
lua.getversion.php                                 18-Jun-2024 14:06                2482
lua.include.php                                    18-Jun-2024 14:06                2993
lua.installation.php                               18-Jun-2024 14:06                2296
lua.registercallback.php                           18-Jun-2024 14:06                4933
lua.requirements.php                               18-Jun-2024 14:06                1473
lua.resources.php                                  18-Jun-2024 14:06                1331
lua.setup.php                                      18-Jun-2024 14:06                1677
luaclosure.invoke.php                              18-Jun-2024 14:06                4393
luasandbox.callfunction.php                        18-Jun-2024 14:06                5709
luasandbox.configuration.php                       18-Jun-2024 14:06                1460
luasandbox.disableprofiler.php                     18-Jun-2024 14:06                3162
luasandbox.enableprofiler.php                      18-Jun-2024 14:06                4088
luasandbox.examples-basic.php                      18-Jun-2024 14:06                7082
luasandbox.examples.php                            18-Jun-2024 14:06                1590
luasandbox.getcpuusage.php                         18-Jun-2024 14:06                4271
luasandbox.getmemoryusage.php                      18-Jun-2024 14:06                3573
luasandbox.getpeakmemoryusage.php                  18-Jun-2024 14:06                3629
luasandbox.getprofilerfunctionreport.php           18-Jun-2024 14:06                6987
luasandbox.getversioninfo.php                      18-Jun-2024 14:06                3298
luasandbox.installation.php                        18-Jun-2024 14:06                2435
luasandbox.loadbinary.php                          18-Jun-2024 14:06                3876
luasandbox.loadstring.php                          18-Jun-2024 14:06                6113
luasandbox.pauseusagetimer.php                     18-Jun-2024 14:06               10578
luasandbox.registerlibrary.php                     18-Jun-2024 14:06                7400
luasandbox.requirements.php                        18-Jun-2024 14:06                2240
luasandbox.resources.php                           18-Jun-2024 14:06                1415
luasandbox.setcpulimit.php                         18-Jun-2024 14:06                7188
luasandbox.setmemorylimit.php                      18-Jun-2024 14:06                6106
luasandbox.setup.php                               18-Jun-2024 14:06                1768
luasandbox.unpauseusagetimer.php                   18-Jun-2024 14:06                3566
luasandbox.wrapphpfunction.php                     18-Jun-2024 14:06                5004                        18-Jun-2024 14:06               10110
luasandboxfunction.construct.php                   18-Jun-2024 14:06                2964
luasandboxfunction.dump.php                        18-Jun-2024 14:06                2634
lzf.configuration.php                              18-Jun-2024 14:06                1411
lzf.constants.php                                  18-Jun-2024 14:06                1287
lzf.installation.php                               18-Jun-2024 14:06                2938
lzf.requirements.php                               18-Jun-2024 14:06                1296
lzf.resources.php                                  18-Jun-2024 14:06                1357
lzf.setup.php                                      18-Jun-2024 14:06                1698
mail.configuration.php                             18-Jun-2024 14:06                9398
mail.constants.php                                 18-Jun-2024 14:06                1287
mail.installation.php                              18-Jun-2024 14:06                1420
mail.requirements.php                              18-Jun-2024 14:06                2427
mail.resources.php                                 18-Jun-2024 14:06                1364
mail.setup.php                                     18-Jun-2024 14:06                1711
mailparse.configuration.php                        18-Jun-2024 14:06                2869
mailparse.constants.php                            18-Jun-2024 14:06                2606
mailparse.installation.php                         18-Jun-2024 14:06                3014
mailparse.requirements.php                         18-Jun-2024 14:06                1338
mailparse.resources.php                            18-Jun-2024 14:06                1726
mailparse.setup.php                                18-Jun-2024 14:06                1776
manual.php                                         18-Jun-2024 14:06                1394
math.configuration.php                             18-Jun-2024 14:06                1418
math.constants.php                                 18-Jun-2024 14:06                7673
math.installation.php                              18-Jun-2024 14:06                1420
math.requirements.php                              18-Jun-2024 14:06                1303
math.resources.php                                 18-Jun-2024 14:06                1364
math.setup.php                                     18-Jun-2024 14:06                1706
mbstring.configuration.php                         18-Jun-2024 14:06               20389
mbstring.constants.php                             18-Jun-2024 14:06                7949
mbstring.encodings.php                             18-Jun-2024 14:06               18827
mbstring.http.php                                  18-Jun-2024 14:06                6892
mbstring.installation.php                          18-Jun-2024 14:06                4285
mbstring.ja-basic.php                              18-Jun-2024 14:06                5123
mbstring.overload.php                              18-Jun-2024 14:06                8840
mbstring.php4.req.php                              18-Jun-2024 14:06                5393
mbstring.requirements.php                          18-Jun-2024 14:06                1331
mbstring.resources.php                             18-Jun-2024 14:06                1392
mbstring.setup.php                                 18-Jun-2024 14:06                1798
mbstring.supported-encodings.php                   18-Jun-2024 14:06                9067
mcrypt.ciphers.php                                 18-Jun-2024 14:06                7310
mcrypt.configuration.php                           18-Jun-2024 14:06                4264
mcrypt.constants.php                               18-Jun-2024 14:06                7657
mcrypt.installation.php                            18-Jun-2024 14:06                2046
mcrypt.requirements.php                            18-Jun-2024 14:06                2599
mcrypt.resources.php                               18-Jun-2024 14:06                1462
mcrypt.setup.php                                   18-Jun-2024 14:06                1743
memcache.add.php                                   18-Jun-2024 14:06                8228
memcache.addserver.php                             18-Jun-2024 14:06               17688
memcache.close.php                                 18-Jun-2024 14:06                5861
memcache.connect.php                               18-Jun-2024 14:06                8861
memcache.constants.php                             18-Jun-2024 14:06                5605
memcache.decrement.php                             18-Jun-2024 14:06                8206
memcache.delete.php                                18-Jun-2024 14:06                7349
memcache.examples-overview.php                     18-Jun-2024 14:06                6972
memcache.examples.php                              18-Jun-2024 14:06                1539
memcache.flush.php                                 18-Jun-2024 14:06                5156
memcache.get.php                                   18-Jun-2024 14:06                9803
memcache.getextendedstats.php                      18-Jun-2024 14:06                9362
memcache.getserverstatus.php                       18-Jun-2024 14:06                6857
memcache.getstats.php                              18-Jun-2024 14:06                5660
memcache.getversion.php                            18-Jun-2024 14:06                5485
memcache.increment.php                             18-Jun-2024 14:06                7959
memcache.ini.php                                   18-Jun-2024 14:06               12509
memcache.installation.php                          18-Jun-2024 14:06                2657
memcache.pconnect.php                              18-Jun-2024 14:06                7328
memcache.replace.php                               18-Jun-2024 14:06                8281
memcache.requirements.php                          18-Jun-2024 14:06                1551
memcache.resources.php                             18-Jun-2024 14:06                1512
memcache.set.php                                   18-Jun-2024 14:06               11356
memcache.setcompressthreshold.php                  18-Jun-2024 14:06                6702
memcache.setserverparams.php                       18-Jun-2024 14:06               13197
memcache.setup.php                                 18-Jun-2024 14:06                1758
memcached.add.php                                  18-Jun-2024 14:06                5309
memcached.addbykey.php                             18-Jun-2024 14:06                6691
memcached.addserver.php                            18-Jun-2024 14:06                9226
memcached.addservers.php                           18-Jun-2024 14:06                6199
memcached.append.php                               18-Jun-2024 14:06                8325
memcached.appendbykey.php                          18-Jun-2024 14:06                6120
memcached.callbacks.php                            18-Jun-2024 14:06                1761               18-Jun-2024 14:06                5266
memcached.callbacks.result.php                     18-Jun-2024 14:06                5371
memcached.cas.php                                  18-Jun-2024 14:06               10726
memcached.casbykey.php                             18-Jun-2024 14:06                7135
memcached.configuration.php                        18-Jun-2024 14:06               34285
memcached.constants.php                            18-Jun-2024 14:06               34707
memcached.construct.php                            18-Jun-2024 14:06                6443
memcached.decrement.php                            18-Jun-2024 14:06               10154
memcached.decrementbykey.php                       18-Jun-2024 14:06                7078
memcached.delete.php                               18-Jun-2024 14:06                6278
memcached.deletebykey.php                          18-Jun-2024 14:06                6632
memcached.deletemulti.php                          18-Jun-2024 14:06                5216
memcached.deletemultibykey.php                     18-Jun-2024 14:06                6952
memcached.expiration.php                           18-Jun-2024 14:06                2590
memcached.fetch.php                                18-Jun-2024 14:06                7234
memcached.fetchall.php                             18-Jun-2024 14:06                7002
memcached.flush.php                                18-Jun-2024 14:06                5484
memcached.get.php                                  18-Jun-2024 14:06               11746
memcached.getallkeys.php                           18-Jun-2024 14:06                3686
memcached.getbykey.php                             18-Jun-2024 14:06                7684
memcached.getdelayed.php                           18-Jun-2024 14:06                9829
memcached.getdelayedbykey.php                      18-Jun-2024 14:06                6782
memcached.getmulti.php                             18-Jun-2024 14:06               22179
memcached.getmultibykey.php                        18-Jun-2024 14:06                6565
memcached.getoption.php                            18-Jun-2024 14:06                5813
memcached.getresultcode.php                        18-Jun-2024 14:06                4641
memcached.getresultmessage.php                     18-Jun-2024 14:06                5166
memcached.getserverbykey.php                       18-Jun-2024 14:06                8181
memcached.getserverlist.php                        18-Jun-2024 14:06                4884
memcached.getstats.php                             18-Jun-2024 14:06                6322
memcached.getversion.php                           18-Jun-2024 14:06                4442
memcached.increment.php                            18-Jun-2024 14:06                9518
memcached.incrementbykey.php                       18-Jun-2024 14:06                7018
memcached.installation.php                         18-Jun-2024 14:06                3373
memcached.ispersistent.php                         18-Jun-2024 14:06                3462
memcached.ispristine.php                           18-Jun-2024 14:06                3272
memcached.prepend.php                              18-Jun-2024 14:06                8511
memcached.prependbykey.php                         18-Jun-2024 14:06                6143
memcached.quit.php                                 18-Jun-2024 14:06                2730
memcached.replace.php                              18-Jun-2024 14:06                5408
memcached.replacebykey.php                         18-Jun-2024 14:06                6813
memcached.requirements.php                         18-Jun-2024 14:06                1736
memcached.resetserverlist.php                      18-Jun-2024 14:06                3440
memcached.resources.php                            18-Jun-2024 14:06                1399
memcached.sessions.php                             18-Jun-2024 14:06                3076
memcached.set.php                                  18-Jun-2024 14:06               10237
memcached.setbykey.php                             18-Jun-2024 14:06                8133
memcached.setmulti.php                             18-Jun-2024 14:06                7092
memcached.setmultibykey.php                        18-Jun-2024 14:06                5995
memcached.setoption.php                            18-Jun-2024 14:06                8173
memcached.setoptions.php                           18-Jun-2024 14:06                7580
memcached.setsaslauthdata.php                      18-Jun-2024 14:06                4010
memcached.setup.php                                18-Jun-2024 14:06                1775
memcached.touch.php                                18-Jun-2024 14:06                4343
memcached.touchbykey.php                           18-Jun-2024 14:06                5619
messageformatter.create.php                        18-Jun-2024 14:06               12093
messageformatter.format.php                        18-Jun-2024 14:06               10527
messageformatter.formatmessage.php                 18-Jun-2024 14:06               15905
messageformatter.geterrorcode.php                  18-Jun-2024 14:06                4450
messageformatter.geterrormessage.php               18-Jun-2024 14:06                8276
messageformatter.getlocale.php                     18-Jun-2024 14:06                6132
messageformatter.getpattern.php                    18-Jun-2024 14:06               10892
messageformatter.parse.php                         18-Jun-2024 14:06               10620
messageformatter.parsemessage.php                  18-Jun-2024 14:06               10913
messageformatter.setpattern.php                    18-Jun-2024 14:06               11631
mhash.configuration.php                            18-Jun-2024 14:06                1425
mhash.constants.php                                18-Jun-2024 14:06                7435
mhash.examples.php                                 18-Jun-2024 14:06                3482
mhash.installation.php                             18-Jun-2024 14:06                1940
mhash.requirements.php                             18-Jun-2024 14:06                1414
mhash.resources.php                                18-Jun-2024 14:06                1371
mhash.setup.php                                    18-Jun-2024 14:06                1725
migration56.changed-functions.php                  18-Jun-2024 14:07                7890
migration56.constants.php                          18-Jun-2024 14:07                6888
migration56.deprecated.php                         18-Jun-2024 14:07                6971
migration56.extensions.php                         18-Jun-2024 14:07                5003
migration56.incompatible.php                       18-Jun-2024 14:07               10818                       18-Jun-2024 14:07               32522                      18-Jun-2024 14:07                7653
migration56.openssl.php                            18-Jun-2024 14:07               30867
migration56.php                                    18-Jun-2024 14:07                2899
migration70.changed-functions.php                  18-Jun-2024 14:07                5997
migration70.classes.php                            18-Jun-2024 14:07                4099
migration70.constants.php                          18-Jun-2024 14:07                9678
migration70.deprecated.php                         18-Jun-2024 14:07                6774
migration70.incompatible.php                       18-Jun-2024 14:07               73585                       18-Jun-2024 14:07               48458                      18-Jun-2024 14:07                7664
migration70.other-changes.php                      18-Jun-2024 14:07                4265
migration70.php                                    18-Jun-2024 14:07                3576
migration70.removed-exts-sapis.php                 18-Jun-2024 14:07                3277
migration70.sapi-changes.php                       18-Jun-2024 14:07                2276
migration71.changed-functions.php                  18-Jun-2024 14:07                9208
migration71.constants.php                          18-Jun-2024 14:07                9028
migration71.deprecated.php                         18-Jun-2024 14:07                2678
migration71.incompatible.php                       18-Jun-2024 14:07               40117                       18-Jun-2024 14:07               30468                      18-Jun-2024 14:07                5199
migration71.other-changes.php                      18-Jun-2024 14:07               10924
migration71.php                                    18-Jun-2024 14:07                2954                    18-Jun-2024 14:07               10196
migration72.constants.php                          18-Jun-2024 14:07               32180
migration72.deprecated.php                         18-Jun-2024 14:07               13786
migration72.incompatible.php                       18-Jun-2024 14:07               24290                       18-Jun-2024 14:07               22014                      18-Jun-2024 14:07               24548
migration72.other-changes.php                      18-Jun-2024 14:07                6965
migration72.php                                    18-Jun-2024 14:07                2808
migration73.constants.php                          18-Jun-2024 14:07               26494
migration73.deprecated.php                         18-Jun-2024 14:07               10515
migration73.incompatible.php                       18-Jun-2024 14:07               23456                       18-Jun-2024 14:07               20689                      18-Jun-2024 14:07                7758
migration73.other-changes.php                      18-Jun-2024 14:07               20192
migration73.php                                    18-Jun-2024 14:07                2950                    18-Jun-2024 14:07                2326
migration74.constants.php                          18-Jun-2024 14:06                8004
migration74.deprecated.php                         18-Jun-2024 14:07               18667
migration74.incompatible.php                       18-Jun-2024 14:07               23552                        18-Jun-2024 14:06                1623                       18-Jun-2024 14:06               26054                      18-Jun-2024 14:06                3892
migration74.other-changes.php                      18-Jun-2024 14:07               25786
migration74.php                                    18-Jun-2024 14:07                3182
migration74.removed-extensions.php                 18-Jun-2024 14:07                2269                    18-Jun-2024 14:07                4819
migration80.deprecated.php                         18-Jun-2024 14:06               21097
migration80.incompatible.php                       18-Jun-2024 14:06              118258                       18-Jun-2024 14:06               38816
migration80.other-changes.php                      18-Jun-2024 14:06               17473
migration80.php                                    18-Jun-2024 14:06                2802
migration81.constants.php                          18-Jun-2024 14:06                8806
migration81.deprecated.php                         18-Jun-2024 14:06               22853
migration81.incompatible.php                       18-Jun-2024 14:06               29012                        18-Jun-2024 14:06                2268                       18-Jun-2024 14:06               28426                      18-Jun-2024 14:06                8677
migration81.other-changes.php                      18-Jun-2024 14:06               12439
migration81.php                                    18-Jun-2024 14:06                3059
migration82.constants.php                          18-Jun-2024 14:06               22434
migration82.deprecated.php                         18-Jun-2024 14:06                7560
migration82.incompatible.php                       18-Jun-2024 14:06               12330                       18-Jun-2024 14:06                9122                      18-Jun-2024 14:06                4442
migration82.other-changes.php                      18-Jun-2024 14:06               28993
migration82.php                                    18-Jun-2024 14:06                3099                    18-Jun-2024 14:06                2794
migration83.constants.php                          18-Jun-2024 14:06               15813
migration83.deprecated.php                         18-Jun-2024 14:06                9154
migration83.incompatible.php                       18-Jun-2024 14:06               20253                        18-Jun-2024 14:06                3521                       18-Jun-2024 14:06                9646                      18-Jun-2024 14:06                7389
migration83.other-changes.php                      18-Jun-2024 14:06               43883
migration83.php                                    18-Jun-2024 14:06                3278                    18-Jun-2024 14:06                1533
misc.configuration.php                             18-Jun-2024 14:06                6622
misc.constants.php                                 18-Jun-2024 14:06                2844
misc.installation.php                              18-Jun-2024 14:06                1420
misc.requirements.php                              18-Jun-2024 14:06                1303
misc.resources.php                                 18-Jun-2024 14:06                1364
misc.setup.php                                     18-Jun-2024 14:06                1696
mongodb-bson-binary.construct.php                  18-Jun-2024 14:06                8589
mongodb-bson-binary.getdata.php                    18-Jun-2024 14:06                4735
mongodb-bson-binary.gettype.php                    18-Jun-2024 14:06                4705
mongodb-bson-binary.jsonserialize.php              18-Jun-2024 14:06                6086
mongodb-bson-binary.serialize.php                  18-Jun-2024 14:06                3829
mongodb-bson-binary.tostring.php                   18-Jun-2024 14:06                4464
mongodb-bson-binary.unserialize.php                18-Jun-2024 14:06                4840
mongodb-bson-binaryinterface.getdata.php           18-Jun-2024 14:06                3003
mongodb-bson-binaryinterface.gettype.php           18-Jun-2024 14:06                2995
mongodb-bson-binaryinterface.tostring.php          18-Jun-2024 14:06                3485
mongodb-bson-dbpointer.construct.php               18-Jun-2024 14:06                2874
mongodb-bson-dbpointer.jsonserialize.php           18-Jun-2024 14:06                6161
mongodb-bson-dbpointer.serialize.php               18-Jun-2024 14:06                3904
mongodb-bson-dbpointer.tostring.php                18-Jun-2024 14:06                2856
mongodb-bson-dbpointer.unserialize.php             18-Jun-2024 14:06                4156
mongodb-bson-decimal128.construct.php              18-Jun-2024 14:06                6203
mongodb-bson-decimal128.jsonserialize.php          18-Jun-2024 14:06                6167
mongodb-bson-decimal128.serialize.php              18-Jun-2024 14:06                3933
mongodb-bson-decimal128.tostring.php               18-Jun-2024 14:06                4833
mongodb-bson-decimal128.unserialize.php            18-Jun-2024 14:06                4980
mongodb-bson-decimal128interface.tostring.php      18-Jun-2024 14:06                3206
mongodb-bson-document.construct.php                18-Jun-2024 14:06                3631
mongodb-bson-document.frombson.php                 18-Jun-2024 14:06                4442
mongodb-bson-document.fromjson.php                 18-Jun-2024 14:06                5033
mongodb-bson-document.fromphp.php                  18-Jun-2024 14:06                4724
mongodb-bson-document.get.php                      18-Jun-2024 14:06                4839
mongodb-bson-document.getiterator.php              18-Jun-2024 14:06                3926
mongodb-bson-document.has.php                      18-Jun-2024 14:06                4162
mongodb-bson-document.offsetexists.php             18-Jun-2024 14:06                3825
mongodb-bson-document.offsetget.php                18-Jun-2024 14:06                4912
mongodb-bson-document.offsetset.php                18-Jun-2024 14:06                3911
mongodb-bson-document.offsetunset.php              18-Jun-2024 14:06                3458
mongodb-bson-document.serialize.php                18-Jun-2024 14:06                3925
mongodb-bson-document.tocanonicalextendedjson.php  18-Jun-2024 14:06               13285
mongodb-bson-document.tophp.php                    18-Jun-2024 14:06                6520
mongodb-bson-document.torelaxedextendedjson.php    18-Jun-2024 14:06               12944
mongodb-bson-document.tostring.php                 18-Jun-2024 14:06                2983
mongodb-bson-document.unserialize.php              18-Jun-2024 14:06                4981
mongodb-bson-int64.construct.php                   18-Jun-2024 14:06                5373
mongodb-bson-int64.jsonserialize.php               18-Jun-2024 14:06                5918
mongodb-bson-int64.serialize.php                   18-Jun-2024 14:06                3804
mongodb-bson-int64.tostring.php                    18-Jun-2024 14:06                4125
mongodb-bson-int64.unserialize.php                 18-Jun-2024 14:06                4856
mongodb-bson-iterator.construct.php                18-Jun-2024 14:06                3639
mongodb-bson-iterator.current.php                  18-Jun-2024 14:06                4096
mongodb-bson-iterator.key.php                      18-Jun-2024 14:06                4053                     18-Jun-2024 14:06                2572
mongodb-bson-iterator.rewind.php                   18-Jun-2024 14:06                2605
mongodb-bson-iterator.valid.php                    18-Jun-2024 14:06                3142
mongodb-bson-javascript.construct.php              18-Jun-2024 14:06                7596
mongodb-bson-javascript.getcode.php                18-Jun-2024 14:06                4695
mongodb-bson-javascript.getscope.php               18-Jun-2024 14:06                5737
mongodb-bson-javascript.jsonserialize.php          18-Jun-2024 14:06                6161
mongodb-bson-javascript.serialize.php              18-Jun-2024 14:06                3937
mongodb-bson-javascript.tostring.php               18-Jun-2024 14:06                4440
mongodb-bson-javascript.unserialize.php            18-Jun-2024 14:06                4928
mongodb-bson-javascriptinterface.getcode.php       18-Jun-2024 14:06                3079
mongodb-bson-javascriptinterface.getscope.php      18-Jun-2024 14:06                3333
mongodb-bson-javascriptinterface.tostring.php      18-Jun-2024 14:06                3559
mongodb-bson-maxkey.construct.php                  18-Jun-2024 14:06                3923
mongodb-bson-maxkey.jsonserialize.php              18-Jun-2024 14:06                6101
mongodb-bson-maxkey.serialize.php                  18-Jun-2024 14:06                3833
mongodb-bson-maxkey.unserialize.php                18-Jun-2024 14:06                4083
mongodb-bson-minkey.construct.php                  18-Jun-2024 14:06                3923
mongodb-bson-minkey.jsonserialize.php              18-Jun-2024 14:06                6101
mongodb-bson-minkey.serialize.php                  18-Jun-2024 14:06                3833
mongodb-bson-minkey.unserialize.php                18-Jun-2024 14:06                4089
mongodb-bson-objectid.construct.php                18-Jun-2024 14:06                5681
mongodb-bson-objectid.gettimestamp.php             18-Jun-2024 14:06                6233
mongodb-bson-objectid.jsonserialize.php            18-Jun-2024 14:06                6144
mongodb-bson-objectid.serialize.php                18-Jun-2024 14:06                3879
mongodb-bson-objectid.tostring.php                 18-Jun-2024 14:06                4485
mongodb-bson-objectid.unserialize.php              18-Jun-2024 14:06                4934
mongodb-bson-objectidinterface.gettimestamp.php    18-Jun-2024 14:06                3198
mongodb-bson-objectidinterface.tostring.php        18-Jun-2024 14:06                3223
mongodb-bson-packedarray.construct.php             18-Jun-2024 14:06                3181
mongodb-bson-packedarray.fromphp.php               18-Jun-2024 14:06                4452
mongodb-bson-packedarray.get.php                   18-Jun-2024 14:06                4905
mongodb-bson-packedarray.getiterator.php           18-Jun-2024 14:06                3979
mongodb-bson-packedarray.has.php                   18-Jun-2024 14:06                4226
mongodb-bson-packedarray.offsetexists.php          18-Jun-2024 14:06                3885
mongodb-bson-packedarray.offsetget.php             18-Jun-2024 14:06                5121
mongodb-bson-packedarray.offsetset.php             18-Jun-2024 14:06                3965
mongodb-bson-packedarray.offsetunset.php           18-Jun-2024 14:06                3512
mongodb-bson-packedarray.serialize.php             18-Jun-2024 14:06                3974
mongodb-bson-packedarray.tophp.php                 18-Jun-2024 14:06                5073
mongodb-bson-packedarray.tostring.php              18-Jun-2024 14:06                2986
mongodb-bson-packedarray.unserialize.php           18-Jun-2024 14:06                5017
mongodb-bson-persistable.bsonserialize.php         18-Jun-2024 14:06                7303
mongodb-bson-regex.construct.php                   18-Jun-2024 14:06                7824
mongodb-bson-regex.getflags.php                    18-Jun-2024 14:06                4845
mongodb-bson-regex.getpattern.php                  18-Jun-2024 14:06                4662
mongodb-bson-regex.jsonserialize.php               18-Jun-2024 14:06                6080
mongodb-bson-regex.serialize.php                   18-Jun-2024 14:06                3804
mongodb-bson-regex.tostring.php                    18-Jun-2024 14:06                4172
mongodb-bson-regex.unserialize.php                 18-Jun-2024 14:06                4816
mongodb-bson-regexinterface.getflags.php           18-Jun-2024 14:06                2993
mongodb-bson-regexinterface.getpattern.php         18-Jun-2024 14:06                3036
mongodb-bson-regexinterface.tostring.php           18-Jun-2024 14:06                3116
mongodb-bson-serializable.bsonserialize.php        18-Jun-2024 14:06               19053
mongodb-bson-symbol.construct.php                  18-Jun-2024 14:06                2817
mongodb-bson-symbol.jsonserialize.php              18-Jun-2024 14:06                6101
mongodb-bson-symbol.serialize.php                  18-Jun-2024 14:06                3829
mongodb-bson-symbol.tostring.php                   18-Jun-2024 14:06                2838
mongodb-bson-symbol.unserialize.php                18-Jun-2024 14:06                4091
mongodb-bson-timestamp.construct.php               18-Jun-2024 14:06                5263
mongodb-bson-timestamp.getincrement.php            18-Jun-2024 14:06                5216
mongodb-bson-timestamp.gettimestamp.php            18-Jun-2024 14:06                5212
mongodb-bson-timestamp.jsonserialize.php           18-Jun-2024 14:06                6168
mongodb-bson-timestamp.serialize.php               18-Jun-2024 14:06                3904
mongodb-bson-timestamp.tostring.php                18-Jun-2024 14:06                4295
mongodb-bson-timestamp.unserialize.php             18-Jun-2024 14:06                4912
mongodb-bson-timestampinterface.getincrement.php   18-Jun-2024 14:06                3787
mongodb-bson-timestampinterface.gettimestamp.php   18-Jun-2024 14:06                3821
mongodb-bson-timestampinterface.tostring.php       18-Jun-2024 14:06                3208
mongodb-bson-undefined.construct.php               18-Jun-2024 14:06                2877
mongodb-bson-undefined.jsonserialize.php           18-Jun-2024 14:06                6164
mongodb-bson-undefined.serialize.php               18-Jun-2024 14:06                3904
mongodb-bson-undefined.tostring.php                18-Jun-2024 14:06                2859
mongodb-bson-undefined.unserialize.php             18-Jun-2024 14:06                4153
mongodb-bson-unserializable.bsonunserialize.php    18-Jun-2024 14:06                7686
mongodb-bson-utcdatetime.construct.php             18-Jun-2024 14:06                9021
mongodb-bson-utcdatetime.jsonserialize.php         18-Jun-2024 14:06                6206
mongodb-bson-utcdatetime.serialize.php             18-Jun-2024 14:06                3956
mongodb-bson-utcdatetime.todatetime.php            18-Jun-2024 14:06                6214
mongodb-bson-utcdatetime.tostring.php              18-Jun-2024 14:06                4270
mongodb-bson-utcdatetime.unserialize.php           18-Jun-2024 14:06                4944
mongodb-bson-utcdatetimeinterface.todatetime.php   18-Jun-2024 14:06                3531
mongodb-bson-utcdatetimeinterface.tostring.php     18-Jun-2024 14:06                3224
mongodb-driver-bulkwrite.construct.php             18-Jun-2024 14:06               20314
mongodb-driver-bulkwrite.count.php                 18-Jun-2024 14:06                7597
mongodb-driver-bulkwrite.delete.php                18-Jun-2024 14:06               13373
mongodb-driver-bulkwrite.insert.php                18-Jun-2024 14:06               10177
mongodb-driver-bulkwrite.update.php                18-Jun-2024 14:06               17934
mongodb-driver-clientencryption.addkeyaltname.php  18-Jun-2024 14:06                6417
mongodb-driver-clientencryption.construct.php      18-Jun-2024 14:06               13210
mongodb-driver-clientencryption.createdatakey.php  18-Jun-2024 14:06               13555
mongodb-driver-clientencryption.decrypt.php        18-Jun-2024 14:06                4643
mongodb-driver-clientencryption.deletekey.php      18-Jun-2024 14:06                4911
mongodb-driver-clientencryption.encrypt.php        18-Jun-2024 14:06               14765
mongodb-driver-clientencryption.encryptexpressi..> 18-Jun-2024 14:06               17408
mongodb-driver-clientencryption.getkey.php         18-Jun-2024 14:06                5074
mongodb-driver-clientencryption.getkeybyaltname..> 18-Jun-2024 14:06                5816
mongodb-driver-clientencryption.getkeys.php        18-Jun-2024 14:06                4468
mongodb-driver-clientencryption.removekeyaltnam..> 18-Jun-2024 14:06                6471
mongodb-driver-clientencryption.rewrapmanydatak..> 18-Jun-2024 14:06               14952
mongodb-driver-command.construct.php               18-Jun-2024 14:06               15522
mongodb-driver-commandexception.getresultdocume..> 18-Jun-2024 14:06                3558
mongodb-driver-cursor.construct.php                18-Jun-2024 14:06                3700
mongodb-driver-cursor.current.php                  18-Jun-2024 14:06                3402
mongodb-driver-cursor.getid.php                    18-Jun-2024 14:06                8272
mongodb-driver-cursor.getserver.php                18-Jun-2024 14:06                7864
mongodb-driver-cursor.isdead.php                   18-Jun-2024 14:06               12039
mongodb-driver-cursor.key.php                      18-Jun-2024 14:06                2868                     18-Jun-2024 14:06                3983
mongodb-driver-cursor.rewind.php                   18-Jun-2024 14:06                4596
mongodb-driver-cursor.settypemap.php               18-Jun-2024 14:06                8616
mongodb-driver-cursor.toarray.php                  18-Jun-2024 14:06                8247
mongodb-driver-cursor.valid.php                    18-Jun-2024 14:06                3058
mongodb-driver-cursorid.construct.php              18-Jun-2024 14:06                3050
mongodb-driver-cursorid.serialize.php              18-Jun-2024 14:06                3931
mongodb-driver-cursorid.tostring.php               18-Jun-2024 14:06                7541
mongodb-driver-cursorid.unserialize.php            18-Jun-2024 14:06                5036
mongodb-driver-cursorinterface.getid.php           18-Jun-2024 14:06                4424
mongodb-driver-cursorinterface.getserver.php       18-Jun-2024 14:06                4448
mongodb-driver-cursorinterface.isdead.php          18-Jun-2024 14:06                4876
mongodb-driver-cursorinterface.settypemap.php      18-Jun-2024 14:06                4539
mongodb-driver-cursorinterface.toarray.php         18-Jun-2024 14:06                4359
mongodb-driver-manager.addsubscriber.php           18-Jun-2024 14:06                6704
mongodb-driver-manager.construct.php               18-Jun-2024 14:06               99030
mongodb-driver-manager.createclientencryption.php  18-Jun-2024 14:06               14989
mongodb-driver-manager.executebulkwrite.php        18-Jun-2024 14:06               26097
mongodb-driver-manager.executecommand.php          18-Jun-2024 14:06               27723
mongodb-driver-manager.executequery.php            18-Jun-2024 14:06               17928
mongodb-driver-manager.executereadcommand.php      18-Jun-2024 14:06               11319
mongodb-driver-manager.executereadwritecommand.php 18-Jun-2024 14:06               12513
mongodb-driver-manager.executewritecommand.php     18-Jun-2024 14:06               12745
mongodb-driver-manager.getencryptedfieldsmap.php   18-Jun-2024 14:06                4319
mongodb-driver-manager.getreadconcern.php          18-Jun-2024 14:06                6286
mongodb-driver-manager.getreadpreference.php       18-Jun-2024 14:06                7112
mongodb-driver-manager.getservers.php              18-Jun-2024 14:06                8689
mongodb-driver-manager.getwriteconcern.php         18-Jun-2024 14:06                6340
mongodb-driver-manager.removesubscriber.php        18-Jun-2024 14:06                5801
mongodb-driver-manager.selectserver.php            18-Jun-2024 14:06                8444
mongodb-driver-manager.startsession.php            18-Jun-2024 14:06               14475> 18-Jun-2024 14:06                4067> 18-Jun-2024 14:06                4027> 18-Jun-2024 14:06                4282> 18-Jun-2024 14:06                4028> 18-Jun-2024 14:06                5765> 18-Jun-2024 14:06                4547> 18-Jun-2024 14:06                4805> 18-Jun-2024 14:06                4649> 18-Jun-2024 14:06                4496> 18-Jun-2024 14:06                4302
mongodb-driver-monitoring-commandstartedevent.g..> 18-Jun-2024 14:06                4501
mongodb-driver-monitoring-commandstartedevent.g..> 18-Jun-2024 14:06                4103
mongodb-driver-monitoring-commandstartedevent.g..> 18-Jun-2024 14:06                4037
mongodb-driver-monitoring-commandstartedevent.g..> 18-Jun-2024 14:06                6130
mongodb-driver-monitoring-commandstartedevent.g..> 18-Jun-2024 14:06                5320
mongodb-driver-monitoring-commandstartedevent.g..> 18-Jun-2024 14:06                4985
mongodb-driver-monitoring-commandstartedevent.g..> 18-Jun-2024 14:06                4521
mongodb-driver-monitoring-commandstartedevent.g..> 18-Jun-2024 14:06                4322> 18-Jun-2024 14:06                5508> 18-Jun-2024 14:06                5561> 18-Jun-2024 14:06                5565
mongodb-driver-monitoring-commandsucceededevent..> 18-Jun-2024 14:06                4124
mongodb-driver-monitoring-commandsucceededevent..> 18-Jun-2024 14:06                4084
mongodb-driver-monitoring-commandsucceededevent..> 18-Jun-2024 14:06                4351
mongodb-driver-monitoring-commandsucceededevent..> 18-Jun-2024 14:06                5852
mongodb-driver-monitoring-commandsucceededevent..> 18-Jun-2024 14:06                4573
mongodb-driver-monitoring-commandsucceededevent..> 18-Jun-2024 14:06                4868
mongodb-driver-monitoring-commandsucceededevent..> 18-Jun-2024 14:06                5230
mongodb-driver-monitoring-commandsucceededevent..> 18-Jun-2024 14:06                4561
mongodb-driver-monitoring-commandsucceededevent..> 18-Jun-2024 14:06                4348
mongodb-driver-monitoring-logsubscriber.log.php    18-Jun-2024 14:06                5166
mongodb-driver-monitoring-sdamsubscriber.server..> 18-Jun-2024 14:06                5291
mongodb-driver-monitoring-sdamsubscriber.server..> 18-Jun-2024 14:06                5249
mongodb-driver-monitoring-sdamsubscriber.server..> 18-Jun-2024 14:06                5912
mongodb-driver-monitoring-sdamsubscriber.server..> 18-Jun-2024 14:06                5996
mongodb-driver-monitoring-sdamsubscriber.server..> 18-Jun-2024 14:06                6019
mongodb-driver-monitoring-sdamsubscriber.server..> 18-Jun-2024 14:06                5283
mongodb-driver-monitoring-sdamsubscriber.topolo..> 18-Jun-2024 14:06                5370
mongodb-driver-monitoring-sdamsubscriber.topolo..> 18-Jun-2024 14:06                5293
mongodb-driver-monitoring-sdamsubscriber.topolo..> 18-Jun-2024 14:06                5280> 18-Jun-2024 14:06                3408> 18-Jun-2024 14:06                3739> 18-Jun-2024 14:06                3522> 18-Jun-2024 14:06                3826> 18-Jun-2024 14:06                3593
mongodb-driver-monitoring-serverclosedevent.get..> 18-Jun-2024 14:06                3370
mongodb-driver-monitoring-serverclosedevent.get..> 18-Jun-2024 14:06                3466
mongodb-driver-monitoring-serverclosedevent.get..> 18-Jun-2024 14:06                3549
mongodb-driver-monitoring-serverheartbeatfailed..> 18-Jun-2024 14:06                4006
mongodb-driver-monitoring-serverheartbeatfailed..> 18-Jun-2024 14:06                3795
mongodb-driver-monitoring-serverheartbeatfailed..> 18-Jun-2024 14:06                3545
mongodb-driver-monitoring-serverheartbeatfailed..> 18-Jun-2024 14:06                3620
mongodb-driver-monitoring-serverheartbeatfailed..> 18-Jun-2024 14:06                4157
mongodb-driver-monitoring-serverheartbeatstarte..> 18-Jun-2024 14:06                3550
mongodb-driver-monitoring-serverheartbeatstarte..> 18-Jun-2024 14:06                3638
mongodb-driver-monitoring-serverheartbeatstarte..> 18-Jun-2024 14:06                4177
mongodb-driver-monitoring-serverheartbeatsuccee..> 18-Jun-2024 14:06                4058
mongodb-driver-monitoring-serverheartbeatsuccee..> 18-Jun-2024 14:06                3617
mongodb-driver-monitoring-serverheartbeatsuccee..> 18-Jun-2024 14:06                3672
mongodb-driver-monitoring-serverheartbeatsuccee..> 18-Jun-2024 14:06                4720
mongodb-driver-monitoring-serverheartbeatsuccee..> 18-Jun-2024 14:06                4182> 18-Jun-2024 14:06                3388> 18-Jun-2024 14:06                3484> 18-Jun-2024 14:06                3474
mongodb-driver-monitoring-topologychangedevent...> 18-Jun-2024 14:06                3812
mongodb-driver-monitoring-topologychangedevent...> 18-Jun-2024 14:06                3900
mongodb-driver-monitoring-topologychangedevent...> 18-Jun-2024 14:06                3580
mongodb-driver-monitoring-topologyclosedevent.g..> 18-Jun-2024 14:06                3525
mongodb-driver-monitoring-topologyopeningevent...> 18-Jun-2024 14:06                3535
mongodb-driver-query.construct.php                 18-Jun-2024 14:06               39227
mongodb-driver-readconcern.bsonserialize.php       18-Jun-2024 14:06                7365
mongodb-driver-readconcern.construct.php           18-Jun-2024 14:06                6303
mongodb-driver-readconcern.getlevel.php            18-Jun-2024 14:06                6130
mongodb-driver-readconcern.isdefault.php           18-Jun-2024 14:06                9117
mongodb-driver-readconcern.serialize.php           18-Jun-2024 14:06                4008
mongodb-driver-readconcern.unserialize.php         18-Jun-2024 14:06                5087
mongodb-driver-readpreference.bsonserialize.php    18-Jun-2024 14:06               11175
mongodb-driver-readpreference.construct.php        18-Jun-2024 14:06               21721
mongodb-driver-readpreference.gethedge.php         18-Jun-2024 14:06                3668
mongodb-driver-readpreference.getmaxstalenessse..> 18-Jun-2024 14:06                8552
mongodb-driver-readpreference.getmode.php          18-Jun-2024 14:06                7887
mongodb-driver-readpreference.getmodestring.php    18-Jun-2024 14:06                8096
mongodb-driver-readpreference.gettagsets.php       18-Jun-2024 14:06                8772
mongodb-driver-readpreference.serialize.php        18-Jun-2024 14:06                4085
mongodb-driver-readpreference.unserialize.php      18-Jun-2024 14:06                5165
mongodb-driver-runtimeexception.haserrorlabel.php  18-Jun-2024 14:06                5037
mongodb-driver-server.construct.php                18-Jun-2024 14:06                3675
mongodb-driver-server.executebulkwrite.php         18-Jun-2024 14:06               14146
mongodb-driver-server.executecommand.php           18-Jun-2024 14:06               15461
mongodb-driver-server.executequery.php             18-Jun-2024 14:06               10106
mongodb-driver-server.executereadcommand.php       18-Jun-2024 14:06               12241
mongodb-driver-server.executereadwritecommand.php  18-Jun-2024 14:06               13202
mongodb-driver-server.executewritecommand.php      18-Jun-2024 14:06               13381
mongodb-driver-server.gethost.php                  18-Jun-2024 14:06                5860
mongodb-driver-server.getinfo.php                  18-Jun-2024 14:06               11548
mongodb-driver-server.getlatency.php               18-Jun-2024 14:06                7878
mongodb-driver-server.getport.php                  18-Jun-2024 14:06                5955
mongodb-driver-server.getserverdescription.php     18-Jun-2024 14:06                3699
mongodb-driver-server.gettags.php                  18-Jun-2024 14:06                4254
mongodb-driver-server.gettype.php                  18-Jun-2024 14:06                4266
mongodb-driver-server.isarbiter.php                18-Jun-2024 14:06                4076
mongodb-driver-server.ishidden.php                 18-Jun-2024 14:06                4067
mongodb-driver-server.ispassive.php                18-Jun-2024 14:06                4174
mongodb-driver-server.isprimary.php                18-Jun-2024 14:06                4083
mongodb-driver-server.issecondary.php              18-Jun-2024 14:06                4157
mongodb-driver-serverapi.bsonserialize.php         18-Jun-2024 14:06                3637
mongodb-driver-serverapi.construct.php             18-Jun-2024 14:06                5840
mongodb-driver-serverapi.serialize.php             18-Jun-2024 14:06                3957
mongodb-driver-serverapi.unserialize.php           18-Jun-2024 14:06                5009
mongodb-driver-serverdescription.gethellorespon..> 18-Jun-2024 14:06                5870
mongodb-driver-serverdescription.gethost.php       18-Jun-2024 14:06                3721
mongodb-driver-serverdescription.getlastupdatet..> 18-Jun-2024 14:06                4202
mongodb-driver-serverdescription.getport.php       18-Jun-2024 14:06                3892
mongodb-driver-serverdescription.getroundtripti..> 18-Jun-2024 14:06                4237
mongodb-driver-serverdescription.gettype.php       18-Jun-2024 14:06                4281
mongodb-driver-session.aborttransaction.php        18-Jun-2024 14:06                4877
mongodb-driver-session.advanceclustertime.php      18-Jun-2024 14:06                5618
mongodb-driver-session.advanceoperationtime.php    18-Jun-2024 14:06                5530
mongodb-driver-session.committransaction.php       18-Jun-2024 14:06                6596
mongodb-driver-session.construct.php               18-Jun-2024 14:06                3147
mongodb-driver-session.endsession.php              18-Jun-2024 14:06                5001
mongodb-driver-session.getclustertime.php          18-Jun-2024 14:06                4426
mongodb-driver-session.getlogicalsessionid.php     18-Jun-2024 14:06                3579
mongodb-driver-session.getoperationtime.php        18-Jun-2024 14:06                4492
mongodb-driver-session.getserver.php               18-Jun-2024 14:06                4629
mongodb-driver-session.gettransactionoptions.php   18-Jun-2024 14:06                4117
mongodb-driver-session.gettransactionstate.php     18-Jun-2024 14:06                4142
mongodb-driver-session.isdirty.php                 18-Jun-2024 14:06                3400
mongodb-driver-session.isintransaction.php         18-Jun-2024 14:06                4248
mongodb-driver-session.starttransaction.php        18-Jun-2024 14:06               10286
mongodb-driver-topologydescription.getservers.php  18-Jun-2024 14:06                3793
mongodb-driver-topologydescription.gettype.php     18-Jun-2024 14:06                3851
mongodb-driver-topologydescription.hasreadables..> 18-Jun-2024 14:06                4482
mongodb-driver-topologydescription.haswritables..> 18-Jun-2024 14:06                3595
mongodb-driver-writeconcern.bsonserialize.php      18-Jun-2024 14:06                7740
mongodb-driver-writeconcern.construct.php          18-Jun-2024 14:06               12402
mongodb-driver-writeconcern.getjournal.php         18-Jun-2024 14:06                6321
mongodb-driver-writeconcern.getw.php               18-Jun-2024 14:06                5611
mongodb-driver-writeconcern.getwtimeout.php        18-Jun-2024 14:06                6407
mongodb-driver-writeconcern.isdefault.php          18-Jun-2024 14:06                9004
mongodb-driver-writeconcern.serialize.php          18-Jun-2024 14:06                4033
mongodb-driver-writeconcern.unserialize.php        18-Jun-2024 14:06                5126
mongodb-driver-writeconcernerror.getcode.php       18-Jun-2024 14:06                6642
mongodb-driver-writeconcernerror.getinfo.php       18-Jun-2024 14:06                7019
mongodb-driver-writeconcernerror.getmessage.php    18-Jun-2024 14:06                6761
mongodb-driver-writeerror.getcode.php              18-Jun-2024 14:06                5942
mongodb-driver-writeerror.getindex.php             18-Jun-2024 14:06                6523
mongodb-driver-writeerror.getinfo.php              18-Jun-2024 14:06                3407
mongodb-driver-writeerror.getmessage.php           18-Jun-2024 14:06                6106
mongodb-driver-writeexception.getwriteresult.php   18-Jun-2024 14:06                8431
mongodb-driver-writeresult.getdeletedcount.php     18-Jun-2024 14:06                8589
mongodb-driver-writeresult.getinsertedcount.php    18-Jun-2024 14:06                8705
mongodb-driver-writeresult.getmatchedcount.php     18-Jun-2024 14:06                9504
mongodb-driver-writeresult.getmodifiedcount.php    18-Jun-2024 14:06                9950
mongodb-driver-writeresult.getserver.php           18-Jun-2024 14:06                6969
mongodb-driver-writeresult.getupsertedcount.php    18-Jun-2024 14:06                8809
mongodb-driver-writeresult.getupsertedids.php      18-Jun-2024 14:06                9371
mongodb-driver-writeresult.getwriteconcernerror..> 18-Jun-2024 14:06                7647
mongodb-driver-writeresult.getwriteerrors.php      18-Jun-2024 14:06               13768
mongodb-driver-writeresult.isacknowledged.php      18-Jun-2024 14:06                8803
mongodb.architecture.php                           18-Jun-2024 14:06                2303
mongodb.configuration.php                          18-Jun-2024 14:06                5042
mongodb.connection-handling.php                    18-Jun-2024 14:06               11513
mongodb.constants.php                              18-Jun-2024 14:06                2479
mongodb.exceptions.php                             18-Jun-2024 14:06                5386
mongodb.exceptions.tree.php                        18-Jun-2024 14:06                5592
mongodb.installation.homebrew.php                  18-Jun-2024 14:06                2596
mongodb.installation.manual.php                    18-Jun-2024 14:06                8072
mongodb.installation.pecl.php                      18-Jun-2024 14:06                6326
mongodb.installation.php                           18-Jun-2024 14:06                2088                   18-Jun-2024 14:06                5598
mongodb.monitoring.php                             18-Jun-2024 14:06               22373
mongodb.overview.php                               18-Jun-2024 14:06                5912
mongodb.persistence.deserialization.php            18-Jun-2024 14:06               25438
mongodb.persistence.php                            18-Jun-2024 14:06                2153
mongodb.persistence.serialization.php              18-Jun-2024 14:06               22342
mongodb.requirements.php                           18-Jun-2024 14:06                4356