Index of /php/manual/pt_BR/


../
feeds/                                             03-Dec-2023 00:02                   -
images/                                            03-Dec-2023 00:02                   -
styles/                                            03-Dec-2023 00:01                   -
toc/                                               03-Dec-2023 00:02                   -
about.formats.php                                  03-Dec-2023 00:02                4274
about.generate.php                                 03-Dec-2023 00:02                2709
about.howtohelp.php                                03-Dec-2023 00:02                3555
about.more.php                                     03-Dec-2023 00:02                1903
about.notes.php                                    03-Dec-2023 00:02                2482
about.php                                          03-Dec-2023 00:02                1923
about.phpversions.php                              03-Dec-2023 00:02                3510
about.prototypes.php                               03-Dec-2023 00:02                7435
about.translations.php                             03-Dec-2023 00:02                3209
aliases.php                                        03-Dec-2023 00:02               29197
allowdynamicproperties.construct.php               03-Dec-2023 00:02                2249
apache.configuration.php                           03-Dec-2023 00:02                5022
apache.constants.php                               03-Dec-2023 00:02                1160
apache.installation.php                            03-Dec-2023 00:02                1310
apache.requirements.php                            03-Dec-2023 00:02                1257
apache.resources.php                               03-Dec-2023 00:02                1250
apache.setup.php                                   03-Dec-2023 00:02                1653
apcu.configuration.php                             03-Dec-2023 00:02               14884
apcu.constants.php                                 03-Dec-2023 00:02                5291
apcu.installation.php                              03-Dec-2023 00:02                3273
apcu.requirements.php                              03-Dec-2023 00:02                1240
apcu.resources.php                                 03-Dec-2023 00:02                1233
apcu.setup.php                                     03-Dec-2023 00:02                1608
apcuiterator.construct.php                         03-Dec-2023 00:02                6319
apcuiterator.current.php                           03-Dec-2023 00:02                2971
apcuiterator.gettotalcount.php                     03-Dec-2023 00:02                3119
apcuiterator.gettotalhits.php                      03-Dec-2023 00:02                3203
apcuiterator.gettotalsize.php                      03-Dec-2023 00:02                2996
apcuiterator.key.php                               03-Dec-2023 00:02                2667
apcuiterator.next.php                              03-Dec-2023 00:02                2907
apcuiterator.rewind.php                            03-Dec-2023 00:02                2685
apcuiterator.valid.php                             03-Dec-2023 00:02                2788
appendices.php                                     03-Dec-2023 00:02               13274
appenditerator.append.php                          03-Dec-2023 00:02                5356
appenditerator.construct.php                       03-Dec-2023 00:02                9911
appenditerator.current.php                         03-Dec-2023 00:02                3478
appenditerator.getarrayiterator.php                03-Dec-2023 00:02                3056
appenditerator.getiteratorindex.php                03-Dec-2023 00:02                6403
appenditerator.key.php                             03-Dec-2023 00:02                7844
appenditerator.next.php                            03-Dec-2023 00:02                3369
appenditerator.rewind.php                          03-Dec-2023 00:02                3364
appenditerator.valid.php                           03-Dec-2023 00:02                3200
array.configuration.php                            03-Dec-2023 00:02                1305
array.constants.php                                03-Dec-2023 00:02                8585
array.installation.php                             03-Dec-2023 00:02                1286
array.requirements.php                             03-Dec-2023 00:02                1250
array.resources.php                                03-Dec-2023 00:02                1243
array.setup.php                                    03-Dec-2023 00:02                1620
array.sorting.php                                  03-Dec-2023 00:02                6873
arrayaccess.offsetexists.php                       03-Dec-2023 00:02                8855
arrayaccess.offsetget.php                          03-Dec-2023 00:02                5008
arrayaccess.offsetset.php                          03-Dec-2023 00:02                5175
arrayaccess.offsetunset.php                        03-Dec-2023 00:02                2825
arrayiterator.append.php                           03-Dec-2023 00:02                3480
arrayiterator.asort.php                            03-Dec-2023 00:02                6574
arrayiterator.construct.php                        03-Dec-2023 00:02                3523
arrayiterator.count.php                            03-Dec-2023 00:02                2926
arrayiterator.current.php                          03-Dec-2023 00:02                5069
arrayiterator.getarraycopy.php                     03-Dec-2023 00:02                2883
arrayiterator.getflags.php                         03-Dec-2023 00:02                3071
arrayiterator.key.php                              03-Dec-2023 00:02                3780
arrayiterator.ksort.php                            03-Dec-2023 00:02                6520
arrayiterator.natcasesort.php                      03-Dec-2023 00:02                4600
arrayiterator.natsort.php                          03-Dec-2023 00:02                4375
arrayiterator.next.php                             03-Dec-2023 00:02                4559
arrayiterator.offsetexists.php                     03-Dec-2023 00:02                3183
arrayiterator.offsetget.php                        03-Dec-2023 00:02                3429
arrayiterator.offsetset.php                        03-Dec-2023 00:02                3676
arrayiterator.offsetunset.php                      03-Dec-2023 00:02                3771
arrayiterator.rewind.php                           03-Dec-2023 00:02                4560
arrayiterator.seek.php                             03-Dec-2023 00:02                2528
arrayiterator.serialize.php                        03-Dec-2023 00:02                2794
arrayiterator.setflags.php                         03-Dec-2023 00:02                4086
arrayiterator.uasort.php                           03-Dec-2023 00:02                6202
arrayiterator.uksort.php                           03-Dec-2023 00:02                5950
arrayiterator.unserialize.php                      03-Dec-2023 00:02                3018
arrayiterator.valid.php                            03-Dec-2023 00:02                4446
arrayobject.append.php                             03-Dec-2023 00:02                5433
arrayobject.asort.php                              03-Dec-2023 00:02                9429
arrayobject.construct.php                          03-Dec-2023 00:02                5794
arrayobject.count.php                              03-Dec-2023 00:02                5255
arrayobject.exchangearray.php                      03-Dec-2023 00:02                5890
arrayobject.getarraycopy.php                       03-Dec-2023 00:02                5149
arrayobject.getflags.php                           03-Dec-2023 00:02                5991
arrayobject.getiterator.php                        03-Dec-2023 00:02                5200
arrayobject.getiteratorclass.php                   03-Dec-2023 00:02                6450
arrayobject.ksort.php                              03-Dec-2023 00:02                9081
arrayobject.natcasesort.php                        03-Dec-2023 00:02                8102
arrayobject.natsort.php                            03-Dec-2023 00:02                7792
arrayobject.offsetexists.php                       03-Dec-2023 00:02                4763
arrayobject.offsetget.php                          03-Dec-2023 00:02                5050
arrayobject.offsetset.php                          03-Dec-2023 00:02                6768
arrayobject.offsetunset.php                        03-Dec-2023 00:02                4206
arrayobject.serialize.php                          03-Dec-2023 00:02                5018
arrayobject.setflags.php                           03-Dec-2023 00:02                6548
arrayobject.setiteratorclass.php                   03-Dec-2023 00:02                5691
arrayobject.uasort.php                             03-Dec-2023 00:02               10670
arrayobject.uksort.php                             03-Dec-2023 00:02               10069
arrayobject.unserialize.php                        03-Dec-2023 00:02                3487
attribute.construct.php                            03-Dec-2023 00:02                2271
backedenum.from.php                                03-Dec-2023 00:02                6018
backedenum.tryfrom.php                             03-Dec-2023 00:02                6321
bc.configuration.php                               03-Dec-2023 00:02                2489
bc.constants.php                                   03-Dec-2023 00:02                1134
bc.installation.php                                03-Dec-2023 00:02                1483
bc.requirements.php                                03-Dec-2023 00:02                1229
bc.resources.php                                   03-Dec-2023 00:02                1222
bc.setup.php                                       03-Dec-2023 00:02                1611
book.apache.php                                    03-Dec-2023 00:02                3583
book.apcu.php                                      03-Dec-2023 00:02                4457
book.array.php                                     03-Dec-2023 00:02               12967
book.bc.php                                        03-Dec-2023 00:02                3335
book.bson.php                                      03-Dec-2023 00:02               24535
book.bzip2.php                                     03-Dec-2023 00:02                3024
book.calendar.php                                  03-Dec-2023 00:02                4472
book.classobj.php                                  03-Dec-2023 00:02                4548
book.cmark.php                                     03-Dec-2023 00:02                8763
book.com.php                                       03-Dec-2023 00:02                8012
book.componere.php                                 03-Dec-2023 00:02                6215
book.ctype.php                                     03-Dec-2023 00:02                3451
book.cubrid.php                                    03-Dec-2023 00:02               13913
book.curl.php                                      03-Dec-2023 00:02                7745
book.datetime.php                                  03-Dec-2023 00:02               18263
book.dba.php                                       03-Dec-2023 00:02                3516
book.dbase.php                                     03-Dec-2023 00:02                3475
book.dio.php                                       03-Dec-2023 00:02                3053
book.dir.php                                       03-Dec-2023 00:02                3337
book.dom.php                                       03-Dec-2023 00:02               20981
book.ds.php                                        03-Dec-2023 00:02               25168
book.eio.php                                       03-Dec-2023 00:02                8034
book.enchant.php                                   03-Dec-2023 00:02                5478
book.errorfunc.php                                 03-Dec-2023 00:02                3612
book.ev.php                                        03-Dec-2023 00:02               13444
book.event.php                                     03-Dec-2023 00:02               23139
book.exec.php                                      03-Dec-2023 00:02                3358
book.exif.php                                      03-Dec-2023 00:02                2608
book.expect.php                                    03-Dec-2023 00:02                2569
book.fann.php                                      03-Dec-2023 00:02               23194
book.fdf.php                                       03-Dec-2023 00:02                5706
book.ffi.php                                       03-Dec-2023 00:02                5711
book.fileinfo.php                                  03-Dec-2023 00:02                3293
book.filesystem.php                                03-Dec-2023 00:02               11013
book.filter.php                                    03-Dec-2023 00:02                3596
book.fpm.php                                       03-Dec-2023 00:02                2008
book.ftp.php                                       03-Dec-2023 00:02                6117
book.funchand.php                                  03-Dec-2023 00:02                3871
book.gearman.php                                   03-Dec-2023 00:02               14866
book.gender.php                                    03-Dec-2023 00:02                2618
book.geoip.php                                     03-Dec-2023 00:02                4460
book.gettext.php                                   03-Dec-2023 00:02                3077
book.gmagick.php                                   03-Dec-2023 00:02               22662
book.gmp.php                                       03-Dec-2023 00:02                6492
book.gnupg.php                                     03-Dec-2023 00:02                4949
book.hash.php                                      03-Dec-2023 00:02                4263
book.hrtime.php                                    03-Dec-2023 00:02                3542
book.ibase.php                                     03-Dec-2023 00:02               12966
book.ibm-db2.php                                   03-Dec-2023 00:02                8706
book.iconv.php                                     03-Dec-2023 00:02                3595
book.igbinary.php                                  03-Dec-2023 00:02                2213
book.image.php                                     03-Dec-2023 00:02               15608
book.imagick.php                                   03-Dec-2023 00:02               63832
book.imap.php                                      03-Dec-2023 00:02               10392
book.info.php                                      03-Dec-2023 00:02                8504
book.inotify.php                                   03-Dec-2023 00:02                2655
book.intl.php                                      03-Dec-2023 00:02               45781
book.json.php                                      03-Dec-2023 00:02                2961
book.ldap.php                                      03-Dec-2023 00:02                9026
book.libxml.php                                    03-Dec-2023 00:02                3299
book.lua.php                                       03-Dec-2023 00:02                2839
book.luasandbox.php                                03-Dec-2023 00:02                5630
book.lzf.php                                       03-Dec-2023 00:02                2289
book.mail.php                                      03-Dec-2023 00:02                2177
book.mailparse.php                                 03-Dec-2023 00:02                3994
book.math.php                                      03-Dec-2023 00:02                5659
book.mbstring.php                                  03-Dec-2023 00:02                9874
book.mcrypt.php                                    03-Dec-2023 00:02                6472
book.memcache.php                                  03-Dec-2023 00:02                4298
book.memcached.php                                 03-Dec-2023 00:02                8828
book.mhash.php                                     03-Dec-2023 00:02                2571
book.misc.php                                      03-Dec-2023 00:02                5338
book.mongodb.php                                   03-Dec-2023 00:02               26803
book.mqseries.php                                  03-Dec-2023 00:02                3256
book.mysql-xdevapi.php                             03-Dec-2023 00:02               29051
book.mysql.php                                     03-Dec-2023 00:02                8256
book.mysqli.php                                    03-Dec-2023 00:02               19248
book.mysqlnd.php                                   03-Dec-2023 00:02                2470
book.network.php                                   03-Dec-2023 00:02                6066
book.oauth.php                                     03-Dec-2023 00:02                7251
book.oci8.php                                      03-Dec-2023 00:02               17416
book.opcache.php                                   03-Dec-2023 00:02                2846
book.openal.php                                    03-Dec-2023 00:02                4539
book.openssl.php                                   03-Dec-2023 00:02               10977
book.outcontrol.php                                03-Dec-2023 00:02                4218
book.parallel.php                                  03-Dec-2023 00:02                5723
book.parle.php                                     03-Dec-2023 00:02                9298
book.password.php                                  03-Dec-2023 00:02                2702
book.pcntl.php                                     03-Dec-2023 00:02                5143
book.pcre.php                                      03-Dec-2023 00:02                3888
book.pdo.php                                       03-Dec-2023 00:02                8108
book.pgsql.php                                     03-Dec-2023 00:02               12163
book.phar.php                                      03-Dec-2023 00:02               15775
book.phpdbg.php                                    03-Dec-2023 00:02                3179
book.posix.php                                     03-Dec-2023 00:02                6822
book.ps.php                                        03-Dec-2023 00:02                9263
book.pspell.php                                    03-Dec-2023 00:02                4528
book.pthreads.php                                  03-Dec-2023 00:02                5523
book.quickhash.php                                 03-Dec-2023 00:02                8980
book.radius.php                                    03-Dec-2023 00:02                5644
book.random.php                                    03-Dec-2023 00:02                9150
book.rar.php                                       03-Dec-2023 00:02                5335
book.readline.php                                  03-Dec-2023 00:02                3864
book.recode.php                                    03-Dec-2023 00:02                2383
book.reflection.php                                03-Dec-2023 00:02               32894
book.rnp.php                                       03-Dec-2023 00:02                6128
book.rpminfo.php                                   03-Dec-2023 00:02                2569
book.rrd.php                                       03-Dec-2023 00:02                5177
book.runkit7.php                                   03-Dec-2023 00:02                4295
book.scoutapm.php                                  03-Dec-2023 00:02                2269
book.seaslog.php                                   03-Dec-2023 00:02                5273
book.sem.php                                       03-Dec-2023 00:02                4233
book.session.php                                   03-Dec-2023 00:02                8653
book.shmop.php                                     03-Dec-2023 00:02                2904
book.simdjson.php                                  03-Dec-2023 00:02                2709
book.simplexml.php                                 03-Dec-2023 00:02                5705
book.snmp.php                                      03-Dec-2023 00:02                5927
book.soap.php                                      03-Dec-2023 00:02                6167
book.sockets.php                                   03-Dec-2023 00:02                7165
book.sodium.php                                    03-Dec-2023 00:02               17396
book.solr.php                                      03-Dec-2023 00:02               53300
book.spl.php                                       03-Dec-2023 00:02               10152
book.sqlite3.php                                   03-Dec-2023 00:02                7035
book.sqlsrv.php                                    03-Dec-2023 00:02                5397
book.ssdeep.php                                    03-Dec-2023 00:02                2394
book.ssh2.php                                      03-Dec-2023 00:02                5527
book.stats.php                                     03-Dec-2023 00:02               11890
book.stomp.php                                     03-Dec-2023 00:02                4204
book.stream.php                                    03-Dec-2023 00:02               12520
book.strings.php                                   03-Dec-2023 00:02               13641
book.svm.php                                       03-Dec-2023 00:02                3727
book.svn.php                                       03-Dec-2023 00:02                7672
book.swoole.php                                    03-Dec-2023 00:02               37443
book.sync.php                                      03-Dec-2023 00:02                4851
book.taint.php                                     03-Dec-2023 00:02                2591
book.tcpwrap.php                                   03-Dec-2023 00:02                2121
book.tidy.php                                      03-Dec-2023 00:02                6656
book.tokenizer.php                                 03-Dec-2023 00:02                2373
book.trader.php                                    03-Dec-2023 00:02               17586
book.ui.php                                        03-Dec-2023 00:02               27966
book.uodbc.php                                     03-Dec-2023 00:02                7343
book.uopz.php                                      03-Dec-2023 00:02                5163
book.url.php                                       03-Dec-2023 00:02                3064
book.v8js.php                                      03-Dec-2023 00:02                3152
book.var.php                                       03-Dec-2023 00:02                6503
book.var_representation.php                        03-Dec-2023 00:02                2188
book.varnish.php                                   03-Dec-2023 00:02                5425
book.wddx.php                                      03-Dec-2023 00:02                2905
book.win32service.php                              03-Dec-2023 00:02                5231
book.wincache.php                                  03-Dec-2023 00:02                5667
book.wkhtmltox.php                                 03-Dec-2023 00:02                3359
book.xattr.php                                     03-Dec-2023 00:02                2525
book.xdiff.php                                     03-Dec-2023 00:02                4208
book.xhprof.php                                    03-Dec-2023 00:02                2512
book.xlswriter.php                                 03-Dec-2023 00:02                4452
book.xml.php                                       03-Dec-2023 00:02                5504
book.xmldiff.php                                   03-Dec-2023 00:02                3150
book.xmlreader.php                                 03-Dec-2023 00:02                4936
book.xmlrpc.php                                    03-Dec-2023 00:02                4008
book.xmlwriter.php                                 03-Dec-2023 00:02                6588
book.xsl.php                                       03-Dec-2023 00:02                3741
book.yac.php                                       03-Dec-2023 00:02                2643
book.yaconf.php                                    03-Dec-2023 00:02                2205
book.yaf.php                                       03-Dec-2023 00:02               34716
book.yaml.php                                      03-Dec-2023 00:02                2842
book.yar.php                                       03-Dec-2023 00:02                3732
book.yaz.php                                       03-Dec-2023 00:02                4421
book.zip.php                                       03-Dec-2023 00:02               10205
book.zlib.php                                      03-Dec-2023 00:02                5229
book.zmq.php                                       03-Dec-2023 00:02                5915
book.zookeeper.php                                 03-Dec-2023 00:02                6721
bzip2.configuration.php                            03-Dec-2023 00:02                1305
bzip2.constants.php                                03-Dec-2023 00:02                1137
bzip2.examples.php                                 03-Dec-2023 00:02                4028
bzip2.installation.php                             03-Dec-2023 00:02                1430
bzip2.requirements.php                             03-Dec-2023 00:02                1413
bzip2.resources.php                                03-Dec-2023 00:02                1329
bzip2.setup.php                                    03-Dec-2023 00:02                1640
cachingiterator.construct.php                      03-Dec-2023 00:02                2729
cachingiterator.count.php                          03-Dec-2023 00:02                2406
cachingiterator.current.php                        03-Dec-2023 00:02                2826
cachingiterator.getcache.php                       03-Dec-2023 00:02                5508
cachingiterator.getflags.php                       03-Dec-2023 00:02                2400
cachingiterator.hasnext.php                        03-Dec-2023 00:02                2417
cachingiterator.key.php                            03-Dec-2023 00:02                2196
cachingiterator.next.php                           03-Dec-2023 00:02                2358
cachingiterator.offsetexists.php                   03-Dec-2023 00:02                2704
cachingiterator.offsetget.php                      03-Dec-2023 00:02                2655
cachingiterator.offsetset.php                      03-Dec-2023 00:02                3005
cachingiterator.offsetunset.php                    03-Dec-2023 00:02                2633
cachingiterator.rewind.php                         03-Dec-2023 00:02                2374
cachingiterator.setflags.php                       03-Dec-2023 00:02                2667
cachingiterator.tostring.php                       03-Dec-2023 00:02                2476
cachingiterator.valid.php                          03-Dec-2023 00:02                2464
calendar.configuration.php                         03-Dec-2023 00:02                1326
calendar.constants.php                             03-Dec-2023 00:02               10739
calendar.installation.php                          03-Dec-2023 00:02                1516
calendar.requirements.php                          03-Dec-2023 00:02                1271
calendar.resources.php                             03-Dec-2023 00:02                1264
calendar.setup.php                                 03-Dec-2023 00:02                1678
callbackfilteriterator.accept.php                  03-Dec-2023 00:02                3312
callbackfilteriterator.construct.php               03-Dec-2023 00:02                3837
cc.license.php                                     03-Dec-2023 00:02               20718
changelog.mysql.php                                03-Dec-2023 00:02                2470
changelog.mysql_xdevapi.php                        03-Dec-2023 00:02                2280
changelog.mysqli.php                               03-Dec-2023 00:02                1292
changelog.strings.php                              03-Dec-2023 00:02                1329
class.addressinfo.php                              03-Dec-2023 00:02                1715
class.allowdynamicproperties.php                   03-Dec-2023 00:02                5014
class.apcuiterator.php                             03-Dec-2023 00:02                6556
class.appenditerator.php                           03-Dec-2023 00:02                7577
class.argumentcounterror.php                       03-Dec-2023 00:02                7596
class.arithmeticerror.php                          03-Dec-2023 00:02                7696
class.arrayaccess.php                              03-Dec-2023 00:02               11859
class.arrayiterator.php                            03-Dec-2023 00:02               15542
class.arrayobject.php                              03-Dec-2023 00:02               14991
class.assertionerror.php                           03-Dec-2023 00:02                7446
class.attribute.php                                03-Dec-2023 00:02                7549
class.backedenum.php                               03-Dec-2023 00:02                4091
class.badfunctioncallexception.php                 03-Dec-2023 00:02                7515
class.badmethodcallexception.php                   03-Dec-2023 00:02                7521
class.cachingiterator.php                          03-Dec-2023 00:02               15547
class.callbackfilteriterator.php                   03-Dec-2023 00:02               11199
class.closure.php                                  03-Dec-2023 00:02                6300
class.collator.php                                 03-Dec-2023 00:02               29801
class.collectable.php                              03-Dec-2023 00:02                2477
class.com-exception.php                            03-Dec-2023 00:02                7308
class.com.php                                      03-Dec-2023 00:02               12006
class.commonmark-cql.php                           03-Dec-2023 00:02                7598
class.commonmark-interfaces-ivisitable.php         03-Dec-2023 00:02                2920
class.commonmark-interfaces-ivisitor.php           03-Dec-2023 00:02                4286
class.commonmark-node-blockquote.php               03-Dec-2023 00:02                8278
class.commonmark-node-bulletlist.php               03-Dec-2023 00:02               10154
class.commonmark-node-code.php                     03-Dec-2023 00:02                9152
class.commonmark-node-codeblock.php                03-Dec-2023 00:02               10349
class.commonmark-node-customblock.php              03-Dec-2023 00:02                8908
class.commonmark-node-custominline.php             03-Dec-2023 00:02                8888
class.commonmark-node-document.php                 03-Dec-2023 00:02                8242
class.commonmark-node-heading.php                  03-Dec-2023 00:02                9510
class.commonmark-node-htmlblock.php                03-Dec-2023 00:02                9210
class.commonmark-node-htmlinline.php               03-Dec-2023 00:02                9186
class.commonmark-node-image.php                    03-Dec-2023 00:02               10234
class.commonmark-node-item.php                     03-Dec-2023 00:02                8245
class.commonmark-node-linebreak.php                03-Dec-2023 00:02                8259
class.commonmark-node-link.php                     03-Dec-2023 00:02               10227
class.commonmark-node-orderedlist.php              03-Dec-2023 00:02               10888
class.commonmark-node-paragraph.php                03-Dec-2023 00:02                8284
class.commonmark-node-softbreak.php                03-Dec-2023 00:02                8277
class.commonmark-node-text-emphasis.php            03-Dec-2023 00:02                8306
class.commonmark-node-text-strong.php              03-Dec-2023 00:02                8295
class.commonmark-node-text.php                     03-Dec-2023 00:02                9544
class.commonmark-node-thematicbreak.php            03-Dec-2023 00:02                8306
class.commonmark-node.php                          03-Dec-2023 00:02                9190
class.commonmark-parser.php                        03-Dec-2023 00:02                3655
class.compersisthelper.php                         03-Dec-2023 00:02                6464
class.compileerror.php                             03-Dec-2023 00:02                7359
class.componere-abstract-definition.php            03-Dec-2023 00:02                4641
class.componere-definition.php                     03-Dec-2023 00:02                9415
class.componere-method.php                         03-Dec-2023 00:02                4389
class.componere-patch.php                          03-Dec-2023 00:02                7801
class.componere-value.php                          03-Dec-2023 00:02                5253
class.countable.php                                03-Dec-2023 00:02                2467
class.curlfile.php                                 03-Dec-2023 00:02                7462
class.curlhandle.php                               03-Dec-2023 00:02                1752
class.curlmultihandle.php                          03-Dec-2023 00:02                1791
class.curlsharehandle.php                          03-Dec-2023 00:02                1787
class.curlstringfile.php                           03-Dec-2023 00:02                5209
class.dateerror.php                                03-Dec-2023 00:02                8039
class.dateexception.php                            03-Dec-2023 00:02                8620
class.dateinterval.php                             03-Dec-2023 00:02               13101
class.dateinvalidoperationexception.php            03-Dec-2023 00:02                8074
class.dateinvalidtimezoneexception.php             03-Dec-2023 00:02                7644
class.datemalformedintervalstringexception.php     03-Dec-2023 00:02                7747
class.datemalformedperiodstringexception.php       03-Dec-2023 00:02                7728
class.datemalformedstringexception.php             03-Dec-2023 00:02                8026
class.dateobjecterror.php                          03-Dec-2023 00:02                7826
class.dateperiod.php                               03-Dec-2023 00:02               20905
class.daterangeerror.php                           03-Dec-2023 00:02                8005
class.datetime.php                                 03-Dec-2023 00:02               21008
class.datetimeimmutable.php                        03-Dec-2023 00:02               21025
class.datetimeinterface.php                        03-Dec-2023 00:02               17698
class.datetimezone.php                             03-Dec-2023 00:02               13250
class.deflatecontext.php                           03-Dec-2023 00:02                1780
class.directory.php                                03-Dec-2023 00:02                5314
class.directoryiterator.php                        03-Dec-2023 00:02               16986
class.divisionbyzeroerror.php                      03-Dec-2023 00:02                7410
class.domainexception.php                          03-Dec-2023 00:02                7436
class.domattr.php                                  03-Dec-2023 00:02               23698
class.domcdatasection.php                          03-Dec-2023 00:02               25879
class.domcharacterdata.php                         03-Dec-2023 00:02               27863
class.domchildnode.php                             03-Dec-2023 00:02                3900
class.domcomment.php                               03-Dec-2023 00:02               25300
class.domdocument.php                              03-Dec-2023 00:02               57919
class.domdocumentfragment.php                      03-Dec-2023 00:02               24438
class.domdocumenttype.php                          03-Dec-2023 00:02               22770
class.domelement.php                               03-Dec-2023 00:02               44586
class.domentity.php                                03-Dec-2023 00:02               23086
class.domentityreference.php                       03-Dec-2023 00:02               19155
class.domexception.php                             03-Dec-2023 00:02                8203
class.domimplementation.php                        03-Dec-2023 00:02                5294
class.domnamednodemap.php                          03-Dec-2023 00:02                6783
class.domnode.php                                  03-Dec-2023 00:02               27860
class.domnodelist.php                              03-Dec-2023 00:02                5714
class.domnotation.php                              03-Dec-2023 00:02               19385
class.domparentnode.php                            03-Dec-2023 00:02                3595
class.domprocessinginstruction.php                 03-Dec-2023 00:02               20514
class.domtext.php                                  03-Dec-2023 00:02               27508
class.domxpath.php                                 03-Dec-2023 00:02                7593
class.dotnet.php                                   03-Dec-2023 00:02                6650
class.ds-collection.php                            03-Dec-2023 00:02                5795
class.ds-deque.php                                 03-Dec-2023 00:02               21449
class.ds-hashable.php                              03-Dec-2023 00:02                3990
class.ds-map.php                                   03-Dec-2023 00:02               22596
class.ds-pair.php                                  03-Dec-2023 00:02                4482
class.ds-priorityqueue.php                         03-Dec-2023 00:02                7942
class.ds-queue.php                                 03-Dec-2023 00:02                7503
class.ds-sequence.php                              03-Dec-2023 00:02               23215
class.ds-set.php                                   03-Dec-2023 00:02               18042
class.ds-stack.php                                 03-Dec-2023 00:02                6942
class.ds-vector.php                                03-Dec-2023 00:02               20983
class.emptyiterator.php                            03-Dec-2023 00:02                3873
class.enchantbroker.php                            03-Dec-2023 00:02                1792
class.enchantdictionary.php                        03-Dec-2023 00:02                1782
class.error.php                                    03-Dec-2023 00:02                9818
class.errorexception.php                           03-Dec-2023 00:02               12923
class.ev.php                                       03-Dec-2023 00:02               37643
class.evcheck.php                                  03-Dec-2023 00:02               10073
class.evchild.php                                  03-Dec-2023 00:02               11491
class.evembed.php                                  03-Dec-2023 00:02                9276
class.event.php                                    03-Dec-2023 00:02               17074
class.eventbase.php                                03-Dec-2023 00:02               13313
class.eventbuffer.php                              03-Dec-2023 00:02               20273
class.eventbufferevent.php                         03-Dec-2023 00:02               33489
class.eventconfig.php                              03-Dec-2023 00:02                6870
class.eventdnsbase.php                             03-Dec-2023 00:02               10211
class.eventhttp.php                                03-Dec-2023 00:02                8523
class.eventhttpconnection.php                      03-Dec-2023 00:02                9495
class.eventhttprequest.php                         03-Dec-2023 00:02               19894
class.eventlistener.php                            03-Dec-2023 00:02               11645
class.eventsslcontext.php                          03-Dec-2023 00:02               16534
class.eventutil.php                                03-Dec-2023 00:02               22370
class.evfork.php                                   03-Dec-2023 00:02                8235
class.evidle.php                                   03-Dec-2023 00:02                9216
class.evio.php                                     03-Dec-2023 00:02               11909
class.evloop.php                                   03-Dec-2023 00:02               29070
class.evperiodic.php                               03-Dec-2023 00:02               13889
class.evprepare.php                                03-Dec-2023 00:02               10221
class.evsignal.php                                 03-Dec-2023 00:02               10932
class.evstat.php                                   03-Dec-2023 00:02               13269
class.evtimer.php                                  03-Dec-2023 00:02               13334
class.evwatcher.php                                03-Dec-2023 00:02                9179
class.exception.php                                03-Dec-2023 00:02               10120
class.fannconnection.php                           03-Dec-2023 00:02                6124
class.ffi-cdata.php                                03-Dec-2023 00:02                5416
class.ffi-ctype.php                                03-Dec-2023 00:02               25789
class.ffi-exception.php                            03-Dec-2023 00:02                7133
class.ffi-parserexception.php                      03-Dec-2023 00:02                7188
class.ffi.php                                      03-Dec-2023 00:02               18367
class.fiber.php                                    03-Dec-2023 00:02                7745
class.fibererror.php                               03-Dec-2023 00:02                7306
class.filesystemiterator.php                       03-Dec-2023 00:02               26588
class.filteriterator.php                           03-Dec-2023 00:02                7149
class.finfo.php                                    03-Dec-2023 00:02                5047
class.gdfont.php                                   03-Dec-2023 00:02                1679
class.gdimage.php                                  03-Dec-2023 00:02                1675
class.gearmanclient.php                            03-Dec-2023 00:02               30703
class.gearmanexception.php                         03-Dec-2023 00:02                6332
class.gearmanjob.php                               03-Dec-2023 00:02                7933
class.gearmantask.php                              03-Dec-2023 00:02                7779
class.gearmanworker.php                            03-Dec-2023 00:02               11357
class.gender.php                                   03-Dec-2023 00:02               33048
class.generator.php                                03-Dec-2023 00:02                6662
class.globiterator.php                             03-Dec-2023 00:02               22275
class.gmagick.php                                  03-Dec-2023 00:02               75837
class.gmagickdraw.php                              03-Dec-2023 00:02               21496
class.gmagickpixel.php                             03-Dec-2023 00:02                5298
class.hashcontext.php                              03-Dec-2023 00:02                3171
class.hrtime-performancecounter.php                03-Dec-2023 00:02                3560
class.hrtime-stopwatch.php                         03-Dec-2023 00:02                6318
class.hrtime-unit.php                              03-Dec-2023 00:02                3914
class.imagick.php                                  03-Dec-2023 00:02              241067
class.imagickdraw.php                              03-Dec-2023 00:02               66535
class.imagickkernel.php                            03-Dec-2023 00:02                5905
class.imagickpixel.php                             03-Dec-2023 00:02               11530
class.imagickpixeliterator.php                     03-Dec-2023 00:02                8535
class.imap-connection.php                          03-Dec-2023 00:02                1757
class.infiniteiterator.php                         03-Dec-2023 00:02                5148
class.inflatecontext.php                           03-Dec-2023 00:02                1776
class.internaliterator.php                         03-Dec-2023 00:02                4771
class.intlbreakiterator.php                        03-Dec-2023 00:02               25563
class.intlcalendar.php                             03-Dec-2023 00:02               59902
class.intlchar.php                                 03-Dec-2023 00:02              373992
class.intlcodepointbreakiterator.php               03-Dec-2023 00:02               18088
class.intldateformatter.php                        03-Dec-2023 00:02               26373
class.intldatepatterngenerator.php                 03-Dec-2023 00:02                4224
class.intlexception.php                            03-Dec-2023 00:02                7544
class.intlgregoriancalendar.php                    03-Dec-2023 00:02               42963
class.intliterator.php                             03-Dec-2023 00:02                5085
class.intlpartsiterator.php                        03-Dec-2023 00:02                6685
class.intlrulebasedbreakiterator.php               03-Dec-2023 00:02               20536
class.intltimezone.php                             03-Dec-2023 00:02               23515
class.invalidargumentexception.php                 03-Dec-2023 00:02                7459
class.iterator.php                                 03-Dec-2023 00:02               11359
class.iteratoraggregate.php                        03-Dec-2023 00:02                6126
class.iteratoriterator.php                         03-Dec-2023 00:02                6022
class.jsonserializable.php                         03-Dec-2023 00:02                2821
class.ldap-connection.php                          03-Dec-2023 00:02                1777
class.ldap-result-entry.php                        03-Dec-2023 00:02                1792
class.ldap-result.php                              03-Dec-2023 00:02                1769
class.lengthexception.php                          03-Dec-2023 00:02                7385
class.libxmlerror.php                              03-Dec-2023 00:02                5189
class.limititerator.php                            03-Dec-2023 00:02                9625
class.locale.php                                   03-Dec-2023 00:02               23367
class.logicexception.php                           03-Dec-2023 00:02                7445
class.lua.php                                      03-Dec-2023 00:02                7331
class.luaclosure.php                               03-Dec-2023 00:02                2917
class.luasandbox.php                               03-Dec-2023 00:02               12447
class.luasandboxerror.php                          03-Dec-2023 00:02                8711
class.luasandboxerrorerror.php                     03-Dec-2023 00:02                6745
class.luasandboxfatalerror.php                     03-Dec-2023 00:02                6867
class.luasandboxfunction.php                       03-Dec-2023 00:02                3664
class.luasandboxmemoryerror.php                    03-Dec-2023 00:02                7073
class.luasandboxruntimeerror.php                   03-Dec-2023 00:02                6887
class.luasandboxsyntaxerror.php                    03-Dec-2023 00:02                6749
class.luasandboxtimeouterror.php                   03-Dec-2023 00:02                7057
class.memcache.php                                 03-Dec-2023 00:02               15436
class.memcached.php                                03-Dec-2023 00:02               38516
class.memcachedexception.php                       03-Dec-2023 00:02                6633
class.messageformatter.php                         03-Dec-2023 00:02               10648
class.mongodb-bson-binary.php                      03-Dec-2023 00:02               14604
class.mongodb-bson-binaryinterface.php             03-Dec-2023 00:02                4554
class.mongodb-bson-dbpointer.php                   03-Dec-2023 00:02                5843
class.mongodb-bson-decimal128.php                  03-Dec-2023 00:02                7493
class.mongodb-bson-decimal128interface.php         03-Dec-2023 00:02                3799
class.mongodb-bson-document.php                    03-Dec-2023 00:02               10324
class.mongodb-bson-int64.php                       03-Dec-2023 00:02                7195
class.mongodb-bson-iterator.php                    03-Dec-2023 00:02                4780
class.mongodb-bson-javascript.php                  03-Dec-2023 00:02                8109
class.mongodb-bson-javascriptinterface.php         03-Dec-2023 00:02                4726
class.mongodb-bson-maxkey.php                      03-Dec-2023 00:02                5729
class.mongodb-bson-maxkeyinterface.php             03-Dec-2023 00:02                2189
class.mongodb-bson-minkey.php                      03-Dec-2023 00:02                5720
class.mongodb-bson-minkeyinterface.php             03-Dec-2023 00:02                2170
class.mongodb-bson-objectid.php                    03-Dec-2023 00:02                8835
class.mongodb-bson-objectidinterface.php           03-Dec-2023 00:02                4231
class.mongodb-bson-packedarray.php                 03-Dec-2023 00:02                8414
class.mongodb-bson-persistable.php                 03-Dec-2023 00:02                5920
class.mongodb-bson-regex.php                       03-Dec-2023 00:02                7761
class.mongodb-bson-regexinterface.php              03-Dec-2023 00:02                4571
class.mongodb-bson-serializable.php                03-Dec-2023 00:02                4190
class.mongodb-bson-symbol.php                      03-Dec-2023 00:02                5731
class.mongodb-bson-timestamp.php                   03-Dec-2023 00:02                8016
class.mongodb-bson-timestampinterface.php          03-Dec-2023 00:02                4733
class.mongodb-bson-type.php                        03-Dec-2023 00:02                2017
class.mongodb-bson-undefined.php                   03-Dec-2023 00:02                5819
class.mongodb-bson-unserializable.php              03-Dec-2023 00:02                3908
class.mongodb-bson-utcdatetime.php                 03-Dec-2023 00:02                7570
class.mongodb-bson-utcdatetimeinterface.php        03-Dec-2023 00:02                4362
class.mongodb-driver-bulkwrite.php                 03-Dec-2023 00:02               23206
class.mongodb-driver-clientencryption.php          03-Dec-2023 00:02               19762
class.mongodb-driver-command.php                   03-Dec-2023 00:02               13945
class.mongodb-driver-cursor.php                    03-Dec-2023 00:02               25282
class.mongodb-driver-cursorid.php                  03-Dec-2023 00:02                5321
class.mongodb-driver-cursorinterface.php           03-Dec-2023 00:02                6010
class.mongodb-driver-exception-authenticationex..> 03-Dec-2023 00:02                8122
class.mongodb-driver-exception-bulkwriteexcepti..> 03-Dec-2023 00:02                8976
class.mongodb-driver-exception-commandexception..> 03-Dec-2023 00:02                9756
class.mongodb-driver-exception-connectionexcept..> 03-Dec-2023 00:02                8191
class.mongodb-driver-exception-connectiontimeou..> 03-Dec-2023 00:02                8579
class.mongodb-driver-exception-encryptionexcept..> 03-Dec-2023 00:02                8125
class.mongodb-driver-exception-exception.php       03-Dec-2023 00:02                2184
class.mongodb-driver-exception-executiontimeout..> 03-Dec-2023 00:02                9229
class.mongodb-driver-exception-invalidargumente..> 03-Dec-2023 00:02                7328
class.mongodb-driver-exception-logicexception.php  03-Dec-2023 00:02                7212
class.mongodb-driver-exception-runtimeexception..> 03-Dec-2023 00:02               10624
class.mongodb-driver-exception-serverexception.php 03-Dec-2023 00:02                8202
class.mongodb-driver-exception-sslconnectionexc..> 03-Dec-2023 00:02                8467
class.mongodb-driver-exception-unexpectedvaluee..> 03-Dec-2023 00:02                7345
class.mongodb-driver-exception-writeexception.php  03-Dec-2023 00:02               11142
class.mongodb-driver-manager.php                   03-Dec-2023 00:02               19536
class.mongodb-driver-monitoring-commandfailedev..> 03-Dec-2023 00:02                7571
class.mongodb-driver-monitoring-commandstartede..> 03-Dec-2023 00:02                7073
class.mongodb-driver-monitoring-commandsubscrib..> 03-Dec-2023 00:02                6222
class.mongodb-driver-monitoring-commandsucceede..> 03-Dec-2023 00:02                7153
class.mongodb-driver-monitoring-logsubscriber.php  03-Dec-2023 00:02                8812
class.mongodb-driver-monitoring-sdamsubscriber.php 03-Dec-2023 00:02               11422
class.mongodb-driver-monitoring-serverchangedev..> 03-Dec-2023 00:02                5615
class.mongodb-driver-monitoring-serverclosedeve..> 03-Dec-2023 00:02                4262
class.mongodb-driver-monitoring-serverheartbeat..> 03-Dec-2023 00:02                5496
class.mongodb-driver-monitoring-serverheartbeat..> 03-Dec-2023 00:02                4381
class.mongodb-driver-monitoring-serverheartbeat..> 03-Dec-2023 00:02                5508
class.mongodb-driver-monitoring-serveropeningev..> 03-Dec-2023 00:02                4282
class.mongodb-driver-monitoring-subscriber.php     03-Dec-2023 00:02                2632
class.mongodb-driver-monitoring-topologychanged..> 03-Dec-2023 00:02                4728
class.mongodb-driver-monitoring-topologyclosede..> 03-Dec-2023 00:02                3339
class.mongodb-driver-monitoring-topologyopening..> 03-Dec-2023 00:02                3353
class.mongodb-driver-query.php                     03-Dec-2023 00:02                3155
class.mongodb-driver-readconcern.php               03-Dec-2023 00:02               16070
class.mongodb-driver-readpreference.php            03-Dec-2023 00:02               18246
class.mongodb-driver-server.php                    03-Dec-2023 00:02               23602
class.mongodb-driver-serverapi.php                 03-Dec-2023 00:02               13435
class.mongodb-driver-serverdescription.php         03-Dec-2023 00:02               14733
class.mongodb-driver-session.php                   03-Dec-2023 00:02               13754
class.mongodb-driver-topologydescription.php       03-Dec-2023 00:02               10237
class.mongodb-driver-writeconcern.php              03-Dec-2023 00:02                9177
class.mongodb-driver-writeconcernerror.php         03-Dec-2023 00:02                4137
class.mongodb-driver-writeerror.php                03-Dec-2023 00:02                4403
class.mongodb-driver-writeresult.php               03-Dec-2023 00:02                7872
class.multipleiterator.php                         03-Dec-2023 00:02               10149
class.mysql-xdevapi-baseresult.php                 03-Dec-2023 00:02                2920
class.mysql-xdevapi-client.php                     03-Dec-2023 00:02                3059
class.mysql-xdevapi-collection.php                 03-Dec-2023 00:02                9975
class.mysql-xdevapi-collectionadd.php              03-Dec-2023 00:02                2937
class.mysql-xdevapi-collectionfind.php             03-Dec-2023 00:02                8295
class.mysql-xdevapi-collectionmodify.php           03-Dec-2023 00:02                9452
class.mysql-xdevapi-collectionremove.php           03-Dec-2023 00:02                5035
class.mysql-xdevapi-columnresult.php               03-Dec-2023 00:02                6051
class.mysql-xdevapi-crudoperationbindable.php      03-Dec-2023 00:02                2915
class.mysql-xdevapi-crudoperationlimitable.php     03-Dec-2023 00:02                2921
class.mysql-xdevapi-crudoperationskippable.php     03-Dec-2023 00:02                2932
class.mysql-xdevapi-crudoperationsortable.php      03-Dec-2023 00:02                2906
class.mysql-xdevapi-databaseobject.php             03-Dec-2023 00:02                3418
class.mysql-xdevapi-docresult.php                  03-Dec-2023 00:02                3807
class.mysql-xdevapi-exception.php                  03-Dec-2023 00:02                2200
class.mysql-xdevapi-executable.php                 03-Dec-2023 00:02                2615
class.mysql-xdevapi-executionstatus.php            03-Dec-2023 00:02                4873
class.mysql-xdevapi-expression.php                 03-Dec-2023 00:02                3194
class.mysql-xdevapi-result.php                     03-Dec-2023 00:02                4133
class.mysql-xdevapi-rowresult.php                  03-Dec-2023 00:02                4730
class.mysql-xdevapi-schema.php                     03-Dec-2023 00:02                7202
class.mysql-xdevapi-schemaobject.php               03-Dec-2023 00:02                2800
class.mysql-xdevapi-session.php                    03-Dec-2023 00:02                8529
class.mysql-xdevapi-sqlstatement.php               03-Dec-2023 00:02                6243
class.mysql-xdevapi-sqlstatementresult.php         03-Dec-2023 00:02                6677
class.mysql-xdevapi-statement.php                  03-Dec-2023 00:02                4669
class.mysql-xdevapi-table.php                      03-Dec-2023 00:02                7355
class.mysql-xdevapi-tabledelete.php                03-Dec-2023 00:02                4940
class.mysql-xdevapi-tableinsert.php                03-Dec-2023 00:02                3439
class.mysql-xdevapi-tableselect.php                03-Dec-2023 00:02                8034
class.mysql-xdevapi-tableupdate.php                03-Dec-2023 00:02                5897
class.mysql-xdevapi-warning.php                    03-Dec-2023 00:02                3757
class.mysqli-driver.php                            03-Dec-2023 00:02                7549
class.mysqli-result.php                            03-Dec-2023 00:02               11701
class.mysqli-sql-exception.php                     03-Dec-2023 00:02                8875
class.mysqli-stmt.php                              03-Dec-2023 00:02               14703
class.mysqli-warning.php                           03-Dec-2023 00:02                4169
class.mysqli.php                                   03-Dec-2023 00:02               36729
class.norewinditerator.php                         03-Dec-2023 00:02                6583
class.normalizer.php                               03-Dec-2023 00:02               11917
class.numberformatter.php                          03-Dec-2023 00:02               60646
class.oauth.php                                    03-Dec-2023 00:02               17242
class.oauthexception.php                           03-Dec-2023 00:02                7684
class.oauthprovider.php                            03-Dec-2023 00:02               11599
class.ocicollection.php                            03-Dec-2023 00:02                5862
class.ocilob.php                                   03-Dec-2023 00:02               12086
class.opensslasymmetrickey.php                     03-Dec-2023 00:02                1855
class.opensslcertificate.php                       03-Dec-2023 00:02                1859
class.opensslcertificatesigningrequest.php         03-Dec-2023 00:02                1946
class.outeriterator.php                            03-Dec-2023 00:02                4222
class.outofboundsexception.php                     03-Dec-2023 00:02                7494
class.outofrangeexception.php                      03-Dec-2023 00:02                7496
class.overflowexception.php                        03-Dec-2023 00:02                7415
class.parallel-channel.php                         03-Dec-2023 00:02                8029
class.parallel-events-event-type.php               03-Dec-2023 00:02                3360
class.parallel-events-event.php                    03-Dec-2023 00:02                3335
class.parallel-events-input.php                    03-Dec-2023 00:02                4583
class.parallel-events.php                          03-Dec-2023 00:02                6700
class.parallel-future.php                          03-Dec-2023 00:02                7630
class.parallel-runtime.php                         03-Dec-2023 00:02                6171
class.parallel-sync.php                            03-Dec-2023 00:02                5252
class.parentiterator.php                           03-Dec-2023 00:02                8110
class.parle-errorinfo.php                          03-Dec-2023 00:02                3734
class.parle-lexer.php                              03-Dec-2023 00:02               11802
class.parle-lexerexception.php                     03-Dec-2023 00:02                6882
class.parle-parser.php                             03-Dec-2023 00:02               15521
class.parle-parserexception.php                    03-Dec-2023 00:02                6864
class.parle-rlexer.php                             03-Dec-2023 00:02               13443
class.parle-rparser.php                            03-Dec-2023 00:02               15678
class.parle-stack.php                              03-Dec-2023 00:02                4682
class.parle-token.php                              03-Dec-2023 00:02                4453
class.parseerror.php                               03-Dec-2023 00:02                7891
class.pdo.php                                      03-Dec-2023 00:02               34144
class.pdoexception.php                             03-Dec-2023 00:02                9166
class.pdostatement.php                             03-Dec-2023 00:02               16892
class.phar.php                                     03-Dec-2023 00:02               58730
class.phardata.php                                 03-Dec-2023 00:02               38814
class.pharexception.php                            03-Dec-2023 00:02                7373
class.pharfileinfo.php                             03-Dec-2023 00:02               18179
class.php-user-filter.php                          03-Dec-2023 00:02                6007
class.pool.php                                     03-Dec-2023 00:02                7194
class.pspell-config.php                            03-Dec-2023 00:02                1776
class.pspell-dictionary.php                        03-Dec-2023 00:02                1813
class.quickhashinthash.php                         03-Dec-2023 00:02               12957
class.quickhashintset.php                          03-Dec-2023 00:02               11153
class.quickhashintstringhash.php                   03-Dec-2023 00:02               13771
class.quickhashstringinthash.php                   03-Dec-2023 00:02               11886
class.random-brokenrandomengineerror.php           03-Dec-2023 00:02                7471
class.random-cryptosafeengine.php                  03-Dec-2023 00:02                2398
class.random-engine-mt19937.php                    03-Dec-2023 00:02                4831
class.random-engine-pcgoneseq128xslrr64.php        03-Dec-2023 00:02                5594
class.random-engine-secure.php                     03-Dec-2023 00:02                3328
class.random-engine-xoshiro256starstar.php         03-Dec-2023 00:02                5812
class.random-engine.php                            03-Dec-2023 00:02                3683
class.random-randomerror.php                       03-Dec-2023 00:02                7395
class.random-randomexception.php                   03-Dec-2023 00:02                7509
class.random-randomizer.php                        03-Dec-2023 00:02                9215
class.rangeexception.php                           03-Dec-2023 00:02                7624
class.rararchive.php                               03-Dec-2023 00:02                6977
class.rarentry.php                                 03-Dec-2023 00:02               41877
class.rarexception.php                             03-Dec-2023 00:02                7632
class.recursivearrayiterator.php                   03-Dec-2023 00:02               14375
class.recursivecachingiterator.php                 03-Dec-2023 00:02               12419
class.recursivecallbackfilteriterator.php          03-Dec-2023 00:02               12831
class.recursivedirectoryiterator.php               03-Dec-2023 00:02               23891
class.recursivefilteriterator.php                  03-Dec-2023 00:02                7928
class.recursiveiterator.php                        03-Dec-2023 00:02                4701
class.recursiveiteratoriterator.php                03-Dec-2023 00:02               11211
class.recursiveregexiterator.php                   03-Dec-2023 00:02               13258
class.recursivetreeiterator.php                    03-Dec-2023 00:02               20558
class.reflection.php                               03-Dec-2023 00:02                3214
class.reflectionclass.php                          03-Dec-2023 00:02               30917
class.reflectionclassconstant.php                  03-Dec-2023 00:02               14433
class.reflectionexception.php                      03-Dec-2023 00:02                6660
class.reflectionextension.php                      03-Dec-2023 00:02                8751
class.reflectionfunction.php                       03-Dec-2023 00:02               18240
class.reflectionfunctionabstract.php               03-Dec-2023 00:02               17590
class.reflectiongenerator.php                      03-Dec-2023 00:02                5967
class.reflectionmethod.php                         03-Dec-2023 00:02               28208
class.reflectionnamedtype.php                      03-Dec-2023 00:02                3273
class.reflectionobject.php                         03-Dec-2023 00:02               24052
class.reflectionparameter.php                      03-Dec-2023 00:02               14598
class.reflectionproperty.php                       03-Dec-2023 00:02               19506
class.reflectionreference.php                      03-Dec-2023 00:02                3812
class.reflectiontype.php                           03-Dec-2023 00:02                4350
class.reflectionuniontype.php                      03-Dec-2023 00:02                3130
class.reflectionzendextension.php                  03-Dec-2023 00:02                7152
class.reflector.php                                03-Dec-2023 00:02                3811
class.regexiterator.php                            03-Dec-2023 00:02               15706
class.resourcebundle.php                           03-Dec-2023 00:02                9374
class.returntypewillchange.php                     03-Dec-2023 00:02                3246
class.rnpffi.php                                   03-Dec-2023 00:02                1633
class.rrdcreator.php                               03-Dec-2023 00:02                4062
class.rrdgraph.php                                 03-Dec-2023 00:02                3632
class.rrdupdater.php                               03-Dec-2023 00:02                3040
class.runtimeexception.php                         03-Dec-2023 00:02                7402
class.seaslog.php                                  03-Dec-2023 00:02               17919
class.seekableiterator.php                         03-Dec-2023 00:02               11147
class.sensitiveparameter.php                       03-Dec-2023 00:02                6380
class.sensitiveparametervalue.php                  03-Dec-2023 00:02                5040
class.serializable.php                             03-Dec-2023 00:02                7930
class.sessionhandler.php                           03-Dec-2023 00:02               24630
class.sessionhandlerinterface.php                  03-Dec-2023 00:02               14997
class.sessionidinterface.php                       03-Dec-2023 00:02                3082
class.sessionupdatetimestamphandlerinterface.php   03-Dec-2023 00:02                4090
class.simdjsonexception.php                        03-Dec-2023 00:02                4654
class.simdjsonvalueerror.php                       03-Dec-2023 00:02                7460
class.simplexmlelement.php                         03-Dec-2023 00:02               13401
class.simplexmliterator.php                        03-Dec-2023 00:02                6686
class.snmp.php                                     03-Dec-2023 00:02               23805
class.snmpexception.php                            03-Dec-2023 00:02                7982
class.soapclient.php                               03-Dec-2023 00:02               29625
class.soapfault.php                                03-Dec-2023 00:02               12645
class.soapheader.php                               03-Dec-2023 00:02                5520
class.soapparam.php                                03-Dec-2023 00:02                3661
class.soapserver.php                               03-Dec-2023 00:02                8810
class.soapvar.php                                  03-Dec-2023 00:02                6977
class.socket.php                                   03-Dec-2023 00:02                1738
class.sodiumexception.php                          03-Dec-2023 00:02                7333
class.solrclient.php                               03-Dec-2023 00:02               21168
class.solrclientexception.php                      03-Dec-2023 00:02                8524
class.solrcollapsefunction.php                     03-Dec-2023 00:02               10466
class.solrdismaxquery.php                          03-Dec-2023 00:02               94862
class.solrdocument.php                             03-Dec-2023 00:02               20124
class.solrdocumentfield.php                        03-Dec-2023 00:02                4453
class.solrexception.php                            03-Dec-2023 00:02                8982
class.solrgenericresponse.php                      03-Dec-2023 00:02               10969
class.solrillegalargumentexception.php             03-Dec-2023 00:02                8648
class.solrillegaloperationexception.php            03-Dec-2023 00:02                8686
class.solrinputdocument.php                        03-Dec-2023 00:02               16641
class.solrmissingmandatoryparameterexception.php   03-Dec-2023 00:02                7897
class.solrmodifiableparams.php                     03-Dec-2023 00:02                7962
class.solrobject.php                               03-Dec-2023 00:02                5381
class.solrparams.php                               03-Dec-2023 00:02                8144
class.solrpingresponse.php                         03-Dec-2023 00:02               10138
class.solrquery.php                                03-Dec-2023 00:02              104116
class.solrqueryresponse.php                        03-Dec-2023 00:02               10896
class.solrresponse.php                             03-Dec-2023 00:02               12815
class.solrserverexception.php                      03-Dec-2023 00:02                8530
class.solrupdateresponse.php                       03-Dec-2023 00:02               10940
class.solrutils.php                                03-Dec-2023 00:02                4463
class.spldoublylinkedlist.php                      03-Dec-2023 00:02               16139
class.splfileinfo.php                              03-Dec-2023 00:02               15445
class.splfileobject.php                            03-Dec-2023 00:02               30404
class.splfixedarray.php                            03-Dec-2023 00:02               18736
class.splheap.php                                  03-Dec-2023 00:02                7484
class.splmaxheap.php                               03-Dec-2023 00:02                6945
class.splminheap.php                               03-Dec-2023 00:02                6955
class.splobjectstorage.php                         03-Dec-2023 00:02               19643
class.splobserver.php                              03-Dec-2023 00:02                2758
class.splpriorityqueue.php                         03-Dec-2023 00:02               10987
class.splqueue.php                                 03-Dec-2023 00:02               16133
class.splstack.php                                 03-Dec-2023 00:02               13301
class.splsubject.php                               03-Dec-2023 00:02                3577
class.spltempfileobject.php                        03-Dec-2023 00:02               25551
class.spoofchecker.php                             03-Dec-2023 00:02               13361
class.sqlite3.php                                  03-Dec-2023 00:02               32880
class.sqlite3result.php                            03-Dec-2023 00:02                5111
class.sqlite3stmt.php                              03-Dec-2023 00:02                7165
class.stdclass.php                                 03-Dec-2023 00:02                6674
class.stomp.php                                    03-Dec-2023 00:02               17018
class.stompexception.php                           03-Dec-2023 00:02                5271
class.stompframe.php                               03-Dec-2023 00:02                4092
class.streamwrapper.php                            03-Dec-2023 00:02               17481
class.stringable.php                               03-Dec-2023 00:02                8162
class.svm.php                                      03-Dec-2023 00:02               15582
class.svmmodel.php                                 03-Dec-2023 00:02                6068
class.swoole-async.php                             03-Dec-2023 00:02                7085
class.swoole-atomic.php                            03-Dec-2023 00:02                4430
class.swoole-buffer.php                            03-Dec-2023 00:02                6542
class.swoole-channel.php                           03-Dec-2023 00:02                3747
class.swoole-client.php                            03-Dec-2023 00:02               14285
class.swoole-connection-iterator.php               03-Dec-2023 00:02                7070
class.swoole-coroutine.php                         03-Dec-2023 00:02               20068
class.swoole-event.php                             03-Dec-2023 00:02                6632
class.swoole-exception.php                         03-Dec-2023 00:02                4169
class.swoole-http-client.php                       03-Dec-2023 00:02               12929
class.swoole-http-request.php                      03-Dec-2023 00:02                2888
class.swoole-http-response.php                     03-Dec-2023 00:02                9496
class.swoole-http-server.php                       03-Dec-2023 00:02               21582
class.swoole-lock.php                              03-Dec-2023 00:02                4468
class.swoole-mmap.php                              03-Dec-2023 00:02                2876
class.swoole-mysql-exception.php                   03-Dec-2023 00:02                4210
class.swoole-mysql.php                             03-Dec-2023 00:02                5153
class.swoole-process.php                           03-Dec-2023 00:02               11888
class.swoole-redis-server.php                      03-Dec-2023 00:02               26103
class.swoole-serialize.php                         03-Dec-2023 00:02                3387
class.swoole-server.php                            03-Dec-2023 00:02               24793
class.swoole-table.php                             03-Dec-2023 00:02               10985
class.swoole-timer.php                             03-Dec-2023 00:02                4513
class.swoole-websocket-frame.php                   03-Dec-2023 00:02                1898
class.swoole-websocket-server.php                  03-Dec-2023 00:02                7020
class.syncevent.php                                03-Dec-2023 00:02                4320
class.syncmutex.php                                03-Dec-2023 00:02                3822
class.syncreaderwriter.php                         03-Dec-2023 00:02                4676
class.syncsemaphore.php                            03-Dec-2023 00:02                4132
class.syncsharedmemory.php                         03-Dec-2023 00:02                4975
class.sysvmessagequeue.php                         03-Dec-2023 00:02                1784
class.sysvsemaphore.php                            03-Dec-2023 00:02                1769
class.sysvsharedmemory.php                         03-Dec-2023 00:02                1787
class.thread.php                                   03-Dec-2023 00:02               10148
class.threaded.php                                 03-Dec-2023 00:02                8048
class.throwable.php                                03-Dec-2023 00:02                6733
class.tidy.php                                     03-Dec-2023 00:02               14783
class.tidynode.php                                 03-Dec-2023 00:02               10396
class.transliterator.php                           03-Dec-2023 00:02                8894
class.traversable.php                              03-Dec-2023 00:02                4380
class.typeerror.php                                03-Dec-2023 00:02                8429
class.uconverter.php                               03-Dec-2023 00:02               32609
class.ui-area.php                                  03-Dec-2023 00:02               11127
class.ui-control.php                               03-Dec-2023 00:02                5240
class.ui-controls-box.php                          03-Dec-2023 00:02                9145
class.ui-controls-button.php                       03-Dec-2023 00:02                6261
class.ui-controls-check.php                        03-Dec-2023 00:02                6987
class.ui-controls-colorbutton.php                  03-Dec-2023 00:02                6297
class.ui-controls-combo.php                        03-Dec-2023 00:02                6233
class.ui-controls-editablecombo.php                03-Dec-2023 00:02                6341
class.ui-controls-entry.php                        03-Dec-2023 00:02                8716
class.ui-controls-form.php                         03-Dec-2023 00:02                7351
class.ui-controls-grid.php                         03-Dec-2023 00:02               11306
class.ui-controls-group.php                        03-Dec-2023 00:02                7825
class.ui-controls-label.php                        03-Dec-2023 00:02                6012
class.ui-controls-multilineentry.php               03-Dec-2023 00:02                8999
class.ui-controls-picker.php                       03-Dec-2023 00:02                6882
class.ui-controls-progress.php                     03-Dec-2023 00:02                5577
class.ui-controls-radio.php                        03-Dec-2023 00:02                6212
class.ui-controls-separator.php                    03-Dec-2023 00:02                6500
class.ui-controls-slider.php                       03-Dec-2023 00:02                6544
class.ui-controls-spin.php                         03-Dec-2023 00:02                6414
class.ui-controls-tab.php                          03-Dec-2023 00:02                8276
class.ui-draw-brush-gradient.php                   03-Dec-2023 00:02                6355
class.ui-draw-brush-lineargradient.php             03-Dec-2023 00:02                5715
class.ui-draw-brush-radialgradient.php             03-Dec-2023 00:02                5843
class.ui-draw-brush.php                            03-Dec-2023 00:02                4210
class.ui-draw-color.php                            03-Dec-2023 00:02                7742
class.ui-draw-line-cap.php                         03-Dec-2023 00:02                2436
class.ui-draw-line-join.php                        03-Dec-2023 00:02                2400
class.ui-draw-matrix.php                           03-Dec-2023 00:02                5449
class.ui-draw-path.php                             03-Dec-2023 00:02                9475
class.ui-draw-pen.php                              03-Dec-2023 00:02                7957
class.ui-draw-stroke.php                           03-Dec-2023 00:02                6128
class.ui-draw-text-font-descriptor.php             03-Dec-2023 00:02                5402
class.ui-draw-text-font-italic.php                 03-Dec-2023 00:02                2626
class.ui-draw-text-font-stretch.php                03-Dec-2023 00:02                4029
class.ui-draw-text-font-weight.php                 03-Dec-2023 00:02                4008
class.ui-draw-text-font.php                        03-Dec-2023 00:02                4525
class.ui-draw-text-layout.php                      03-Dec-2023 00:02                4759
class.ui-exception-invalidargumentexception.php    03-Dec-2023 00:02                6898
class.ui-exception-runtimeexception.php            03-Dec-2023 00:02                6821
class.ui-executor.php                              03-Dec-2023 00:02                4860
class.ui-key.php                                   03-Dec-2023 00:02                9168
class.ui-menu.php                                  03-Dec-2023 00:02                5754
class.ui-menuitem.php                              03-Dec-2023 00:02                3586
class.ui-point.php                                 03-Dec-2023 00:02                5864
class.ui-size.php                                  03-Dec-2023 00:02                5948
class.ui-window.php                                03-Dec-2023 00:02               11833
class.underflowexception.php                       03-Dec-2023 00:02                7486
class.unexpectedvalueexception.php                 03-Dec-2023 00:02                7661
class.unhandledmatcherror.php                      03-Dec-2023 00:02                7533
class.unitenum.php                                 03-Dec-2023 00:02                2745
class.v8js.php                                     03-Dec-2023 00:02                7779
class.v8jsexception.php                            03-Dec-2023 00:02               10225
class.valueerror.php                               03-Dec-2023 00:02                7468
class.variant.php                                  03-Dec-2023 00:02                5374
class.varnishadmin.php                             03-Dec-2023 00:02                9914
class.varnishlog.php                               03-Dec-2023 00:02               28044
class.varnishstat.php                              03-Dec-2023 00:02                2837
class.volatile.php                                 03-Dec-2023 00:02               10931
class.vtiful-kernel-excel.php                      03-Dec-2023 00:02               10270
class.vtiful-kernel-format.php                     03-Dec-2023 00:02               13172
class.weakmap.php                                  03-Dec-2023 00:02                8863
class.weakreference.php                            03-Dec-2023 00:02                5449
class.win32serviceexception.php                    03-Dec-2023 00:02                6946
class.wkhtmltox-image-converter.php                03-Dec-2023 00:02                3809
class.wkhtmltox-pdf-converter.php                  03-Dec-2023 00:02                4200
class.wkhtmltox-pdf-object.php                     03-Dec-2023 00:02                2823
class.worker.php                                   03-Dec-2023 00:02                7673
class.xmldiff-base.php                             03-Dec-2023 00:02                4263
class.xmldiff-dom.php                              03-Dec-2023 00:02                5266
class.xmldiff-file.php                             03-Dec-2023 00:02                4882
class.xmldiff-memory.php                           03-Dec-2023 00:02                4914
class.xmlreader.php                                03-Dec-2023 00:02               32184
class.xmlwriter.php                                03-Dec-2023 00:02               25032
class.xsltprocessor.php                            03-Dec-2023 00:02                5079
class.yac.php                                      03-Dec-2023 00:02                8400
class.yaconf.php                                   03-Dec-2023 00:02                3344
class.yaf-action-abstract.php                      03-Dec-2023 00:02               11589
class.yaf-application.php                          03-Dec-2023 00:02               12392
class.yaf-bootstrap-abstract.php                   03-Dec-2023 00:02                5503
class.yaf-config-abstract.php                      03-Dec-2023 00:02                5084
class.yaf-config-ini.php                           03-Dec-2023 00:02               16534
class.yaf-config-simple.php                        03-Dec-2023 00:02               12028
class.yaf-controller-abstract.php                  03-Dec-2023 00:02               18037
class.yaf-dispatcher.php                           03-Dec-2023 00:02               19383
class.yaf-exception-dispatchfailed.php             03-Dec-2023 00:02                2584
class.yaf-exception-loadfailed-action.php          03-Dec-2023 00:02                2655
class.yaf-exception-loadfailed-controller.php      03-Dec-2023 00:02                2680
class.yaf-exception-loadfailed-module.php          03-Dec-2023 00:02                2644
class.yaf-exception-loadfailed-view.php            03-Dec-2023 00:02                2584
class.yaf-exception-loadfailed.php                 03-Dec-2023 00:02                2558
class.yaf-exception-routerfailed.php               03-Dec-2023 00:02                2569
class.yaf-exception-startuperror.php               03-Dec-2023 00:02                2567
class.yaf-exception-typeerror.php                  03-Dec-2023 00:02                2538
class.yaf-exception.php                            03-Dec-2023 00:02                7566
class.yaf-loader.php                               03-Dec-2023 00:02               17786
class.yaf-plugin-abstract.php                      03-Dec-2023 00:02               15815
class.yaf-registry.php                             03-Dec-2023 00:02                5589
class.yaf-request-abstract.php                     03-Dec-2023 00:02               21269
class.yaf-request-http.php                         03-Dec-2023 00:02               20519
class.yaf-request-simple.php                       03-Dec-2023 00:02               19755
class.yaf-response-abstract.php                    03-Dec-2023 00:02               10526
class.yaf-route-interface.php                      03-Dec-2023 00:02                3452
class.yaf-route-map.php                            03-Dec-2023 00:02                6060
class.yaf-route-regex.php                          03-Dec-2023 00:02                7546
class.yaf-route-rewrite.php                        03-Dec-2023 00:02                6821
class.yaf-route-simple.php                         03-Dec-2023 00:02                6077
class.yaf-route-static.php                         03-Dec-2023 00:02                4687
class.yaf-route-supervar.php                       03-Dec-2023 00:02                4407
class.yaf-router.php                               03-Dec-2023 00:02               11679
class.yaf-session.php                              03-Dec-2023 00:02               11439
class.yaf-view-interface.php                       03-Dec-2023 00:02                5372
class.yaf-view-simple.php                          03-Dec-2023 00:02                9922
class.yar-client-exception.php                     03-Dec-2023 00:02                6041
class.yar-client.php                               03-Dec-2023 00:02                5496
class.yar-concurrent-client.php                    03-Dec-2023 00:02                6185
class.yar-server-exception.php                     03-Dec-2023 00:02                6501
class.yar-server.php                               03-Dec-2023 00:02                3322
class.ziparchive.php                               03-Dec-2023 00:02               70063
class.zmq.php                                      03-Dec-2023 00:02               33755
class.zmqcontext.php                               03-Dec-2023 00:02                5153
class.zmqdevice.php                                03-Dec-2023 00:02                6989
class.zmqpoll.php                                  03-Dec-2023 00:02                4765
class.zmqsocket.php                                03-Dec-2023 00:02               10135
class.zookeeper.php                                03-Dec-2023 00:02               46850
class.zookeeperauthenticationexception.php         03-Dec-2023 00:02                6828
class.zookeeperconfig.php                          03-Dec-2023 00:02                5420
class.zookeeperconnectionexception.php             03-Dec-2023 00:02                6823
class.zookeeperexception.php                       03-Dec-2023 00:02                6689
class.zookeepermarshallingexception.php            03-Dec-2023 00:02                6844
class.zookeepernonodeexception.php                 03-Dec-2023 00:02                6811
class.zookeeperoperationtimeoutexception.php       03-Dec-2023 00:02                6854
class.zookeepersessionexception.php                03-Dec-2023 00:02                6782
classobj.configuration.php                         03-Dec-2023 00:02                1326
classobj.constants.php                             03-Dec-2023 00:02                1168
classobj.examples.php                              03-Dec-2023 00:02               13458
classobj.installation.php                          03-Dec-2023 00:02                1307
classobj.requirements.php                          03-Dec-2023 00:02                1271
classobj.resources.php                             03-Dec-2023 00:02                1264
classobj.setup.php                                 03-Dec-2023 00:02                1665
closure.bind.php                                   03-Dec-2023 00:02                7481
closure.bindto.php                                 03-Dec-2023 00:02                8884
closure.call.php                                   03-Dec-2023 00:02                6256
closure.construct.php                              03-Dec-2023 00:02                2426
closure.fromcallable.php                           03-Dec-2023 00:02                3815
cmark.installation.php                             03-Dec-2023 00:02                1983
cmark.requirements.php                             03-Dec-2023 00:02                1343
cmark.setup.php                                    03-Dec-2023 00:02                1456
collator.asort.php                                 03-Dec-2023 00:02                8781
collator.compare.php                               03-Dec-2023 00:02                9978
collator.construct.php                             03-Dec-2023 00:02                5505
collator.create.php                                03-Dec-2023 00:02                5215
collator.getattribute.php                          03-Dec-2023 00:02                5751
collator.geterrorcode.php                          03-Dec-2023 00:02                5027
collator.geterrormessage.php                       03-Dec-2023 00:02                5094
collator.getlocale.php                             03-Dec-2023 00:02                6344
collator.getsortkey.php                            03-Dec-2023 00:02                6509
collator.getstrength.php                           03-Dec-2023 00:02                4721
collator.setattribute.php                          03-Dec-2023 00:02                6245
collator.setstrength.php                           03-Dec-2023 00:02               12505
collator.sort.php                                  03-Dec-2023 00:02                7591
collator.sortwithsortkeys.php                      03-Dec-2023 00:02                6177
collectable.isgarbage.php                          03-Dec-2023 00:02                3222
com.configuration.php                              03-Dec-2023 00:02                7775
com.constants.php                                  03-Dec-2023 00:02               18688
com.construct.php                                  03-Dec-2023 00:02                8039
com.error-handling.php                             03-Dec-2023 00:02                1566
com.examples.arrays.php                            03-Dec-2023 00:02                2056
com.examples.foreach.php                           03-Dec-2023 00:02                2839
com.examples.php                                   03-Dec-2023 00:02                1393
com.installation.php                               03-Dec-2023 00:02                1551
com.requirements.php                               03-Dec-2023 00:02                1303
com.resources.php                                  03-Dec-2023 00:02                1226
com.setup.php                                      03-Dec-2023 00:02                1612
commonmark-cql.construct.php                       03-Dec-2023 00:02                2125
commonmark-cql.invoke.php                          03-Dec-2023 00:02                3754
commonmark-interfaces-ivisitable.accept.php        03-Dec-2023 00:02                3108
commonmark-interfaces-ivisitor.enter.php           03-Dec-2023 00:02                4109
commonmark-interfaces-ivisitor.leave.php           03-Dec-2023 00:02                4111
commonmark-node-bulletlist.construct.php           03-Dec-2023 00:02                2985
commonmark-node-codeblock.construct.php            03-Dec-2023 00:02                2697
commonmark-node-heading.construct.php              03-Dec-2023 00:02                2542
commonmark-node-image.construct.php                03-Dec-2023 00:02                3080
commonmark-node-link.construct.php                 03-Dec-2023 00:02                3077
commonmark-node-orderedlist.construct.php          03-Dec-2023 00:02                3801
commonmark-node-text.construct.php                 03-Dec-2023 00:02                2581
commonmark-node.accept.php                         03-Dec-2023 00:02                2848
commonmark-node.appendchild.php                    03-Dec-2023 00:02                2683
commonmark-node.insertafter.php                    03-Dec-2023 00:02                2708
commonmark-node.insertbefore.php                   03-Dec-2023 00:02                2706
commonmark-node.prependchild.php                   03-Dec-2023 00:02                2710
commonmark-node.replace.php                        03-Dec-2023 00:02                2654
commonmark-node.unlink.php                         03-Dec-2023 00:02                2327
commonmark-parser.construct.php                    03-Dec-2023 00:02                3233
commonmark-parser.finish.php                       03-Dec-2023 00:02                2382
commonmark-parser.parse.php                        03-Dec-2023 00:02                2528
compersisthelper.construct.php                     03-Dec-2023 00:02                3460
compersisthelper.getcurfilename.php                03-Dec-2023 00:02                3011
compersisthelper.getmaxstreamsize.php              03-Dec-2023 00:02                3045
compersisthelper.initnew.php                       03-Dec-2023 00:02                2891
compersisthelper.loadfromfile.php                  03-Dec-2023 00:02                3993
compersisthelper.loadfromstream.php                03-Dec-2023 00:02                3260
compersisthelper.savetofile.php                    03-Dec-2023 00:02                5810
compersisthelper.savetostream.php                  03-Dec-2023 00:02                3287
componere-abstract-definition.addinterface.php     03-Dec-2023 00:02                3248
componere-abstract-definition.addmethod.php        03-Dec-2023 00:02                4014
componere-abstract-definition.addtrait.php         03-Dec-2023 00:02                3200
componere-abstract-definition.getreflector.php     03-Dec-2023 00:02                2363
componere-definition.addconstant.php               03-Dec-2023 00:02                4298
componere-definition.addproperty.php               03-Dec-2023 00:02                3709
componere-definition.construct.php                 03-Dec-2023 00:02                5451
componere-definition.getclosure.php                03-Dec-2023 00:02                3374
componere-definition.getclosures.php               03-Dec-2023 00:02                2623
componere-definition.isregistered.php              03-Dec-2023 00:02                2186
componere-definition.register.php                  03-Dec-2023 00:02                2403
componere-method.construct.php                     03-Dec-2023 00:02                2181
componere-method.getreflector.php                  03-Dec-2023 00:02                2166
componere-method.setprivate.php                    03-Dec-2023 00:02                2426
componere-method.setprotected.php                  03-Dec-2023 00:02                2441
componere-method.setstatic.php                     03-Dec-2023 00:02                2024
componere-patch.apply.php                          03-Dec-2023 00:02                1825
componere-patch.construct.php                      03-Dec-2023 00:02                3417
componere-patch.derive.php                         03-Dec-2023 00:02                3159
componere-patch.getclosure.php                     03-Dec-2023 00:02                2968
componere-patch.getclosures.php                    03-Dec-2023 00:02                2108
componere-patch.isapplied.php                      03-Dec-2023 00:02                1745
componere-patch.revert.php                         03-Dec-2023 00:02                1822
componere-value.construct.php                      03-Dec-2023 00:02                2613
componere-value.hasdefault.php                     03-Dec-2023 00:02                1804
componere-value.isprivate.php                      03-Dec-2023 00:02                1810
componere-value.isprotected.php                    03-Dec-2023 00:02                1820
componere-value.isstatic.php                       03-Dec-2023 00:02                1804
componere-value.setprivate.php                     03-Dec-2023 00:02                2448
componere-value.setprotected.php                   03-Dec-2023 00:02                2462
componere-value.setstatic.php                      03-Dec-2023 00:02                2040
componere.cast.php                                 03-Dec-2023 00:02                4889
componere.cast_by_ref.php                          03-Dec-2023 00:02                5055
componere.installation.php                         03-Dec-2023 00:02                1354
componere.requirements.php                         03-Dec-2023 00:02                1233
componere.setup.php                                03-Dec-2023 00:02                1495
configuration.changes.modes.php                    03-Dec-2023 00:02                3789
configuration.changes.php                          03-Dec-2023 00:02                8812
configuration.file.per-user.php                    03-Dec-2023 00:02                3193
configuration.file.php                             03-Dec-2023 00:02               10195
configuration.php                                  03-Dec-2023 00:02                1766
configure.about.php                                03-Dec-2023 00:02               12868
configure.php                                      03-Dec-2023 00:02                1440
context.ftp.php                                    03-Dec-2023 00:02                4206
context.http.php                                   03-Dec-2023 00:02               15333
context.params.php                                 03-Dec-2023 00:02                2544
context.phar.php                                   03-Dec-2023 00:02                2869
context.php                                        03-Dec-2023 00:02                3212
context.socket.php                                 03-Dec-2023 00:02                9516
context.ssl.php                                    03-Dec-2023 00:02               11224
context.zip.php                                    03-Dec-2023 00:02                4306
context.zlib.php                                   03-Dec-2023 00:02                2518
control-structures.alternative-syntax.php          03-Dec-2023 00:02                6758
control-structures.break.php                       03-Dec-2023 00:02                4568
control-structures.continue.php                    03-Dec-2023 00:02                7869
control-structures.declare.php                     03-Dec-2023 00:02               10114
control-structures.do.while.php                    03-Dec-2023 00:02                4909
control-structures.else.php                        03-Dec-2023 00:02                4600
control-structures.elseif.php                      03-Dec-2023 00:02                7287
control-structures.for.php                         03-Dec-2023 00:02               11489
control-structures.foreach.php                     03-Dec-2023 00:02               20702
control-structures.goto.php                        03-Dec-2023 00:02                6871
control-structures.if.php                          03-Dec-2023 00:02                4632
control-structures.intro.php                       03-Dec-2023 00:02                2641
control-structures.match.php                       03-Dec-2023 00:02               17939
control-structures.switch.php                      03-Dec-2023 00:02               18737
control-structures.while.php                       03-Dec-2023 00:02                4476
copyright.php                                      03-Dec-2023 00:02                2021
countable.count.php                                03-Dec-2023 00:02                5152
ctype.configuration.php                            03-Dec-2023 00:02                1305
ctype.constants.php                                03-Dec-2023 00:02                1154
ctype.installation.php                             03-Dec-2023 00:02                1548
ctype.requirements.php                             03-Dec-2023 00:02                1282
ctype.resources.php                                03-Dec-2023 00:02                1243
ctype.setup.php                                    03-Dec-2023 00:02                1624
cubrid.configuration.php                           03-Dec-2023 00:02                1251
cubrid.constants.php                               03-Dec-2023 00:02               13792
cubrid.examples.php                                03-Dec-2023 00:02               13809
cubrid.installation.php                            03-Dec-2023 00:02                2133
cubrid.requirements.php                            03-Dec-2023 00:02                1309
cubrid.resources.php                               03-Dec-2023 00:02                3131
cubrid.setup.php                                   03-Dec-2023 00:02                1635
cubridmysql.cubrid.php                             03-Dec-2023 00:02                4899
curl.configuration.php                             03-Dec-2023 00:02                2467
curl.constants.php                                 03-Dec-2023 00:02              120918
curl.examples-basic.php                            03-Dec-2023 00:02                4578
curl.examples.php                                  03-Dec-2023 00:02                1357
curl.installation.php                              03-Dec-2023 00:02                2531
curl.requirements.php                              03-Dec-2023 00:02                1520
curl.resources.php                                 03-Dec-2023 00:02                1418
curl.setup.php                                     03-Dec-2023 00:02                1632
curlfile.construct.php                             03-Dec-2023 00:02               20440
curlfile.getfilename.php                           03-Dec-2023 00:02                2071
curlfile.getmimetype.php                           03-Dec-2023 00:02                2070
curlfile.getpostfilename.php                       03-Dec-2023 00:02                2150
curlfile.setmimetype.php                           03-Dec-2023 00:02                2361
curlfile.setpostfilename.php                       03-Dec-2023 00:02                2421
curlstringfile.construct.php                       03-Dec-2023 00:02                6745
dateinterval.construct.php                         03-Dec-2023 00:02               13468
dateinterval.createfromdatestring.php              03-Dec-2023 00:02               15235
dateinterval.format.php                            03-Dec-2023 00:02               14681
dateperiod.construct.php                           03-Dec-2023 00:02               19220
dateperiod.createfromiso8601string.php             03-Dec-2023 00:02                7696
dateperiod.getdateinterval.php                     03-Dec-2023 00:02                4644
dateperiod.getenddate.php                          03-Dec-2023 00:02                7375
dateperiod.getrecurrences.php                      03-Dec-2023 00:02                8735
dateperiod.getstartdate.php                        03-Dec-2023 00:02                5057
datetime.add.php                                   03-Dec-2023 00:02                4870
datetime.configuration.php                         03-Dec-2023 00:02                5967
datetime.constants.php                             03-Dec-2023 00:02                2562
datetime.construct.php                             03-Dec-2023 00:02                6095
datetime.createfromformat.php                      03-Dec-2023 00:02                6900
datetime.createfromimmutable.php                   03-Dec-2023 00:02                4893
datetime.createfrominterface.php                   03-Dec-2023 00:02                4834
datetime.diff.php                                  03-Dec-2023 00:02               16748
datetime.error.tree.php                            03-Dec-2023 00:02                3272
datetime.examples-arithmetic.php                   03-Dec-2023 00:02               15307
datetime.examples.php                              03-Dec-2023 00:02                1435
datetime.format.php                                03-Dec-2023 00:02               26305
datetime.formats.php                               03-Dec-2023 00:02               55909
datetime.getlasterrors.php                         03-Dec-2023 00:02                1840
datetime.getoffset.php                             03-Dec-2023 00:02                7630
datetime.gettimestamp.php                          03-Dec-2023 00:02                9799
datetime.gettimezone.php                           03-Dec-2023 00:02                7624
datetime.installation.php                          03-Dec-2023 00:02                1706
datetime.modify.php                                03-Dec-2023 00:02               14094
datetime.requirements.php                          03-Dec-2023 00:02                1271
datetime.resources.php                             03-Dec-2023 00:02                1264
datetime.set-state.php                             03-Dec-2023 00:02                2792
datetime.setdate.php                               03-Dec-2023 00:02                5165
datetime.setisodate.php                            03-Dec-2023 00:02                5371
datetime.settime.php                               03-Dec-2023 00:02                6644
datetime.settimestamp.php                          03-Dec-2023 00:02                4844
datetime.settimezone.php                           03-Dec-2023 00:02                9317
datetime.setup.php                                 03-Dec-2023 00:02                1687
datetime.sub.php                                   03-Dec-2023 00:02                6272
datetime.wakeup.php                                03-Dec-2023 00:02                2924
datetimeimmutable.add.php                          03-Dec-2023 00:02               10453
datetimeimmutable.construct.php                    03-Dec-2023 00:02               17998
datetimeimmutable.createfromformat.php             03-Dec-2023 00:02               46998
datetimeimmutable.createfrominterface.php          03-Dec-2023 00:02                5093
datetimeimmutable.createfrommutable.php            03-Dec-2023 00:02                5038
datetimeimmutable.getlasterrors.php                03-Dec-2023 00:02                5378
datetimeimmutable.modify.php                       03-Dec-2023 00:02                9188
datetimeimmutable.set-state.php                    03-Dec-2023 00:02                2696
datetimeimmutable.setdate.php                      03-Dec-2023 00:02                8917
datetimeimmutable.setisodate.php                   03-Dec-2023 00:02               12529
datetimeimmutable.settime.php                      03-Dec-2023 00:02               11724
datetimeimmutable.settimestamp.php                 03-Dec-2023 00:02                5657
datetimeimmutable.settimezone.php                  03-Dec-2023 00:02                5998
datetimeimmutable.sub.php                          03-Dec-2023 00:02               11914
datetimezone.construct.php                         03-Dec-2023 00:02               10429
datetimezone.getlocation.php                       03-Dec-2023 00:02                5736
datetimezone.getname.php                           03-Dec-2023 00:02                3509
datetimezone.getoffset.php                         03-Dec-2023 00:02                6974
datetimezone.gettransitions.php                    03-Dec-2023 00:02               10935
datetimezone.listabbreviations.php                 03-Dec-2023 00:02                5966
datetimezone.listidentifiers.php                   03-Dec-2023 00:02               13920
dba.configuration.php                              03-Dec-2023 00:02                2261
dba.constants.php                                  03-Dec-2023 00:02                1914
dba.example.php                                    03-Dec-2023 00:02                6182
dba.examples.php                                   03-Dec-2023 00:02                1293
dba.installation.php                               03-Dec-2023 00:02                9450
dba.requirements.php                               03-Dec-2023 00:02                7257
dba.resources.php                                  03-Dec-2023 00:02                1495
dba.setup.php                                      03-Dec-2023 00:02                1616
dbase.configuration.php                            03-Dec-2023 00:02                1305
dbase.constants.php                                03-Dec-2023 00:02                1154
dbase.installation.php                             03-Dec-2023 00:02                1356
dbase.requirements.php                             03-Dec-2023 00:02                1250
dbase.resources.php                                03-Dec-2023 00:02                1243
dbase.setup.php                                    03-Dec-2023 00:02                1640
debugger-about.php                                 03-Dec-2023 00:02                1534
debugger.php                                       03-Dec-2023 00:02                1353
dio.configuration.php                              03-Dec-2023 00:02                1288
dio.constants.php                                  03-Dec-2023 00:02                7259
dio.installation.php                               03-Dec-2023 00:02                2062
dio.requirements.php                               03-Dec-2023 00:02                1233
dio.resources.php                                  03-Dec-2023 00:02                1353
dio.setup.php                                      03-Dec-2023 00:02                1617
dir.configuration.php                              03-Dec-2023 00:02                1291
dir.constants.php                                  03-Dec-2023 00:02                2188
dir.installation.php                               03-Dec-2023 00:02                1272
dir.requirements.php                               03-Dec-2023 00:02                1236
dir.resources.php                                  03-Dec-2023 00:02                1229
dir.setup.php                                      03-Dec-2023 00:02                1615
directory.close.php                                03-Dec-2023 00:02                2157
directory.read.php                                 03-Dec-2023 00:02                2230
directory.rewind.php                               03-Dec-2023 00:02                2196
directoryiterator.construct.php                    03-Dec-2023 00:02                5707
directoryiterator.current.php                      03-Dec-2023 00:02                6117
directoryiterator.getbasename.php                  03-Dec-2023 00:02                6272
directoryiterator.getextension.php                 03-Dec-2023 00:02                5951
directoryiterator.getfilename.php                  03-Dec-2023 00:02                5055
directoryiterator.isdot.php                        03-Dec-2023 00:02                5127
directoryiterator.key.php                          03-Dec-2023 00:02                6454
directoryiterator.next.php                         03-Dec-2023 00:02                5409
directoryiterator.rewind.php                       03-Dec-2023 00:02                5362
directoryiterator.seek.php                         03-Dec-2023 00:02                5267
directoryiterator.tostring.php                     03-Dec-2023 00:02                4552
directoryiterator.valid.php                        03-Dec-2023 00:02                5647
doc.changelog.php                                  03-Dec-2023 00:02                1248
dom.configuration.php                              03-Dec-2023 00:02                1288
dom.constants.php                                  03-Dec-2023 00:02               16003
dom.examples.php                                   03-Dec-2023 00:02                2919
dom.installation.php                               03-Dec-2023 00:02                1360
dom.requirements.php                               03-Dec-2023 00:02                1554
dom.resources.php                                  03-Dec-2023 00:02                1226
dom.setup.php                                      03-Dec-2023 00:02                1606
domattr.construct.php                              03-Dec-2023 00:02                5398
domattr.isid.php                                   03-Dec-2023 00:02                4811
domcdatasection.construct.php                      03-Dec-2023 00:02                5048
domcharacterdata.after.php                         03-Dec-2023 00:02                7317
domcharacterdata.appenddata.php                    03-Dec-2023 00:02                4234
domcharacterdata.before.php                        03-Dec-2023 00:02                7012
domcharacterdata.deletedata.php                    03-Dec-2023 00:02                4745
domcharacterdata.insertdata.php                    03-Dec-2023 00:02                4467
domcharacterdata.remove.php                        03-Dec-2023 00:02                5361
domcharacterdata.replacedata.php                   03-Dec-2023 00:02                5081
domcharacterdata.replacewith.php                   03-Dec-2023 00:02                7498
domcharacterdata.substringdata.php                 03-Dec-2023 00:02                4667
domchildnode.after.php                             03-Dec-2023 00:02                5316
domchildnode.before.php                            03-Dec-2023 00:02                4783
domchildnode.remove.php                            03-Dec-2023 00:02                3093
domchildnode.replacewith.php                       03-Dec-2023 00:02                4990
domcomment.construct.php                           03-Dec-2023 00:02                4900
domdocument.adoptnode.php                          03-Dec-2023 00:02                6488
domdocument.append.php                             03-Dec-2023 00:02                6436
domdocument.construct.php                          03-Dec-2023 00:02                4232
domdocument.createattribute.php                    03-Dec-2023 00:02                5767
domdocument.createattributens.php                  03-Dec-2023 00:02                7826
domdocument.createcdatasection.php                 03-Dec-2023 00:02                5452
domdocument.createcomment.php                      03-Dec-2023 00:02                5852
domdocument.createdocumentfragment.php             03-Dec-2023 00:02                5741
domdocument.createelement.php                      03-Dec-2023 00:02               11075
domdocument.createelementns.php                    03-Dec-2023 00:02               13656
domdocument.createentityreference.php              03-Dec-2023 00:02                6084
domdocument.createprocessinginstruction.php        03-Dec-2023 00:02                6348
domdocument.createtextnode.php                     03-Dec-2023 00:02                5840
domdocument.getelementbyid.php                     03-Dec-2023 00:02                7460
domdocument.getelementsbytagname.php               03-Dec-2023 00:02                5909
domdocument.getelementsbytagnamens.php             03-Dec-2023 00:02                7406
domdocument.importnode.php                         03-Dec-2023 00:02                8546
domdocument.load.php                               03-Dec-2023 00:02                6185
domdocument.loadhtml.php                           03-Dec-2023 00:02                7331
domdocument.loadhtmlfile.php                       03-Dec-2023 00:02                7450
domdocument.loadxml.php                            03-Dec-2023 00:02                5901
domdocument.normalizedocument.php                  03-Dec-2023 00:02                2924
domdocument.prepend.php                            03-Dec-2023 00:02                6528
domdocument.registernodeclass.php                  03-Dec-2023 00:02               20215
domdocument.relaxngvalidate.php                    03-Dec-2023 00:02                3821
domdocument.relaxngvalidatesource.php              03-Dec-2023 00:02                3876
domdocument.replacechildren.php                    03-Dec-2023 00:02                6840
domdocument.save.php                               03-Dec-2023 00:02                7342
domdocument.savehtml.php                           03-Dec-2023 00:02                7308
domdocument.savehtmlfile.php                       03-Dec-2023 00:02                7772
domdocument.savexml.php                            03-Dec-2023 00:02                9330
domdocument.schemavalidate.php                     03-Dec-2023 00:02                4153
domdocument.schemavalidatesource.php               03-Dec-2023 00:02                4215
domdocument.validate.php                           03-Dec-2023 00:02                5849
domdocument.xinclude.php                           03-Dec-2023 00:02                6889
domdocumentfragment.append.php                     03-Dec-2023 00:02                7126
domdocumentfragment.appendxml.php                  03-Dec-2023 00:02                5256
domdocumentfragment.construct.php                  03-Dec-2023 00:02                2097
domdocumentfragment.prepend.php                    03-Dec-2023 00:02                7184
domdocumentfragment.replacechildren.php            03-Dec-2023 00:02                7584
domelement.after.php                               03-Dec-2023 00:02                6995
domelement.append.php                              03-Dec-2023 00:02                6748
domelement.before.php                              03-Dec-2023 00:02                6647
domelement.construct.php                           03-Dec-2023 00:02                6398
domelement.getattribute.php                        03-Dec-2023 00:02                3421
domelement.getattributenames.php                   03-Dec-2023 00:02                3824
domelement.getattributenode.php                    03-Dec-2023 00:02                3952
domelement.getattributenodens.php                  03-Dec-2023 00:02                4326
domelement.getattributens.php                      03-Dec-2023 00:02                3877
domelement.getelementsbytagname.php                03-Dec-2023 00:02                3558
domelement.getelementsbytagnamens.php              03-Dec-2023 00:02                4503
domelement.hasattribute.php                        03-Dec-2023 00:02                3625
domelement.hasattributens.php                      03-Dec-2023 00:02                4011
domelement.insertadjacentelement.php               03-Dec-2023 00:02                6476
domelement.insertadjacenttext.php                  03-Dec-2023 00:02                6313
domelement.prepend.php                             03-Dec-2023 00:02                6798
domelement.remove.php                              03-Dec-2023 00:02                4989
domelement.removeattribute.php                     03-Dec-2023 00:02                3746
domelement.removeattributenode.php                 03-Dec-2023 00:02                4197
domelement.removeattributens.php                   03-Dec-2023 00:02                4081
domelement.replacechildren.php                     03-Dec-2023 00:02                7434
domelement.replacewith.php                         03-Dec-2023 00:02                7497
domelement.setattribute.php                        03-Dec-2023 00:02                5894
domelement.setattributenode.php                    03-Dec-2023 00:02                4382
domelement.setattributenodens.php                  03-Dec-2023 00:02                4449
domelement.setattributens.php                      03-Dec-2023 00:02                4840
domelement.setidattribute.php                      03-Dec-2023 00:02                4468
domelement.setidattributenode.php                  03-Dec-2023 00:02                4522
domelement.setidattributens.php                    03-Dec-2023 00:02                4864
domelement.toggleattribute.php                     03-Dec-2023 00:02                5875
domentityreference.construct.php                   03-Dec-2023 00:02                4742
domimplementation.construct.php                    03-Dec-2023 00:02                2107
domimplementation.createdocument.php               03-Dec-2023 00:02                6749
domimplementation.createdocumenttype.php           03-Dec-2023 00:02                9372
domimplementation.hasfeature.php                   03-Dec-2023 00:02                8718
domnamednodemap.count.php                          03-Dec-2023 00:02                2325
domnamednodemap.getiterator.php                    03-Dec-2023 00:02                3162
domnamednodemap.getnameditem.php                   03-Dec-2023 00:02                3272
domnamednodemap.getnameditemns.php                 03-Dec-2023 00:02                3638
domnamednodemap.item.php                           03-Dec-2023 00:02                2842
domnode.appendchild.php                            03-Dec-2023 00:02                6241
domnode.c14n.php                                   03-Dec-2023 00:02                4259
domnode.c14nfile.php                               03-Dec-2023 00:02                4539
domnode.clonenode.php                              03-Dec-2023 00:02                2609
domnode.contains.php                               03-Dec-2023 00:02                5031
domnode.getlineno.php                              03-Dec-2023 00:02                4617
domnode.getnodepath.php                            03-Dec-2023 00:02                4929
domnode.getrootnode.php                            03-Dec-2023 00:02                4102
domnode.hasattributes.php                          03-Dec-2023 00:02                2712
domnode.haschildnodes.php                          03-Dec-2023 00:02                2634
domnode.insertbefore.php                           03-Dec-2023 00:02                5038
domnode.isdefaultnamespace.php                     03-Dec-2023 00:02                2664
domnode.isequalnode.php                            03-Dec-2023 00:02                4424
domnode.issamenode.php                             03-Dec-2023 00:02                2582
domnode.issupported.php                            03-Dec-2023 00:02                3508
domnode.lookupnamespaceuri.php                     03-Dec-2023 00:02                3248
domnode.lookupprefix.php                           03-Dec-2023 00:02                2967
domnode.normalize.php                              03-Dec-2023 00:02                2770
domnode.removechild.php                            03-Dec-2023 00:02                6792
domnode.replacechild.php                           03-Dec-2023 00:02                5397
domnodelist.count.php                              03-Dec-2023 00:02                2254
domnodelist.getiterator.php                        03-Dec-2023 00:02                3065
domnodelist.item.php                               03-Dec-2023 00:02                6699
domparentnode.append.php                           03-Dec-2023 00:02                4430
domparentnode.prepend.php                          03-Dec-2023 00:02                4470
domparentnode.replacechildren.php                  03-Dec-2023 00:02                6227
domprocessinginstruction.construct.php             03-Dec-2023 00:02                6501
domtext.construct.php                              03-Dec-2023 00:02                4698
domtext.iselementcontentwhitespace.php             03-Dec-2023 00:02                2434
domtext.iswhitespaceinelementcontent.php           03-Dec-2023 00:02                2636
domtext.splittext.php                              03-Dec-2023 00:02                2992
domxpath.construct.php                             03-Dec-2023 00:02                2735
domxpath.evaluate.php                              03-Dec-2023 00:02                7241
domxpath.query.php                                 03-Dec-2023 00:02               11706
domxpath.registernamespace.php                     03-Dec-2023 00:02                2984
domxpath.registerphpfunctions.php                  03-Dec-2023 00:02               13345
dotnet.construct.php                               03-Dec-2023 00:02                2858
ds-collection.clear.php                            03-Dec-2023 00:02                3810
ds-collection.copy.php                             03-Dec-2023 00:02                4240
ds-collection.isempty.php                          03-Dec-2023 00:02                4006
ds-collection.toarray.php                          03-Dec-2023 00:02                3867
ds-deque.allocate.php                              03-Dec-2023 00:02                4506
ds-deque.apply.php                                 03-Dec-2023 00:02                4946
ds-deque.capacity.php                              03-Dec-2023 00:02                3809
ds-deque.clear.php                                 03-Dec-2023 00:02                3727
ds-deque.construct.php                             03-Dec-2023 00:02                4163
ds-deque.contains.php                              03-Dec-2023 00:02                6886
ds-deque.copy.php                                  03-Dec-2023 00:02                4106
ds-deque.count.php                                 03-Dec-2023 00:02                1536
ds-deque.filter.php                                03-Dec-2023 00:02                7226
ds-deque.find.php                                  03-Dec-2023 00:02                5322
ds-deque.first.php                                 03-Dec-2023 00:02                3705
ds-deque.get.php                                   03-Dec-2023 00:02                6446
ds-deque.insert.php                                03-Dec-2023 00:02                6536
ds-deque.isempty.php                               03-Dec-2023 00:02                3892
ds-deque.join.php                                  03-Dec-2023 00:02                5505
ds-deque.jsonserialize.php                         03-Dec-2023 00:02                1816
ds-deque.last.php                                  03-Dec-2023 00:02                3693
ds-deque.map.php                                   03-Dec-2023 00:02                5322
ds-deque.merge.php                                 03-Dec-2023 00:02                4773
ds-deque.pop.php                                   03-Dec-2023 00:02                4190
ds-deque.push.php                                  03-Dec-2023 00:02                4609
ds-deque.reduce.php                                03-Dec-2023 00:02                8038
ds-deque.remove.php                                03-Dec-2023 00:02                4759
ds-deque.reverse.php                               03-Dec-2023 00:02                3563
ds-deque.reversed.php                              03-Dec-2023 00:02                3931
ds-deque.rotate.php                                03-Dec-2023 00:02                4896
ds-deque.set.php                                   03-Dec-2023 00:02                5900
ds-deque.shift.php                                 03-Dec-2023 00:02                4291
ds-deque.slice.php                                 03-Dec-2023 00:02                6957
ds-deque.sort.php                                  03-Dec-2023 00:02                7179
ds-deque.sorted.php                                03-Dec-2023 00:02                7223
ds-deque.sum.php                                   03-Dec-2023 00:02                4912
ds-deque.toarray.php                               03-Dec-2023 00:02                3753
ds-deque.unshift.php                               03-Dec-2023 00:02                4688
ds-hashable.equals.php                             03-Dec-2023 00:02                3430
ds-hashable.hash.php                               03-Dec-2023 00:02                7405
ds-map.allocate.php                                03-Dec-2023 00:02                4372
ds-map.apply.php                                   03-Dec-2023 00:02                5683
ds-map.capacity.php                                03-Dec-2023 00:02                3099
ds-map.clear.php                                   03-Dec-2023 00:02                4203
ds-map.construct.php                               03-Dec-2023 00:02                4665
ds-map.copy.php                                    03-Dec-2023 00:02                3966
ds-map.count.php                                   03-Dec-2023 00:02                1497
ds-map.diff.php                                    03-Dec-2023 00:02                5385
ds-map.filter.php                                  03-Dec-2023 00:02                8051
ds-map.first.php                                   03-Dec-2023 00:02                3963
ds-map.get.php                                     03-Dec-2023 00:02                8351
ds-map.haskey.php                                  03-Dec-2023 00:02                4482
ds-map.hasvalue.php                                03-Dec-2023 00:02                4526
ds-map.intersect.php                               03-Dec-2023 00:02                5906
ds-map.isempty.php                                 03-Dec-2023 00:02                4114
ds-map.jsonserialize.php                           03-Dec-2023 00:02                1794
ds-map.keys.php                                    03-Dec-2023 00:02                3867
ds-map.ksort.php                                   03-Dec-2023 00:02                7866
ds-map.ksorted.php                                 03-Dec-2023 00:02                7972
ds-map.last.php                                    03-Dec-2023 00:02                3948
ds-map.map.php                                     03-Dec-2023 00:02                6344
ds-map.merge.php                                   03-Dec-2023 00:02                5637
ds-map.pairs.php                                   03-Dec-2023 00:02                4282
ds-map.put.php                                     03-Dec-2023 00:02               13825
ds-map.putall.php                                  03-Dec-2023 00:02                5298
ds-map.reduce.php                                  03-Dec-2023 00:02                9018
ds-map.remove.php                                  03-Dec-2023 00:02                6939
ds-map.reverse.php                                 03-Dec-2023 00:02                4015
ds-map.reversed.php                                03-Dec-2023 00:02                4141
ds-map.skip.php                                    03-Dec-2023 00:02                4468
ds-map.slice.php                                   03-Dec-2023 00:02                7808
ds-map.sort.php                                    03-Dec-2023 00:02                7789
ds-map.sorted.php                                  03-Dec-2023 00:02                7951
ds-map.sum.php                                     03-Dec-2023 00:02                5379
ds-map.toarray.php                                 03-Dec-2023 00:02                4634
ds-map.union.php                                   03-Dec-2023 00:02                5890
ds-map.values.php                                  03-Dec-2023 00:02                3866
ds-map.xor.php                                     03-Dec-2023 00:02                5451
ds-pair.clear.php                                  03-Dec-2023 00:02                3632
ds-pair.construct.php                              03-Dec-2023 00:02                2638
ds-pair.copy.php                                   03-Dec-2023 00:02                4020
ds-pair.isempty.php                                03-Dec-2023 00:02                3842
ds-pair.jsonserialize.php                          03-Dec-2023 00:02                1814
ds-pair.toarray.php                                03-Dec-2023 00:02                3687
ds-priorityqueue.allocate.php                      03-Dec-2023 00:02                4672
ds-priorityqueue.capacity.php                      03-Dec-2023 00:02                3308
ds-priorityqueue.clear.php                         03-Dec-2023 00:02                4384
ds-priorityqueue.construct.php                     03-Dec-2023 00:02                2840
ds-priorityqueue.copy.php                          03-Dec-2023 00:02                4409
ds-priorityqueue.count.php                         03-Dec-2023 00:02                1645
ds-priorityqueue.isempty.php                       03-Dec-2023 00:02                4802
ds-priorityqueue.jsonserialize.php                 03-Dec-2023 00:02                1934
ds-priorityqueue.peek.php                          03-Dec-2023 00:02                4683
ds-priorityqueue.pop.php                           03-Dec-2023 00:02                5453
ds-priorityqueue.push.php                          03-Dec-2023 00:02                5481
ds-priorityqueue.toarray.php                       03-Dec-2023 00:02                4852
ds-queue.allocate.php                              03-Dec-2023 00:02                4699
ds-queue.capacity.php                              03-Dec-2023 00:02                3815
ds-queue.clear.php                                 03-Dec-2023 00:02                3712
ds-queue.construct.php                             03-Dec-2023 00:02                4161
ds-queue.copy.php                                  03-Dec-2023 00:02                4208
ds-queue.count.php                                 03-Dec-2023 00:02                1533
ds-queue.isempty.php                               03-Dec-2023 00:02                3908
ds-queue.jsonserialize.php                         03-Dec-2023 00:02                1822
ds-queue.peek.php                                  03-Dec-2023 00:02                4287
ds-queue.pop.php                                   03-Dec-2023 00:02                4821
ds-queue.push.php                                  03-Dec-2023 00:02                4644
ds-queue.toarray.php                               03-Dec-2023 00:02                3917
ds-sequence.allocate.php                           03-Dec-2023 00:02                4410
ds-sequence.apply.php                              03-Dec-2023 00:02                5061
ds-sequence.capacity.php                           03-Dec-2023 00:02                4364
ds-sequence.contains.php                           03-Dec-2023 00:02                7013
ds-sequence.filter.php                             03-Dec-2023 00:02                7365
ds-sequence.find.php                               03-Dec-2023 00:02                5434
ds-sequence.first.php                              03-Dec-2023 00:02                3820
ds-sequence.get.php                                03-Dec-2023 00:02                6574
ds-sequence.insert.php                             03-Dec-2023 00:02                6655
ds-sequence.join.php                               03-Dec-2023 00:02                5601
ds-sequence.last.php                               03-Dec-2023 00:02                3787
ds-sequence.map.php                                03-Dec-2023 00:02                5451
ds-sequence.merge.php                              03-Dec-2023 00:02                4899
ds-sequence.pop.php                                03-Dec-2023 00:02                4302
ds-sequence.push.php                               03-Dec-2023 00:02                4731
ds-sequence.reduce.php                             03-Dec-2023 00:02                8157
ds-sequence.remove.php                             03-Dec-2023 00:02                4871
ds-sequence.reverse.php                            03-Dec-2023 00:02                3676
ds-sequence.reversed.php                           03-Dec-2023 00:02                4054
ds-sequence.rotate.php                             03-Dec-2023 00:02                5033
ds-sequence.set.php                                03-Dec-2023 00:02                6024
ds-sequence.shift.php                              03-Dec-2023 00:02                4403
ds-sequence.slice.php                              03-Dec-2023 00:02                7122
ds-sequence.sort.php                               03-Dec-2023 00:02                7306
ds-sequence.sorted.php                             03-Dec-2023 00:02                7350
ds-sequence.sum.php                                03-Dec-2023 00:02                5037
ds-sequence.unshift.php                            03-Dec-2023 00:02                4799
ds-set.add.php                                     03-Dec-2023 00:02               12013
ds-set.allocate.php                                03-Dec-2023 00:02                4381
ds-set.capacity.php                                03-Dec-2023 00:02                3767
ds-set.clear.php                                   03-Dec-2023 00:02                3658
ds-set.construct.php                               03-Dec-2023 00:02                4115
ds-set.contains.php                                03-Dec-2023 00:02                7019
ds-set.copy.php                                    03-Dec-2023 00:02                4147
ds-set.count.php                                   03-Dec-2023 00:02                1497
ds-set.diff.php                                    03-Dec-2023 00:02                4675
ds-set.filter.php                                  03-Dec-2023 00:02                7174
ds-set.first.php                                   03-Dec-2023 00:02                3658
ds-set.get.php                                     03-Dec-2023 00:02                6390
ds-set.intersect.php                               03-Dec-2023 00:02                4906
ds-set.isempty.php                                 03-Dec-2023 00:02                3850
ds-set.join.php                                    03-Dec-2023 00:02                5451
ds-set.jsonserialize.php                           03-Dec-2023 00:02                1788
ds-set.last.php                                    03-Dec-2023 00:02                3659
ds-set.merge.php                                   03-Dec-2023 00:02                4699
ds-set.reduce.php                                  03-Dec-2023 00:02                7984
ds-set.remove.php                                  03-Dec-2023 00:02                4915
ds-set.reverse.php                                 03-Dec-2023 00:02                3511
ds-set.reversed.php                                03-Dec-2023 00:02                3869
ds-set.slice.php                                   03-Dec-2023 00:02                6871
ds-set.sort.php                                    03-Dec-2023 00:02                7115
ds-set.sorted.php                                  03-Dec-2023 00:02                7159
ds-set.sum.php                                     03-Dec-2023 00:02                4852
ds-set.toarray.php                                 03-Dec-2023 00:02                3699
ds-set.union.php                                   03-Dec-2023 00:02                4869
ds-set.xor.php                                     03-Dec-2023 00:02                4845
ds-stack.allocate.php                              03-Dec-2023 00:02                2727
ds-stack.capacity.php                              03-Dec-2023 00:02                2083
ds-stack.clear.php                                 03-Dec-2023 00:02                3708
ds-stack.construct.php                             03-Dec-2023 00:02                4127
ds-stack.copy.php                                  03-Dec-2023 00:02                4208
ds-stack.count.php                                 03-Dec-2023 00:02                1533
ds-stack.isempty.php                               03-Dec-2023 00:02                3908
ds-stack.jsonserialize.php                         03-Dec-2023 00:02                1822
ds-stack.peek.php                                  03-Dec-2023 00:02                4252
ds-stack.pop.php                                   03-Dec-2023 00:02                4815
ds-stack.push.php                                  03-Dec-2023 00:02                4644
ds-stack.toarray.php                               03-Dec-2023 00:02                3744
ds-vector.allocate.php                             03-Dec-2023 00:02                4327
ds-vector.apply.php                                03-Dec-2023 00:02                4972
ds-vector.capacity.php                             03-Dec-2023 00:02                4269
ds-vector.clear.php                                03-Dec-2023 00:02                3739
ds-vector.construct.php                            03-Dec-2023 00:02                4195
ds-vector.contains.php                             03-Dec-2023 00:02                6916
ds-vector.copy.php                                 03-Dec-2023 00:02                4232
ds-vector.count.php                                03-Dec-2023 00:02                1550
ds-vector.filter.php                               03-Dec-2023 00:02                7260
ds-vector.find.php                                 03-Dec-2023 00:02                5347
ds-vector.first.php                                03-Dec-2023 00:02                3731
ds-vector.get.php                                  03-Dec-2023 00:02                6477
ds-vector.insert.php                               03-Dec-2023 00:02                6566
ds-vector.isempty.php                              03-Dec-2023 00:02                3916
ds-vector.join.php                                 03-Dec-2023 00:02                5532
ds-vector.jsonserialize.php                        03-Dec-2023 00:02                1830
ds-vector.last.php                                 03-Dec-2023 00:02                3718
ds-vector.map.php                                  03-Dec-2023 00:02                5354
ds-vector.merge.php                                03-Dec-2023 00:02                4804
ds-vector.pop.php                                  03-Dec-2023 00:02                4215
ds-vector.push.php                                 03-Dec-2023 00:02                4638
ds-vector.reduce.php                               03-Dec-2023 00:02                8066
ds-vector.remove.php                               03-Dec-2023 00:02                4784
ds-vector.reverse.php                              03-Dec-2023 00:02                3589
ds-vector.reversed.php                             03-Dec-2023 00:02                3961
ds-vector.rotate.php                               03-Dec-2023 00:02                4930
ds-vector.set.php                                  03-Dec-2023 00:02                5931
ds-vector.shift.php                                03-Dec-2023 00:02                4316
ds-vector.slice.php                                03-Dec-2023 00:02                7003
ds-vector.sort.php                                 03-Dec-2023 00:02                7211
ds-vector.sorted.php                               03-Dec-2023 00:02                7255
ds-vector.sum.php                                  03-Dec-2023 00:02                4942
ds-vector.toarray.php                              03-Dec-2023 00:02                3778
ds-vector.unshift.php                              03-Dec-2023 00:02                4718
ds.constants.php                                   03-Dec-2023 00:02                1134
ds.examples.php                                    03-Dec-2023 00:02                4654
ds.installation.php                                03-Dec-2023 00:02                2522
ds.requirements.php                                03-Dec-2023 00:02                1234
ds.setup.php                                       03-Dec-2023 00:02                1432
eio.configuration.php                              03-Dec-2023 00:02                1286
eio.constants.php                                  03-Dec-2023 00:02               15983
eio.examples.php                                   03-Dec-2023 00:02               26984
eio.installation.php                               03-Dec-2023 00:02                1768
eio.requirements.php                               03-Dec-2023 00:02                1354
eio.resources.php                                  03-Dec-2023 00:02                1261
eio.setup.php                                      03-Dec-2023 00:02                1618
emptyiterator.current.php                          03-Dec-2023 00:02                2655
emptyiterator.key.php                              03-Dec-2023 00:02                2619
emptyiterator.next.php                             03-Dec-2023 00:02                2330
emptyiterator.rewind.php                           03-Dec-2023 00:02                2352
emptyiterator.valid.php                            03-Dec-2023 00:02                2364
enchant.configuration.php                          03-Dec-2023 00:02                1316
enchant.constants.php                              03-Dec-2023 00:02                2544
enchant.examples.php                               03-Dec-2023 00:02                5390
enchant.installation.php                           03-Dec-2023 00:02                3226
enchant.requirements.php                           03-Dec-2023 00:02                1837
enchant.resources.php                              03-Dec-2023 00:02                1368
enchant.setup.php                                  03-Dec-2023 00:02                1663
error.clone.php                                    03-Dec-2023 00:02                2736
error.construct.php                                03-Dec-2023 00:02                3213
error.getcode.php                                  03-Dec-2023 00:02                3920
error.getfile.php                                  03-Dec-2023 00:02                3667
error.getline.php                                  03-Dec-2023 00:02                3865
error.getmessage.php                               03-Dec-2023 00:02                3748
error.getprevious.php                              03-Dec-2023 00:02                6394
error.gettrace.php                                 03-Dec-2023 00:02                4185
error.gettraceasstring.php                         03-Dec-2023 00:02                4035
error.tostring.php                                 03-Dec-2023 00:02                3792
errorexception.construct.php                       03-Dec-2023 00:02                5419
errorexception.getseverity.php                     03-Dec-2023 00:02                4189
errorfunc.configuration.php                        03-Dec-2023 00:02               24295
errorfunc.constants.php                            03-Dec-2023 00:02                9386
errorfunc.examples.php                             03-Dec-2023 00:02               19141
errorfunc.installation.php                         03-Dec-2023 00:02                1314
errorfunc.requirements.php                         03-Dec-2023 00:02                1278
errorfunc.resources.php                            03-Dec-2023 00:02                1271
errorfunc.setup.php                                03-Dec-2023 00:02                1687
ev.backend.php                                     03-Dec-2023 00:02                3367
ev.configuration.php                               03-Dec-2023 00:02                1281
ev.depth.php                                       03-Dec-2023 00:02                3179
ev.embeddablebackends.php                          03-Dec-2023 00:02                6436
ev.examples.php                                    03-Dec-2023 00:02               41739
ev.feedsignal.php                                  03-Dec-2023 00:02                3279
ev.feedsignalevent.php                             03-Dec-2023 00:02                3066
ev.global.constants.php                            03-Dec-2023 00:02                1278
ev.installation.php                                03-Dec-2023 00:02                1761
ev.iteration.php                                   03-Dec-2023 00:02                2553
ev.now.php                                         03-Dec-2023 00:02                3024
ev.nowupdate.php                                   03-Dec-2023 00:02                3139
ev.periodic-modes.php                              03-Dec-2023 00:02                7517
ev.recommendedbackends.php                         03-Dec-2023 00:02                7128
ev.requirements.php                                03-Dec-2023 00:02                1289
ev.resources.php                                   03-Dec-2023 00:02                1226
ev.resume.php                                      03-Dec-2023 00:02                3661
ev.run.php                                         03-Dec-2023 00:02                4739
ev.setup.php                                       03-Dec-2023 00:02                1573
ev.sleep.php                                       03-Dec-2023 00:02                2323
ev.stop.php                                        03-Dec-2023 00:02                2778
ev.supportedbackends.php                           03-Dec-2023 00:02                6418
ev.suspend.php                                     03-Dec-2023 00:02                3428
ev.time.php                                        03-Dec-2023 00:02                2598
ev.verify.php                                      03-Dec-2023 00:02                2204
ev.watcher-callbacks.php                           03-Dec-2023 00:02                4120
ev.watchers.php                                    03-Dec-2023 00:02                3356
evcheck.construct.php                              03-Dec-2023 00:02                3642
evcheck.createstopped.php                          03-Dec-2023 00:02                3512
evchild.construct.php                              03-Dec-2023 00:02                6341
evchild.createstopped.php                          03-Dec-2023 00:02                4952
evchild.set.php                                    03-Dec-2023 00:02                3060
evembed.construct.php                              03-Dec-2023 00:02                7864
evembed.createstopped.php                          03-Dec-2023 00:02                4682
evembed.set.php                                    03-Dec-2023 00:02                2445
evembed.sweep.php                                  03-Dec-2023 00:02                3024
event.add.php                                      03-Dec-2023 00:02               10032
event.addsignal.php                                03-Dec-2023 00:02                1642
event.addtimer.php                                 03-Dec-2023 00:02                1651
event.callbacks.php                                03-Dec-2023 00:02                5388
event.configuration.php                            03-Dec-2023 00:02                1302
event.construct.php                                03-Dec-2023 00:02                4750
event.constructing.signal.events.php               03-Dec-2023 00:02                5951
event.del.php                                      03-Dec-2023 00:02                2455
event.delsignal.php                                03-Dec-2023 00:02                1642
event.deltimer.php                                 03-Dec-2023 00:02                1639
event.examples.php                                 03-Dec-2023 00:02              164983
event.flags.php                                    03-Dec-2023 00:02                2305
event.free.php                                     03-Dec-2023 00:02                2930
event.getsupportedmethods.php                      03-Dec-2023 00:02                2595
event.installation.php                             03-Dec-2023 00:02                1788
event.pending.php                                  03-Dec-2023 00:02                2661
event.persistence.php                              03-Dec-2023 00:02                2738
event.requirements.php                             03-Dec-2023 00:02                1507
event.resources.php                                03-Dec-2023 00:02                1216
event.set.php                                      03-Dec-2023 00:02                4496
event.setpriority.php                              03-Dec-2023 00:02                2364
event.settimer.php                                 03-Dec-2023 00:02                4014
event.setup.php                                    03-Dec-2023 00:02                1612
event.signal.php                                   03-Dec-2023 00:02                4240
event.timer.php                                    03-Dec-2023 00:02                3569
eventbase.construct.php                            03-Dec-2023 00:02                2799
eventbase.dispatch.php                             03-Dec-2023 00:02                3181
eventbase.exit.php                                 03-Dec-2023 00:02                2878
eventbase.free.php                                 03-Dec-2023 00:02                3285
eventbase.getfeatures.php                          03-Dec-2023 00:02                5716
eventbase.getmethod.php                            03-Dec-2023 00:02                4450
eventbase.gettimeofdaycached.php                   03-Dec-2023 00:02                2600
eventbase.gotexit.php                              03-Dec-2023 00:02                3212
eventbase.gotstop.php                              03-Dec-2023 00:02                3184
eventbase.loop.php                                 03-Dec-2023 00:02                3419
eventbase.priorityinit.php                         03-Dec-2023 00:02                2855
eventbase.reinit.php                               03-Dec-2023 00:02                2224
eventbase.stop.php                                 03-Dec-2023 00:02                2723
eventbuffer.add.php                                03-Dec-2023 00:02                2854
eventbuffer.addbuffer.php                          03-Dec-2023 00:02                3266
eventbuffer.appendfrom.php                         03-Dec-2023 00:02                4868
eventbuffer.construct.php                          03-Dec-2023 00:02                2139
eventbuffer.copyout.php                            03-Dec-2023 00:02                3814
eventbuffer.drain.php                              03-Dec-2023 00:02                3346
eventbuffer.enablelocking.php                      03-Dec-2023 00:02                2865
eventbuffer.expand.php                             03-Dec-2023 00:02                2637
eventbuffer.freeze.php                             03-Dec-2023 00:02                2903
eventbuffer.lock.php                               03-Dec-2023 00:02                2990
eventbuffer.prepend.php                            03-Dec-2023 00:02                3359
eventbuffer.prependbuffer.php                      03-Dec-2023 00:02                3581
eventbuffer.pullup.php                             03-Dec-2023 00:02                4568
eventbuffer.read.php                               03-Dec-2023 00:02                4835
eventbuffer.readfrom.php                           03-Dec-2023 00:02                4321
eventbuffer.readline.php                           03-Dec-2023 00:02                4145
eventbuffer.search.php                             03-Dec-2023 00:02                8025
eventbuffer.searcheol.php                          03-Dec-2023 00:02                4590
eventbuffer.substr.php                             03-Dec-2023 00:02                3307
eventbuffer.unfreeze.php                           03-Dec-2023 00:02                2917
eventbuffer.unlock.php                             03-Dec-2023 00:02                2683
eventbuffer.write.php                              03-Dec-2023 00:02                3374
eventbufferevent.about.callbacks.php               03-Dec-2023 00:02                5598
eventbufferevent.close.php                         03-Dec-2023 00:02                2453
eventbufferevent.connect.php                       03-Dec-2023 00:02               23633
eventbufferevent.connecthost.php                   03-Dec-2023 00:02               17163
eventbufferevent.construct.php                     03-Dec-2023 00:02                6894
eventbufferevent.createpair.php                    03-Dec-2023 00:02                4035
eventbufferevent.disable.php                       03-Dec-2023 00:02                3153
eventbufferevent.enable.php                        03-Dec-2023 00:02                3417
eventbufferevent.free.php                          03-Dec-2023 00:02                2760
eventbufferevent.getdnserrorstring.php             03-Dec-2023 00:02                3063
eventbufferevent.getenabled.php                    03-Dec-2023 00:02                3029
eventbufferevent.getinput.php                      03-Dec-2023 00:02                5014
eventbufferevent.getoutput.php                     03-Dec-2023 00:02                7895
eventbufferevent.read.php                          03-Dec-2023 00:02                2975
eventbufferevent.readbuffer.php                    03-Dec-2023 00:02                3103
eventbufferevent.setcallbacks.php                  03-Dec-2023 00:02                4613
eventbufferevent.setpriority.php                   03-Dec-2023 00:02                2745
eventbufferevent.settimeouts.php                   03-Dec-2023 00:02                2917
eventbufferevent.setwatermark.php                  03-Dec-2023 00:02                3809
eventbufferevent.sslerror.php                      03-Dec-2023 00:02                5784
eventbufferevent.sslfilter.php                     03-Dec-2023 00:02               34169
eventbufferevent.sslgetcipherinfo.php              03-Dec-2023 00:02                2807
eventbufferevent.sslgetciphername.php              03-Dec-2023 00:02                2710
eventbufferevent.sslgetcipherversion.php           03-Dec-2023 00:02                2739
eventbufferevent.sslgetprotocol.php                03-Dec-2023 00:02                2668
eventbufferevent.sslrenegotiate.php                03-Dec-2023 00:02                2794
eventbufferevent.sslsocket.php                     03-Dec-2023 00:02                5513
eventbufferevent.write.php                         03-Dec-2023 00:02                3039
eventbufferevent.writebuffer.php                   03-Dec-2023 00:02                3221
eventconfig.avoidmethod.php                        03-Dec-2023 00:02                4201
eventconfig.construct.php                          03-Dec-2023 00:02                4339
eventconfig.requirefeatures.php                    03-Dec-2023 00:02                5769
eventconfig.setflags.php                           03-Dec-2023 00:02                3158
eventconfig.setmaxdispatchinterval.php             03-Dec-2023 00:02                4269
eventdnsbase.addnameserverip.php                   03-Dec-2023 00:02                2771
eventdnsbase.addsearch.php                         03-Dec-2023 00:02                2475
eventdnsbase.clearsearch.php                       03-Dec-2023 00:02                2796
eventdnsbase.construct.php                         03-Dec-2023 00:02                3224
eventdnsbase.countnameservers.php                  03-Dec-2023 00:02                2477
eventdnsbase.loadhosts.php                         03-Dec-2023 00:02                2644
eventdnsbase.parseresolvconf.php                   03-Dec-2023 00:02                4062
eventdnsbase.setoption.php                         03-Dec-2023 00:02                3162
eventdnsbase.setsearchndots.php                    03-Dec-2023 00:02                2708
eventhttp.accept.php                               03-Dec-2023 00:02               12267
eventhttp.addserveralias.php                       03-Dec-2023 00:02                6243
eventhttp.bind.php                                 03-Dec-2023 00:02                7609
eventhttp.construct.php                            03-Dec-2023 00:02               17581
eventhttp.removeserveralias.php                    03-Dec-2023 00:02                3049
eventhttp.setallowedmethods.php                    03-Dec-2023 00:02                3316
eventhttp.setcallback.php                          03-Dec-2023 00:02               17775
eventhttp.setdefaultcallback.php                   03-Dec-2023 00:02                7664
eventhttp.setmaxbodysize.php                       03-Dec-2023 00:02                2846
eventhttp.setmaxheaderssize.php                    03-Dec-2023 00:02                2758
eventhttp.settimeout.php                           03-Dec-2023 00:02                2430
eventhttpconnection.construct.php                  03-Dec-2023 00:02                5211
eventhttpconnection.getbase.php                    03-Dec-2023 00:02                2558
eventhttpconnection.getpeer.php                    03-Dec-2023 00:02                2890
eventhttpconnection.makerequest.php                03-Dec-2023 00:02               11386
eventhttpconnection.setclosecallback.php           03-Dec-2023 00:02                9364
eventhttpconnection.setlocaladdress.php            03-Dec-2023 00:02                3143
eventhttpconnection.setlocalport.php               03-Dec-2023 00:02                3031
eventhttpconnection.setmaxbodysize.php             03-Dec-2023 00:02                3068
eventhttpconnection.setmaxheaderssize.php          03-Dec-2023 00:02                3089
eventhttpconnection.setretries.php                 03-Dec-2023 00:02                2660
eventhttpconnection.settimeout.php                 03-Dec-2023 00:02                2557
eventhttprequest.addheader.php                     03-Dec-2023 00:02                3661
eventhttprequest.cancel.php                        03-Dec-2023 00:02                2814
eventhttprequest.clearheaders.php                  03-Dec-2023 00:02                2781
eventhttprequest.closeconnection.php               03-Dec-2023 00:02                2369
eventhttprequest.construct.php                     03-Dec-2023 00:02               11546
eventhttprequest.findheader.php                    03-Dec-2023 00:02                3364
eventhttprequest.free.php                          03-Dec-2023 00:02                2277
eventhttprequest.getbufferevent.php                03-Dec-2023 00:02                3683
eventhttprequest.getcommand.php                    03-Dec-2023 00:02                2649
eventhttprequest.getconnection.php                 03-Dec-2023 00:02                4452
eventhttprequest.gethost.php                       03-Dec-2023 00:02                2821
eventhttprequest.getinputbuffer.php                03-Dec-2023 00:02                2768
eventhttprequest.getinputheaders.php               03-Dec-2023 00:02                2801
eventhttprequest.getoutputbuffer.php               03-Dec-2023 00:02                2827
eventhttprequest.getoutputheaders.php              03-Dec-2023 00:02                2785
eventhttprequest.getresponsecode.php               03-Dec-2023 00:02                3118
eventhttprequest.geturi.php                        03-Dec-2023 00:02                3029
eventhttprequest.removeheader.php                  03-Dec-2023 00:02                3375
eventhttprequest.senderror.php                     03-Dec-2023 00:02                5615
eventhttprequest.sendreply.php                     03-Dec-2023 00:02                3944
eventhttprequest.sendreplychunk.php                03-Dec-2023 00:02                3426
eventhttprequest.sendreplyend.php                  03-Dec-2023 00:02                3029
eventhttprequest.sendreplystart.php                03-Dec-2023 00:02                4199
eventlistener.construct.php                        03-Dec-2023 00:02               22730
eventlistener.disable.php                          03-Dec-2023 00:02                2659
eventlistener.enable.php                           03-Dec-2023 00:02                2645
eventlistener.getbase.php                          03-Dec-2023 00:02                2288
eventlistener.getsocketname.php                    03-Dec-2023 00:02                3184
eventlistener.setcallback.php                      03-Dec-2023 00:02                5700
eventlistener.seterrorcallback.php                 03-Dec-2023 00:02                4243
eventsslcontext.construct.php                      03-Dec-2023 00:02                5462
eventutil.construct.php                            03-Dec-2023 00:02                2330
eventutil.getlastsocketerrno.php                   03-Dec-2023 00:02                3237
eventutil.getlastsocketerror.php                   03-Dec-2023 00:02                3102
eventutil.getsocketfd.php                          03-Dec-2023 00:02                3139
eventutil.getsocketname.php                        03-Dec-2023 00:02                3632
eventutil.setsocketoption.php                      03-Dec-2023 00:02                5475
eventutil.sslrandpoll.php                          03-Dec-2023 00:02                2319
evfork.construct.php                               03-Dec-2023 00:02                3617
evfork.createstopped.php                           03-Dec-2023 00:02                3714
evidle.construct.php                               03-Dec-2023 00:02                3672
evidle.createstopped.php                           03-Dec-2023 00:02                4030
evio.construct.php                                 03-Dec-2023 00:02                4720
evio.createstopped.php                             03-Dec-2023 00:02                5096
evio.set.php                                       03-Dec-2023 00:02                2787
evloop.backend.php                                 03-Dec-2023 00:02                2654
evloop.check.php                                   03-Dec-2023 00:02                3116
evloop.child.php                                   03-Dec-2023 00:02                3478
evloop.construct.php                               03-Dec-2023 00:02                3912
evloop.defaultloop.php                             03-Dec-2023 00:02                4509
evloop.embed.php                                   03-Dec-2023 00:02                3581
evloop.fork.php                                    03-Dec-2023 00:02                3310
evloop.idle.php                                    03-Dec-2023 00:02                3330
evloop.invokepending.php                           03-Dec-2023 00:02                2184
evloop.io.php                                      03-Dec-2023 00:02                3749
evloop.loopfork.php                                03-Dec-2023 00:02                2467
evloop.now.php                                     03-Dec-2023 00:02                2768
evloop.nowupdate.php                               03-Dec-2023 00:02                3133
evloop.periodic.php                                03-Dec-2023 00:02                3788
evloop.prepare.php                                 03-Dec-2023 00:02                3328
evloop.resume.php                                  03-Dec-2023 00:02                2793
evloop.run.php                                     03-Dec-2023 00:02                4722
evloop.signal.php                                  03-Dec-2023 00:02                3575
evloop.stat.php                                    03-Dec-2023 00:02                3696
evloop.stop.php                                    03-Dec-2023 00:02                2905
evloop.suspend.php                                 03-Dec-2023 00:02                2785
evloop.timer.php                                   03-Dec-2023 00:02                3715
evloop.verify.php                                  03-Dec-2023 00:02                2543
evperiodic.again.php                               03-Dec-2023 00:02                2533
evperiodic.at.php                                  03-Dec-2023 00:02                2556
evperiodic.construct.php                           03-Dec-2023 00:02                9832
evperiodic.createstopped.php                       03-Dec-2023 00:02                5652
evperiodic.set.php                                 03-Dec-2023 00:02                3045
evprepare.construct.php                            03-Dec-2023 00:02                3397
evprepare.createstopped.php                        03-Dec-2023 00:02                4262
evsignal.construct.php                             03-Dec-2023 00:02                5377
evsignal.createstopped.php                         03-Dec-2023 00:02                4733
evsignal.set.php                                   03-Dec-2023 00:02                2399
evstat.attr.php                                    03-Dec-2023 00:02                8182
evstat.construct.php                               03-Dec-2023 00:02                7134
evstat.createstopped.php                           03-Dec-2023 00:02                5029
evstat.prev.php                                    03-Dec-2023 00:02                2914
evstat.set.php                                     03-Dec-2023 00:02                2703
evstat.stat.php                                    03-Dec-2023 00:02                2834
evtimer.again.php                                  03-Dec-2023 00:02                3028
evtimer.construct.php                              03-Dec-2023 00:02               12499
evtimer.createstopped.php                          03-Dec-2023 00:02                8196
evtimer.set.php                                    03-Dec-2023 00:02                2862
evwatcher.clear.php                                03-Dec-2023 00:02                2745
evwatcher.construct.php                            03-Dec-2023 00:02                2081
evwatcher.feed.php                                 03-Dec-2023 00:02                2512
evwatcher.getloop.php                              03-Dec-2023 00:02                2287
evwatcher.invoke.php                               03-Dec-2023 00:02                2519
evwatcher.keepalive.php                            03-Dec-2023 00:02                5041
evwatcher.setcallback.php                          03-Dec-2023 00:02                2532
evwatcher.start.php                                03-Dec-2023 00:02                2475
evwatcher.stop.php                                 03-Dec-2023 00:02                2444
example.xml-external-entity.php                    03-Dec-2023 00:02               21355
example.xml-map-tags.php                           03-Dec-2023 00:02                8109
example.xml-structure.php                          03-Dec-2023 00:02                6197
example.xmlwriter-namespace.php                    03-Dec-2023 00:02                5338
example.xmlwriter-oop.php                          03-Dec-2023 00:02                3346
example.xmlwriter-simple.php                       03-Dec-2023 00:02                8593
exception.clone.php                                03-Dec-2023 00:02                2989
exception.construct.php                            03-Dec-2023 00:02                3579
exception.getcode.php                              03-Dec-2023 00:02                4446
exception.getfile.php                              03-Dec-2023 00:02                3775
exception.getline.php                              03-Dec-2023 00:02                3999
exception.getmessage.php                           03-Dec-2023 00:02                3862
exception.getprevious.php                          03-Dec-2023 00:02                6677
exception.gettrace.php                             03-Dec-2023 00:02                4276
exception.gettraceasstring.php                     03-Dec-2023 00:02                4126
exception.tostring.php                             03-Dec-2023 00:02                3952
exec.configuration.php                             03-Dec-2023 00:02                1298
exec.constants.php                                 03-Dec-2023 00:02                1208
exec.installation.php                              03-Dec-2023 00:02                1279
exec.requirements.php                              03-Dec-2023 00:02                1243
exec.resources.php                                 03-Dec-2023 00:02                1372
exec.setup.php                                     03-Dec-2023 00:02                1652
exif.configuration.php                             03-Dec-2023 00:02                6824
exif.constants.php                                 03-Dec-2023 00:02                1707
exif.installation.php                              03-Dec-2023 00:02                1701
exif.requirements.php                              03-Dec-2023 00:02                1439
exif.resources.php                                 03-Dec-2023 00:02                1236
exif.setup.php                                     03-Dec-2023 00:02                1633
expect.configuration.php                           03-Dec-2023 00:02                5149
expect.constants.php                               03-Dec-2023 00:02                3258
expect.examples-usage.php                          03-Dec-2023 00:02               12172
expect.examples.php                                03-Dec-2023 00:02                1357
expect.installation.php                            03-Dec-2023 00:02                2414
expect.requirements.php                            03-Dec-2023 00:02                1360
expect.resources.php                               03-Dec-2023 00:02                1445
expect.setup.php                                   03-Dec-2023 00:02                1656
extensions.alphabetical.php                        03-Dec-2023 00:02               21038
extensions.membership.php                          03-Dec-2023 00:02               20711
extensions.php                                     03-Dec-2023 00:02                1693
extensions.state.php                               03-Dec-2023 00:02                2714
fann.configuration.php                             03-Dec-2023 00:02                1295
fann.constants.php                                 03-Dec-2023 00:02               17672
fann.examples-1.php                                03-Dec-2023 00:02                8482
fann.examples.php                                  03-Dec-2023 00:02                1311
fann.installation.php                              03-Dec-2023 00:02                4979
fann.requirements.php                              03-Dec-2023 00:02                1215
fann.resources.php                                 03-Dec-2023 00:02                1182
fann.setup.php                                     03-Dec-2023 00:02                1603
fannconnection.construct.php                       03-Dec-2023 00:02                2814
fannconnection.getfromneuron.php                   03-Dec-2023 00:02                2282
fannconnection.gettoneuron.php                     03-Dec-2023 00:02                2270
fannconnection.getweight.php                       03-Dec-2023 00:02                2238
fannconnection.setweight.php                       03-Dec-2023 00:02                2831
faq.build.php                                      03-Dec-2023 00:02               24132
faq.com.php                                        03-Dec-2023 00:02               11859
faq.databases.php                                  03-Dec-2023 00:02                7887
faq.general.php                                    03-Dec-2023 00:02                4811
faq.html.php                                       03-Dec-2023 00:02               20065
faq.installation.php                               03-Dec-2023 00:02               26129
faq.mailinglist.php                                03-Dec-2023 00:02               11216
faq.misc.php                                       03-Dec-2023 00:02                4551
faq.obtaining.php                                  03-Dec-2023 00:02               10806
faq.passwords.php                                  03-Dec-2023 00:02                9841
faq.php                                            03-Dec-2023 00:02                2067
faq.using.php                                      03-Dec-2023 00:02               22859
fdf.configuration.php                              03-Dec-2023 00:02                1288
fdf.constants.php                                  03-Dec-2023 00:02                6372
fdf.examples.php                                   03-Dec-2023 00:02                5982
fdf.installation.php                               03-Dec-2023 00:02                3458
fdf.requirements.php                               03-Dec-2023 00:02                1552
fdf.resources.php                                  03-Dec-2023 00:02                1742
fdf.setup.php                                      03-Dec-2023 00:02                1611
features.commandline.differences.php               03-Dec-2023 00:02               12233
features.commandline.ini.php                       03-Dec-2023 00:02                2203
features.commandline.interactive.php               03-Dec-2023 00:02                9024
features.commandline.introduction.php              03-Dec-2023 00:02                6629
features.commandline.io-streams.php                03-Dec-2023 00:02                5816
features.commandline.options.php                   03-Dec-2023 00:02               26389
features.commandline.php                           03-Dec-2023 00:02                2101
features.commandline.usage.php                     03-Dec-2023 00:02               14228
features.commandline.webserver.php                 03-Dec-2023 00:02               12971
features.connection-handling.php                   03-Dec-2023 00:02                5578
features.cookies.php                               03-Dec-2023 00:02                3047
features.dtrace.dtrace.php                         03-Dec-2023 00:02               14566
features.dtrace.introduction.php                   03-Dec-2023 00:02                3525
features.dtrace.php                                03-Dec-2023 00:02                1693
features.dtrace.systemtap.php                      03-Dec-2023 00:02                8199
features.file-upload.common-pitfalls.php           03-Dec-2023 00:02                5465
features.file-upload.errors.php                    03-Dec-2023 00:02                3757
features.file-upload.errors.seealso.php            03-Dec-2023 00:02                1357
features.file-upload.multiple.php                  03-Dec-2023 00:02                6658
features.file-upload.php                           03-Dec-2023 00:02                1923
features.file-upload.post-method.php               03-Dec-2023 00:02               16223
features.file-upload.put-method.php                03-Dec-2023 00:02                5823
features.gc.collecting-cycles.php                  03-Dec-2023 00:02                8346
features.gc.performance-considerations.php         03-Dec-2023 00:02               14251
features.gc.php                                    03-Dec-2023 00:02                1812
features.gc.refcounting-basics.php                 03-Dec-2023 00:02               21620
features.http-auth.php                             03-Dec-2023 00:02               23265
features.persistent-connections.php                03-Dec-2023 00:02                8826
features.php                                       03-Dec-2023 00:02                4291
features.remote-files.php                          03-Dec-2023 00:02                8030
features.session.security.management.php           03-Dec-2023 00:02               25257
features.sessions.php                              03-Dec-2023 00:02                1388
features.xforms.php                                03-Dec-2023 00:02                5404
ffi-ctype.getalignment.php                         03-Dec-2023 00:02                2257
ffi-ctype.getarrayelementtype.php                  03-Dec-2023 00:02                2401
ffi-ctype.getarraylength.php                       03-Dec-2023 00:02                2300
ffi-ctype.getattributes.php                        03-Dec-2023 00:02                2276
ffi-ctype.getenumkind.php                          03-Dec-2023 00:02                2252
ffi-ctype.getfuncabi.php                           03-Dec-2023 00:02                2260
ffi-ctype.getfuncparametercount.php                03-Dec-2023 00:02                2366
ffi-ctype.getfuncparametertype.php                 03-Dec-2023 00:02                2610
ffi-ctype.getfuncreturntype.php                    03-Dec-2023 00:02                2383
ffi-ctype.getkind.php                              03-Dec-2023 00:02                2214
ffi-ctype.getname.php                              03-Dec-2023 00:02                2218
ffi-ctype.getpointertype.php                       03-Dec-2023 00:02                2327
ffi-ctype.getsize.php                              03-Dec-2023 00:02                2232
ffi-ctype.getstructfieldnames.php                  03-Dec-2023 00:02                2342
ffi-ctype.getstructfieldoffset.php                 03-Dec-2023 00:02                2546
ffi-ctype.getstructfieldtype.php                   03-Dec-2023 00:02                2566
ffi.addr.php                                       03-Dec-2023 00:02                2754
ffi.alignof.php                                    03-Dec-2023 00:02                2826
ffi.arraytype.php                                  03-Dec-2023 00:02                4412
ffi.cast.php                                       03-Dec-2023 00:02                4891
ffi.cdef.php                                       03-Dec-2023 00:02                4161
ffi.configuration.php                              03-Dec-2023 00:02                4151
ffi.constants.php                                  03-Dec-2023 00:02                1118
ffi.examples-basic.php                             03-Dec-2023 00:02               15715
ffi.examples-callback.php                          03-Dec-2023 00:02                4715
ffi.examples-complete.php                          03-Dec-2023 00:02                5406
ffi.examples.php                                   03-Dec-2023 00:02                1468
ffi.free.php                                       03-Dec-2023 00:02                2371
ffi.installation.php                               03-Dec-2023 00:02                1462
ffi.isnull.php                                     03-Dec-2023 00:02                2438
ffi.load.php                                       03-Dec-2023 00:02                4115
ffi.memcmp.php                                     03-Dec-2023 00:02                3774
ffi.memcpy.php                                     03-Dec-2023 00:02                3113
ffi.memset.php                                     03-Dec-2023 00:02                2955
ffi.new.php                                        03-Dec-2023 00:02                5276
ffi.requirements.php                               03-Dec-2023 00:02                1311
ffi.resources.php                                  03-Dec-2023 00:02                1226
ffi.scope.php                                      03-Dec-2023 00:02                3061
ffi.setup.php                                      03-Dec-2023 00:02                1601
ffi.sizeof.php                                     03-Dec-2023 00:02                2667
ffi.string.php                                     03-Dec-2023 00:02                3674
ffi.type.php                                       03-Dec-2023 00:02                3370
ffi.typeof.php                                     03-Dec-2023 00:02                2818
fiber.construct.php                                03-Dec-2023 00:02                2337
fiber.getcurrent.php                               03-Dec-2023 00:02                2403
fiber.getreturn.php                                03-Dec-2023 00:02                2576
fiber.isrunning.php                                03-Dec-2023 00:02                2574
fiber.isstarted.php                                03-Dec-2023 00:02                2146
fiber.issuspended.php                              03-Dec-2023 00:02                2172
fiber.isterminated.php                             03-Dec-2023 00:02                2226
fiber.resume.php                                   03-Dec-2023 00:02                3339
fiber.start.php                                    03-Dec-2023 00:02                3065
fiber.suspend.php                                  03-Dec-2023 00:02                4049
fiber.throw.php                                    03-Dec-2023 00:02                3197
fibererror.construct.php                           03-Dec-2023 00:02                2152
fileinfo.configuration.php                         03-Dec-2023 00:02                1326
fileinfo.constants.php                             03-Dec-2023 00:02                4909
fileinfo.installation.php                          03-Dec-2023 00:02                1786
fileinfo.requirements.php                          03-Dec-2023 00:02                1271
fileinfo.resources.php                             03-Dec-2023 00:02                1434
fileinfo.setup.php                                 03-Dec-2023 00:02                1679
filesystem.configuration.php                       03-Dec-2023 00:02                7106
filesystem.constants.php                           03-Dec-2023 00:02                8903
filesystem.installation.php                        03-Dec-2023 00:02                1321
filesystem.requirements.php                        03-Dec-2023 00:02                1285
filesystem.resources.php                           03-Dec-2023 00:02                1450
filesystem.setup.php                               03-Dec-2023 00:02                1743
filesystemiterator.construct.php                   03-Dec-2023 00:02                7260
filesystemiterator.current.php                     03-Dec-2023 00:02                5301
filesystemiterator.getflags.php                    03-Dec-2023 00:02                3138
filesystemiterator.key.php                         03-Dec-2023 00:02                5034
filesystemiterator.next.php                        03-Dec-2023 00:02                4430
filesystemiterator.rewind.php                      03-Dec-2023 00:02                5059
filesystemiterator.setflags.php                    03-Dec-2023 00:02                6544
filter.configuration.php                           03-Dec-2023 00:02                4925
filter.constants.php                               03-Dec-2023 00:02               17985
filter.examples.php                                03-Dec-2023 00:02                1418
filter.examples.sanitization.php                   03-Dec-2023 00:02                5538
filter.examples.validation.php                     03-Dec-2023 00:02               10078
filter.filters.flags.php                           03-Dec-2023 00:02               12441
filter.filters.misc.php                            03-Dec-2023 00:02                1874
filter.filters.php                                 03-Dec-2023 00:02                1614
filter.filters.sanitize.php                        03-Dec-2023 00:02               10398
filter.filters.validate.php                        03-Dec-2023 00:02               11011
filter.installation.php                            03-Dec-2023 00:02                1385
filter.requirements.php                            03-Dec-2023 00:02                1257
filter.resources.php                               03-Dec-2023 00:02                1233
filter.setup.php                                   03-Dec-2023 00:02                1643
filteriterator.accept.php                          03-Dec-2023 00:02                5065
filteriterator.construct.php                       03-Dec-2023 00:02                3060
filteriterator.current.php                         03-Dec-2023 00:02                3024
filteriterator.key.php                             03-Dec-2023 00:02                2960
filteriterator.next.php                            03-Dec-2023 00:02                2900
filteriterator.rewind.php                          03-Dec-2023 00:02                3108
filteriterator.valid.php                           03-Dec-2023 00:02                2444
filters.compression.php                            03-Dec-2023 00:02               15510
filters.convert.php                                03-Dec-2023 00:02               11575
filters.encryption.php                             03-Dec-2023 00:02               41020
filters.php                                        03-Dec-2023 00:02                3359
filters.string.php                                 03-Dec-2023 00:02               10083
finfo.buffer.php                                   03-Dec-2023 00:02                2450
finfo.construct.php                                03-Dec-2023 00:02                2787
finfo.file.php                                     03-Dec-2023 00:02                2441
finfo.set-flags.php                                03-Dec-2023 00:02                1984
fpm.observability.php                              03-Dec-2023 00:02                1368
fpm.setup.php                                      03-Dec-2023 00:02                1290
fpm.status.php                                     03-Dec-2023 00:02                9938
ftp.configuration.php                              03-Dec-2023 00:02                1291
ftp.constants.php                                  03-Dec-2023 00:02                3518
ftp.examples-basic.php                             03-Dec-2023 00:02                4767
ftp.examples.php                                   03-Dec-2023 00:02                1288
ftp.installation.php                               03-Dec-2023 00:02                1538
ftp.requirements.php                               03-Dec-2023 00:02                1236
ftp.resources.php                                  03-Dec-2023 00:02                1494
ftp.setup.php                                      03-Dec-2023 00:02                1614
funchand.configuration.php                         03-Dec-2023 00:02                1326
funchand.constants.php                             03-Dec-2023 00:02                1268
funchand.installation.php                          03-Dec-2023 00:02                1307
funchand.requirements.php                          03-Dec-2023 00:02                1271
funchand.resources.php                             03-Dec-2023 00:02                1264
funchand.setup.php                                 03-Dec-2023 00:02                1714
funcref.php                                        03-Dec-2023 00:02               14817
function.abs.php                                   03-Dec-2023 00:02                5102
function.acos.php                                  03-Dec-2023 00:02                3447
function.acosh.php                                 03-Dec-2023 00:02                3193
function.addcslashes.php                           03-Dec-2023 00:02                7737
function.addslashes.php                            03-Dec-2023 00:02                6293
function.apache-child-terminate.php                03-Dec-2023 00:02                3392
function.apache-get-modules.php                    03-Dec-2023 00:02                3280
function.apache-get-version.php                    03-Dec-2023 00:02                3769
function.apache-getenv.php                         03-Dec-2023 00:02                4964
function.apache-lookup-uri.php                     03-Dec-2023 00:02                5898
function.apache-note.php                           03-Dec-2023 00:02                6939
function.apache-request-headers.php                03-Dec-2023 00:02                5656
function.apache-response-headers.php               03-Dec-2023 00:02                4337
function.apache-setenv.php                         03-Dec-2023 00:02                5413
function.apcu-add.php                              03-Dec-2023 00:02                8184
function.apcu-cache-info.php                       03-Dec-2023 00:02                6423
function.apcu-cas.php                              03-Dec-2023 00:02                8435
function.apcu-clear-cache.php                      03-Dec-2023 00:02                2491
function.apcu-dec.php                              03-Dec-2023 00:02                7854
function.apcu-delete.php                           03-Dec-2023 00:02                5814
function.apcu-enabled.php                          03-Dec-2023 00:02                2213
function.apcu-entry.php                            03-Dec-2023 00:02                8383
function.apcu-exists.php                           03-Dec-2023 00:02                6741
function.apcu-fetch.php                            03-Dec-2023 00:02                5651
function.apcu-inc.php                              03-Dec-2023 00:02                7838
function.apcu-key-info.php                         03-Dec-2023 00:02                4750
function.apcu-sma-info.php                         03-Dec-2023 00:02                4293
function.apcu-store.php                            03-Dec-2023 00:02                6995
function.array-change-key-case.php                 03-Dec-2023 00:02                5030
function.array-chunk.php                           03-Dec-2023 00:02                7210
function.array-column.php                          03-Dec-2023 00:02               16359
function.array-combine.php                         03-Dec-2023 00:02                7097
function.array-count-values.php                    03-Dec-2023 00:02                5497
function.array-diff-assoc.php                      03-Dec-2023 00:02               11262
function.array-diff-key.php                        03-Dec-2023 00:02               13110
function.array-diff-uassoc.php                     03-Dec-2023 00:02               12152
function.array-diff-ukey.php                       03-Dec-2023 00:02               12482
function.array-diff.php                            03-Dec-2023 00:02               12214
function.array-fill-keys.php                       03-Dec-2023 00:02                5218
function.array-fill.php                            03-Dec-2023 00:02                8772
function.array-filter.php                          03-Dec-2023 00:02               16168
function.array-flip.php                            03-Dec-2023 00:02                6977
function.array-intersect-assoc.php                 03-Dec-2023 00:02                8982
function.array-intersect-key.php                   03-Dec-2023 00:02               10476
function.array-intersect-uassoc.php                03-Dec-2023 00:02                9104
function.array-intersect-ukey.php                  03-Dec-2023 00:02               12239
function.array-intersect.php                       03-Dec-2023 00:02                6910
function.array-is-list.php                         03-Dec-2023 00:02                6766
function.array-key-exists.php                      03-Dec-2023 00:02                8443
function.array-key-first.php                       03-Dec-2023 00:02                6876
function.array-key-last.php                        03-Dec-2023 00:02                3144
function.array-keys.php                            03-Dec-2023 00:02                8208
function.array-map.php                             03-Dec-2023 00:02               27064
function.array-merge-recursive.php                 03-Dec-2023 00:02                6821
function.array-merge.php                           03-Dec-2023 00:02               12293
function.array-multisort.php                       03-Dec-2023 00:02               22695
function.array-pad.php                             03-Dec-2023 00:02                6940
function.array-pop.php                             03-Dec-2023 00:02                5651
function.array-product.php                         03-Dec-2023 00:02                4171
function.array-push.php                            03-Dec-2023 00:02                7090
function.array-rand.php                            03-Dec-2023 00:02                7838
function.array-reduce.php                          03-Dec-2023 00:02               10102
function.array-replace-recursive.php               03-Dec-2023 00:02               11100
function.array-replace.php                         03-Dec-2023 00:02                6685
function.array-reverse.php                         03-Dec-2023 00:02                5898
function.array-search.php                          03-Dec-2023 00:02                8142
function.array-shift.php                           03-Dec-2023 00:02                5730
function.array-slice.php                           03-Dec-2023 00:02               13439
function.array-splice.php                          03-Dec-2023 00:02               17562
function.array-sum.php                             03-Dec-2023 00:02                4839
function.array-udiff-assoc.php                     03-Dec-2023 00:02               14861
function.array-udiff-uassoc.php                    03-Dec-2023 00:02               16247
function.array-udiff.php                           03-Dec-2023 00:02               27261
function.array-uintersect-assoc.php                03-Dec-2023 00:02                8599
function.array-uintersect-uassoc.php               03-Dec-2023 00:02                8944
function.array-uintersect.php                      03-Dec-2023 00:02                8140
function.array-unique.php                          03-Dec-2023 00:02                9250
function.array-unshift.php                         03-Dec-2023 00:02               11033
function.array-values.php                          03-Dec-2023 00:02                4449
function.array-walk-recursive.php                  03-Dec-2023 00:02                7381
function.array-walk.php                            03-Dec-2023 00:02               13686
function.array.php                                 03-Dec-2023 00:02               11671
function.arsort.php                                03-Dec-2023 00:02                8717
function.asin.php                                  03-Dec-2023 00:02                3470
function.asinh.php                                 03-Dec-2023 00:02                3204
function.asort.php                                 03-Dec-2023 00:02                8708
function.assert-options.php                        03-Dec-2023 00:02               13661
function.assert.php                                03-Dec-2023 00:02               20615
function.atan.php                                  03-Dec-2023 00:02                3489
function.atan2.php                                 03-Dec-2023 00:02                3351
function.atanh.php                                 03-Dec-2023 00:02                3235
function.autoload.php                              03-Dec-2023 00:02                3132
function.base-convert.php                          03-Dec-2023 00:02                6366
function.base64-decode.php                         03-Dec-2023 00:02                4806
function.base64-encode.php                         03-Dec-2023 00:02                4627
function.basename.php                              03-Dec-2023 00:02                7493
function.bcadd.php                                 03-Dec-2023 00:02                5576
function.bccomp.php                                03-Dec-2023 00:02                5442
function.bcdiv.php                                 03-Dec-2023 00:02                5109
function.bcmod.php                                 03-Dec-2023 00:02                7169
function.bcmul.php                                 03-Dec-2023 00:02                6964
function.bcpow.php                                 03-Dec-2023 00:02                7001
function.bcpowmod.php                              03-Dec-2023 00:02                7134
function.bcscale.php                               03-Dec-2023 00:02                5216
function.bcsqrt.php                                03-Dec-2023 00:02                6030
function.bcsub.php                                 03-Dec-2023 00:02                5569
function.bin2hex.php                               03-Dec-2023 00:02                4399
function.bind-textdomain-codeset.php               03-Dec-2023 00:02                3098
function.bindec.php                                03-Dec-2023 00:02               14415
function.bindtextdomain.php                        03-Dec-2023 00:02                3891
function.boolval.php                               03-Dec-2023 00:02               10249
function.bzclose.php                               03-Dec-2023 00:02                2907
function.bzcompress.php                            03-Dec-2023 00:02                4895
function.bzdecompress.php                          03-Dec-2023 00:02                6081
function.bzerrno.php                               03-Dec-2023 00:02                3075
function.bzerror.php                               03-Dec-2023 00:02                4291
function.bzerrstr.php                              03-Dec-2023 00:02                3088
function.bzflush.php                               03-Dec-2023 00:02                3199
function.bzopen.php                                03-Dec-2023 00:02                4870
function.bzread.php                                03-Dec-2023 00:02                6255
function.bzwrite.php                               03-Dec-2023 00:02                5963
function.cal-days-in-month.php                     03-Dec-2023 00:02                4442
function.cal-from-jd.php                           03-Dec-2023 00:02                6869
function.cal-info.php                              03-Dec-2023 00:02                5665
function.cal-to-jd.php                             03-Dec-2023 00:02                5585
function.call-user-func-array.php                  03-Dec-2023 00:02               17384
function.call-user-func.php                        03-Dec-2023 00:02               14357
function.ceil.php                                  03-Dec-2023 00:02                4901
function.chdir.php                                 03-Dec-2023 00:02                5270
function.checkdate.php                             03-Dec-2023 00:02                5266
function.checkdnsrr.php                            03-Dec-2023 00:02                4985
function.chgrp.php                                 03-Dec-2023 00:02                6499
function.chmod.php                                 03-Dec-2023 00:02                8764
function.chop.php                                  03-Dec-2023 00:02                2047
function.chown.php                                 03-Dec-2023 00:02                6555
function.chr.php                                   03-Dec-2023 00:02                8495
function.chroot.php                                03-Dec-2023 00:02                4502
function.chunk-split.php                           03-Dec-2023 00:02                5121
function.class-alias.php                           03-Dec-2023 00:02                7970
function.class-exists.php                          03-Dec-2023 00:02                6898
function.class-implements.php                      03-Dec-2023 00:02                6970
function.class-parents.php                         03-Dec-2023 00:02                6640
function.class-uses.php                            03-Dec-2023 00:02                5944
function.clearstatcache.php                        03-Dec-2023 00:02               10721
function.cli-get-process-title.php                 03-Dec-2023 00:02                4274
function.cli-set-process-title.php                 03-Dec-2023 00:02                5289
function.closedir.php                              03-Dec-2023 00:02                4678
function.closelog.php                              03-Dec-2023 00:02                2806
function.com-create-guid.php                       03-Dec-2023 00:02                2736
function.com-event-sink.php                        03-Dec-2023 00:02                9989
function.com-get-active-object.php                 03-Dec-2023 00:02                5405
function.com-load-typelib.php                      03-Dec-2023 00:02                4880
function.com-message-pump.php                      03-Dec-2023 00:02                3787
function.com-print-typeinfo.php                    03-Dec-2023 00:02                4656
function.commonmark-parse.php                      03-Dec-2023 00:02                3543
function.commonmark-render-html.php                03-Dec-2023 00:02                3951
function.commonmark-render-latex.php               03-Dec-2023 00:02                4227
function.commonmark-render-man.php                 03-Dec-2023 00:02                4209
function.commonmark-render-xml.php                 03-Dec-2023 00:02                3908
function.commonmark-render.php                     03-Dec-2023 00:02                4155
function.compact.php                               03-Dec-2023 00:02                7863
function.connection-aborted.php                    03-Dec-2023 00:02                2832
function.connection-status.php                     03-Dec-2023 00:02                3094
function.constant.php                              03-Dec-2023 00:02                6174
function.convert-cyr-string.php                    03-Dec-2023 00:02                4939
function.convert-uudecode.php                      03-Dec-2023 00:02                4332
function.convert-uuencode.php                      03-Dec-2023 00:02                5253
function.copy.php                                  03-Dec-2023 00:02                5776
function.cos.php                                   03-Dec-2023 00:02                3925
function.cosh.php                                  03-Dec-2023 00:02                3102
function.count-chars.php                           03-Dec-2023 00:02                7133
function.count.php                                 03-Dec-2023 00:02               15921
function.crc32.php                                 03-Dec-2023 00:02                7191
function.create-function.php                       03-Dec-2023 00:02               17215
function.crypt.php                                 03-Dec-2023 00:02               12314
function.ctype-alnum.php                           03-Dec-2023 00:02                6633
function.ctype-alpha.php                           03-Dec-2023 00:02                6955
function.ctype-cntrl.php                           03-Dec-2023 00:02                6576
function.ctype-digit.php                           03-Dec-2023 00:02                8914
function.ctype-graph.php                           03-Dec-2023 00:02                7306
function.ctype-lower.php                           03-Dec-2023 00:02                6715
function.ctype-print.php                           03-Dec-2023 00:02                7381
function.ctype-punct.php                           03-Dec-2023 00:02                6643
function.ctype-space.php                           03-Dec-2023 00:02                7438
function.ctype-upper.php                           03-Dec-2023 00:02                6751
function.ctype-xdigit.php                          03-Dec-2023 00:02                6486
function.cubrid-affected-rows.php                  03-Dec-2023 00:02                9075
function.cubrid-bind.php                           03-Dec-2023 00:02               20407
function.cubrid-client-encoding.php                03-Dec-2023 00:02                5071
function.cubrid-close-prepare.php                  03-Dec-2023 00:02                6092
function.cubrid-close-request.php                  03-Dec-2023 00:02                6103
function.cubrid-close.php                          03-Dec-2023 00:02                6232
function.cubrid-col-get.php                        03-Dec-2023 00:02                8235
function.cubrid-col-size.php                       03-Dec-2023 00:02                8332
function.cubrid-column-names.php                   03-Dec-2023 00:02                8376
function.cubrid-column-types.php                   03-Dec-2023 00:02                8330
function.cubrid-commit.php                         03-Dec-2023 00:02               15121
function.cubrid-connect-with-url.php               03-Dec-2023 00:02               14913
function.cubrid-connect.php                        03-Dec-2023 00:02               11850
function.cubrid-current-oid.php                    03-Dec-2023 00:02                5786
function.cubrid-data-seek.php                      03-Dec-2023 00:02                7136
function.cubrid-db-name.php                        03-Dec-2023 00:02                6243
function.cubrid-disconnect.php                     03-Dec-2023 00:02                6945
function.cubrid-drop.php                           03-Dec-2023 00:02               11142
function.cubrid-errno.php                          03-Dec-2023 00:02                6684
function.cubrid-error-code-facility.php            03-Dec-2023 00:02                5752
function.cubrid-error-code.php                     03-Dec-2023 00:02                5662
function.cubrid-error-msg.php                      03-Dec-2023 00:02                5110
function.cubrid-error.php                          03-Dec-2023 00:02                6242
function.cubrid-execute.php                        03-Dec-2023 00:02               13956
function.cubrid-fetch-array.php                    03-Dec-2023 00:02                9658
function.cubrid-fetch-assoc.php                    03-Dec-2023 00:02                8843
function.cubrid-fetch-field.php                    03-Dec-2023 00:02               13851
function.cubrid-fetch-lengths.php                  03-Dec-2023 00:02                5904
function.cubrid-fetch-object.php                   03-Dec-2023 00:02               11618
function.cubrid-fetch-row.php                      03-Dec-2023 00:02                8767
function.cubrid-fetch.php                          03-Dec-2023 00:02                9916
function.cubrid-field-flags.php                    03-Dec-2023 00:02                7471
function.cubrid-field-len.php                      03-Dec-2023 00:02                7977
function.cubrid-field-name.php                     03-Dec-2023 00:02                6886
function.cubrid-field-seek.php                     03-Dec-2023 00:02               10566
function.cubrid-field-table.php                    03-Dec-2023 00:02                7069
function.cubrid-field-type.php                     03-Dec-2023 00:02                7131
function.cubrid-free-result.php                    03-Dec-2023 00:02                5569
function.cubrid-get-autocommit.php                 03-Dec-2023 00:02                3550
function.cubrid-get-charset.php                    03-Dec-2023 00:02                4798
function.cubrid-get-class-name.php                 03-Dec-2023 00:02                6087
function.cubrid-get-client-info.php                03-Dec-2023 00:02                7976
function.cubrid-get-db-parameter.php               03-Dec-2023 00:02               14099
function.cubrid-get-query-timeout.php              03-Dec-2023 00:02                6516
function.cubrid-get-server-info.php                03-Dec-2023 00:02                8208
function.cubrid-get.php                            03-Dec-2023 00:02                9745
function.cubrid-insert-id.php                      03-Dec-2023 00:02                6917
function.cubrid-is-instance.php                    03-Dec-2023 00:02                6992
function.cubrid-list-dbs.php                       03-Dec-2023 00:02                4324
function.cubrid-load-from-glo.php                  03-Dec-2023 00:02                6579
function.cubrid-lob-close.php                      03-Dec-2023 00:02                7085
function.cubrid-lob-export.php                     03-Dec-2023 00:02                7542
function.cubrid-lob-get.php                        03-Dec-2023 00:02                7451
function.cubrid-lob-send.php                       03-Dec-2023 00:02                6773
function.cubrid-lob-size.php                       03-Dec-2023 00:02                5697
function.cubrid-lob2-bind.php                      03-Dec-2023 00:02                9448
function.cubrid-lob2-close.php                     03-Dec-2023 00:02                3189
function.cubrid-lob2-export.php                    03-Dec-2023 00:02                8480
function.cubrid-lob2-import.php                    03-Dec-2023 00:02                8349
function.cubrid-lob2-new.php                       03-Dec-2023 00:02                3697
function.cubrid-lob2-read.php                      03-Dec-2023 00:02               13505
function.cubrid-lob2-seek.php                      03-Dec-2023 00:02               11004
function.cubrid-lob2-seek64.php                    03-Dec-2023 00:02               12422
function.cubrid-lob2-size.php                      03-Dec-2023 00:02                4230
function.cubrid-lob2-size64.php                    03-Dec-2023 00:02                4408
function.cubrid-lob2-tell.php                      03-Dec-2023 00:02                4249
function.cubrid-lob2-tell64.php                    03-Dec-2023 00:02                4445
function.cubrid-lob2-write.php                     03-Dec-2023 00:02               13818
function.cubrid-lock-read.php                      03-Dec-2023 00:02                8839
function.cubrid-lock-write.php                     03-Dec-2023 00:02                9227
function.cubrid-move-cursor.php                    03-Dec-2023 00:02                9159
function.cubrid-new-glo.php                        03-Dec-2023 00:02                6679
function.cubrid-next-result.php                    03-Dec-2023 00:02               16054
function.cubrid-num-cols.php                       03-Dec-2023 00:02                5793
function.cubrid-num-fields.php                     03-Dec-2023 00:02                5471
function.cubrid-num-rows.php                       03-Dec-2023 00:02                6992
function.cubrid-pconnect-with-url.php              03-Dec-2023 00:02               14347
function.cubrid-pconnect.php                       03-Dec-2023 00:02               11738
function.cubrid-ping.php                           03-Dec-2023 00:02                5838
function.cubrid-prepare.php                        03-Dec-2023 00:02                9956
function.cubrid-put.php                            03-Dec-2023 00:02               11124
function.cubrid-query.php                          03-Dec-2023 00:02               14221
function.cubrid-real-escape-string.php             03-Dec-2023 00:02                7936
function.cubrid-result.php                         03-Dec-2023 00:02                7191
function.cubrid-rollback.php                       03-Dec-2023 00:02               14401
function.cubrid-save-to-glo.php                    03-Dec-2023 00:02                6492
function.cubrid-schema.php                         03-Dec-2023 00:02               20070
function.cubrid-send-glo.php                       03-Dec-2023 00:02                6015
function.cubrid-seq-drop.php                       03-Dec-2023 00:02                9393
function.cubrid-seq-insert.php                     03-Dec-2023 00:02                9843
function.cubrid-seq-put.php                        03-Dec-2023 00:02                9770
function.cubrid-set-add.php                        03-Dec-2023 00:02                9148
function.cubrid-set-autocommit.php                 03-Dec-2023 00:02                3942
function.cubrid-set-db-parameter.php               03-Dec-2023 00:02                7868
function.cubrid-set-drop.php                       03-Dec-2023 00:02                9125
function.cubrid-set-query-timeout.php              03-Dec-2023 00:02                3286
function.cubrid-unbuffered-query.php               03-Dec-2023 00:02                6705
function.cubrid-version.php                        03-Dec-2023 00:02                8612
function.curl-close.php                            03-Dec-2023 00:02                5946
function.curl-copy-handle.php                      03-Dec-2023 00:02                6167
function.curl-errno.php                            03-Dec-2023 00:02                5943
function.curl-error.php                            03-Dec-2023 00:02                5846
function.curl-escape.php                           03-Dec-2023 00:02                7309
function.curl-exec.php                             03-Dec-2023 00:02                6860
function.curl-getinfo.php                          03-Dec-2023 00:02               30856
function.curl-init.php                             03-Dec-2023 00:02                6887
function.curl-multi-add-handle.php                 03-Dec-2023 00:02               10171
function.curl-multi-close.php                      03-Dec-2023 00:02                9485
function.curl-multi-errno.php                      03-Dec-2023 00:02                3766
function.curl-multi-exec.php                       03-Dec-2023 00:02               10194
function.curl-multi-getcontent.php                 03-Dec-2023 00:02                4009
function.curl-multi-info-read.php                  03-Dec-2023 00:02               11760
function.curl-multi-init.php                       03-Dec-2023 00:02                8684
function.curl-multi-remove-handle.php              03-Dec-2023 00:02                5389
function.curl-multi-select.php                     03-Dec-2023 00:02                4219
function.curl-multi-setopt.php                     03-Dec-2023 00:02               11355
function.curl-multi-strerror.php                   03-Dec-2023 00:02                6952
function.curl-pause.php                            03-Dec-2023 00:02                3669
function.curl-reset.php                            03-Dec-2023 00:02                6375
function.curl-setopt-array.php                     03-Dec-2023 00:02                7337
function.curl-setopt.php                           03-Dec-2023 00:02              139131
function.curl-share-close.php                      03-Dec-2023 00:02                8047
function.curl-share-errno.php                      03-Dec-2023 00:02                3792
function.curl-share-init.php                       03-Dec-2023 00:02                7707
function.curl-share-setopt.php                     03-Dec-2023 00:02               10190
function.curl-share-strerror.php                   03-Dec-2023 00:02                3290
function.curl-strerror.php                         03-Dec-2023 00:02                6074
function.curl-unescape.php                         03-Dec-2023 00:02                7752
function.curl-version.php                          03-Dec-2023 00:02                6782
function.curl_upkeep.php                           03-Dec-2023 00:02                6819
function.current.php                               03-Dec-2023 00:02               10850
function.date-add.php                              03-Dec-2023 00:02                1716
function.date-create-from-format.php               03-Dec-2023 00:02                1891
function.date-create-immutable-from-format.php     03-Dec-2023 00:02                2003
function.date-create-immutable.php                 03-Dec-2023 00:02                4004
function.date-create.php                           03-Dec-2023 00:02                4195
function.date-date-set.php                         03-Dec-2023 00:02                1775
function.date-default-timezone-get.php             03-Dec-2023 00:02                6887
function.date-default-timezone-set.php             03-Dec-2023 00:02                5571
function.date-diff.php                             03-Dec-2023 00:02                1735
function.date-format.php                           03-Dec-2023 00:02                1743
function.date-get-last-errors.php                  03-Dec-2023 00:02                1908
function.date-interval-create-from-date-string.php 03-Dec-2023 00:02                2019
function.date-interval-format.php                  03-Dec-2023 00:02                1870
function.date-isodate-set.php                      03-Dec-2023 00:02                1798
function.date-modify.php                           03-Dec-2023 00:02                1747
function.date-offset-get.php                       03-Dec-2023 00:02                1791
function.date-parse-from-format.php                03-Dec-2023 00:02               13685
function.date-parse.php                            03-Dec-2023 00:02               19142
function.date-sub.php                              03-Dec-2023 00:02                2351
function.date-sun-info.php                         03-Dec-2023 00:02               15444
function.date-sunrise.php                          03-Dec-2023 00:02               13032
function.date-sunset.php                           03-Dec-2023 00:02               13043
function.date-time-set.php                         03-Dec-2023 00:02                1761
function.date-timestamp-get.php                    03-Dec-2023 00:02                1820
function.date-timestamp-set.php                    03-Dec-2023 00:02                1828
function.date-timezone-get.php                     03-Dec-2023 00:02                1817
function.date-timezone-set.php                     03-Dec-2023 00:02                1789
function.date.php                                  03-Dec-2023 00:02               21393
function.db2-autocommit.php                        03-Dec-2023 00:02               10451
function.db2-bind-param.php                        03-Dec-2023 00:02               21832
function.db2-client-info.php                       03-Dec-2023 00:02               11471
function.db2-close.php                             03-Dec-2023 00:02                5424
function.db2-column-privileges.php                 03-Dec-2023 00:02                8388
function.db2-columns.php                           03-Dec-2023 00:02               10284
function.db2-commit.php                            03-Dec-2023 00:02                3511
function.db2-conn-error.php                        03-Dec-2023 00:02                6689
function.db2-conn-errormsg.php                     03-Dec-2023 00:02                6481
function.db2-connect.php                           03-Dec-2023 00:02               38111
function.db2-cursor-type.php                       03-Dec-2023 00:02                3072
function.db2-escape-string.php                     03-Dec-2023 00:02                7418
function.db2-exec.php                              03-Dec-2023 00:02               25817
function.db2-execute.php                           03-Dec-2023 00:02               25294
function.db2-fetch-array.php                       03-Dec-2023 00:02               11023
function.db2-fetch-assoc.php                       03-Dec-2023 00:02               11039
function.db2-fetch-both.php                        03-Dec-2023 00:02               11572
function.db2-fetch-object.php                      03-Dec-2023 00:02                8840
function.db2-fetch-row.php                         03-Dec-2023 00:02               16010
function.db2-field-display-size.php                03-Dec-2023 00:02                4873
function.db2-field-name.php                        03-Dec-2023 00:02                4759
function.db2-field-num.php                         03-Dec-2023 00:02                4769
function.db2-field-precision.php                   03-Dec-2023 00:02                4801
function.db2-field-scale.php                       03-Dec-2023 00:02                4763
function.db2-field-type.php                        03-Dec-2023 00:02                4764
function.db2-field-width.php                       03-Dec-2023 00:02                4971
function.db2-foreign-keys.php                      03-Dec-2023 00:02                8715
function.db2-free-result.php                       03-Dec-2023 00:02                3154
function.db2-free-stmt.php                         03-Dec-2023 00:02                3142
function.db2-get-option.php                        03-Dec-2023 00:02               23876
function.db2-last-insert-id.php                    03-Dec-2023 00:02                7918
function.db2-lob-read.php                          03-Dec-2023 00:02               16110
function.db2-next-result.php                       03-Dec-2023 00:02                8566
function.db2-num-fields.php                        03-Dec-2023 00:02                7037
function.db2-num-rows.php                          03-Dec-2023 00:02                4403
function.db2-pclose.php                            03-Dec-2023 00:02                5602
function.db2-pconnect.php                          03-Dec-2023 00:02               31371
function.db2-prepare.php                           03-Dec-2023 00:02               10297
function.db2-primary-keys.php                      03-Dec-2023 00:02                7349
function.db2-procedure-columns.php                 03-Dec-2023 00:02               11404
function.db2-procedures.php                        03-Dec-2023 00:02                7708
function.db2-result.php                            03-Dec-2023 00:02                7751
function.db2-rollback.php                          03-Dec-2023 00:02                9061
function.db2-server-info.php                       03-Dec-2023 00:02               22031
function.db2-set-option.php                        03-Dec-2023 00:02               65428
function.db2-special-columns.php                   03-Dec-2023 00:02                9855
function.db2-statistics.php                        03-Dec-2023 00:02               11789
function.db2-stmt-error.php                        03-Dec-2023 00:02                4442
function.db2-stmt-errormsg.php                     03-Dec-2023 00:02                4073
function.db2-table-privileges.php                  03-Dec-2023 00:02                8056
function.db2-tables.php                            03-Dec-2023 00:02                8198
function.dba-close.php                             03-Dec-2023 00:02                3122
function.dba-delete.php                            03-Dec-2023 00:02                3831
function.dba-exists.php                            03-Dec-2023 00:02                3862
function.dba-fetch.php                             03-Dec-2023 00:02                6430
function.dba-firstkey.php                          03-Dec-2023 00:02                3470
function.dba-handlers.php                          03-Dec-2023 00:02                5252
function.dba-insert.php                            03-Dec-2023 00:02                4413
function.dba-key-split.php                         03-Dec-2023 00:02                3595
function.dba-list.php                              03-Dec-2023 00:02                2151
function.dba-nextkey.php                           03-Dec-2023 00:02                3392
function.dba-open.php                              03-Dec-2023 00:02               12737
function.dba-optimize.php                          03-Dec-2023 00:02                2984
function.dba-popen.php                             03-Dec-2023 00:02                8058
function.dba-replace.php                           03-Dec-2023 00:02                4241
function.dba-sync.php                              03-Dec-2023 00:02                3004
function.dbase-add-record.php                      03-Dec-2023 00:02                6067
function.dbase-close.php                           03-Dec-2023 00:02                4438
function.dbase-create.php                          03-Dec-2023 00:02                6351
function.dbase-delete-record.php                   03-Dec-2023 00:02                4144
function.dbase-get-header-info.php                 03-Dec-2023 00:02                6146
function.dbase-get-record-with-names.php           03-Dec-2023 00:02                7223
function.dbase-get-record.php                      03-Dec-2023 00:02                4319
function.dbase-numfields.php                       03-Dec-2023 00:02                5130
function.dbase-numrecords.php                      03-Dec-2023 00:02                6633
function.dbase-open.php                            03-Dec-2023 00:02                5382
function.dbase-pack.php                            03-Dec-2023 00:02                5445
function.dbase-replace-record.php                  03-Dec-2023 00:02                7392
function.dcgettext.php                             03-Dec-2023 00:02                3239
function.dcngettext.php                            03-Dec-2023 00:02                3776
function.debug-backtrace.php                       03-Dec-2023 00:02               11238
function.debug-print-backtrace.php                 03-Dec-2023 00:02                5218
function.debug-zval-dump.php                       03-Dec-2023 00:02                9998
function.decbin.php                                03-Dec-2023 00:02                8624
function.dechex.php                                03-Dec-2023 00:02                4484
function.decoct.php                                03-Dec-2023 00:02                4475
function.define.php                                03-Dec-2023 00:02               10867
function.defined.php                               03-Dec-2023 00:02                7597
function.deflate-add.php                           03-Dec-2023 00:02                5076
function.deflate-init.php                          03-Dec-2023 00:02                7117
function.deg2rad.php                               03-Dec-2023 00:02                3949
function.delete.php                                03-Dec-2023 00:02                2474
function.dgettext.php                              03-Dec-2023 00:02                3034
function.die.php                                   03-Dec-2023 00:02                1545
function.dio-close.php                             03-Dec-2023 00:02                3899
function.dio-fcntl.php                             03-Dec-2023 00:02                8674
function.dio-open.php                              03-Dec-2023 00:02                7409
function.dio-read.php                              03-Dec-2023 00:02                3332
function.dio-seek.php                              03-Dec-2023 00:02                6991
function.dio-stat.php                              03-Dec-2023 00:02                4090
function.dio-tcsetattr.php                         03-Dec-2023 00:02                6686
function.dio-truncate.php                          03-Dec-2023 00:02                3449
function.dio-write.php                             03-Dec-2023 00:02                3608
function.dir.php                                   03-Dec-2023 00:02                6842
function.dirname.php                               03-Dec-2023 00:02                9420
function.disk-free-space.php                       03-Dec-2023 00:02                5388
function.disk-total-space.php                      03-Dec-2023 00:02                4936
function.diskfreespace.php                         03-Dec-2023 00:02                1780
function.dl.php                                    03-Dec-2023 00:02                9680
function.dngettext.php                             03-Dec-2023 00:02                3594
function.dns-check-record.php                      03-Dec-2023 00:02                1729
function.dns-get-mx.php                            03-Dec-2023 00:02                1702
function.dns-get-record.php                        03-Dec-2023 00:02               21988
function.dom-import-simplexml.php                  03-Dec-2023 00:02                6915
function.doubleval.php                             03-Dec-2023 00:02                1715
function.each.php                                  03-Dec-2023 00:02               11265
function.easter-date.php                           03-Dec-2023 00:02               13410
function.easter-days.php                           03-Dec-2023 00:02                6726
function.echo.php                                  03-Dec-2023 00:02               17113
function.eio-busy.php                              03-Dec-2023 00:02                4456
function.eio-cancel.php                            03-Dec-2023 00:02                7162
function.eio-chmod.php                             03-Dec-2023 00:02                5705
function.eio-chown.php                             03-Dec-2023 00:02                5852
function.eio-close.php                             03-Dec-2023 00:02                5289
function.eio-custom.php                            03-Dec-2023 00:02                9856
function.eio-dup2.php                              03-Dec-2023 00:02                5369
function.eio-event-loop.php                        03-Dec-2023 00:02                5564
function.eio-fallocate.php                         03-Dec-2023 00:02                6793
function.eio-fchmod.php                            03-Dec-2023 00:02                5762
function.eio-fchown.php                            03-Dec-2023 00:02                6010
function.eio-fdatasync.php                         03-Dec-2023 00:02                5188
function.eio-fstat.php                             03-Dec-2023 00:02               11167
function.eio-fstatvfs.php                          03-Dec-2023 00:02                5331
function.eio-fsync.php                             03-Dec-2023 00:02                5305
function.eio-ftruncate.php                         03-Dec-2023 00:02                5780
function.eio-futime.php                            03-Dec-2023 00:02                6032
function.eio-get-event-stream.php                  03-Dec-2023 00:02                7977
function.eio-get-last-error.php                    03-Dec-2023 00:02                2946
function.eio-grp-add.php                           03-Dec-2023 00:02               11280
function.eio-grp-cancel.php                        03-Dec-2023 00:02                3047
function.eio-grp-limit.php                         03-Dec-2023 00:02                2892
function.eio-grp.php                               03-Dec-2023 00:02               11556
function.eio-init.php                              03-Dec-2023 00:02                2538
function.eio-link.php                              03-Dec-2023 00:02               12061
function.eio-lstat.php                             03-Dec-2023 00:02                9453
function.eio-mkdir.php                             03-Dec-2023 00:02                8683
function.eio-mknod.php                             03-Dec-2023 00:02               10546
function.eio-nop.php                               03-Dec-2023 00:02                4917
function.eio-npending.php                          03-Dec-2023 00:02                2964
function.eio-nready.php                            03-Dec-2023 00:02                2712
function.eio-nreqs.php                             03-Dec-2023 00:02                5446
function.eio-nthreads.php                          03-Dec-2023 00:02                3431
function.eio-open.php                              03-Dec-2023 00:02               10911
function.eio-poll.php                              03-Dec-2023 00:02                5560
function.eio-read.php                              03-Dec-2023 00:02               12125
function.eio-readahead.php                         03-Dec-2023 00:02                5749
function.eio-readdir.php                           03-Dec-2023 00:02               15420
function.eio-readlink.php                          03-Dec-2023 00:02               11748
function.eio-realpath.php                          03-Dec-2023 00:02                5052
function.eio-rename.php                            03-Dec-2023 00:02                8751
function.eio-rmdir.php                             03-Dec-2023 00:02                7768
function.eio-seek.php                              03-Dec-2023 00:02                6442
function.eio-sendfile.php                          03-Dec-2023 00:02                6018
function.eio-set-max-idle.php                      03-Dec-2023 00:02                3071
function.eio-set-max-parallel.php                  03-Dec-2023 00:02                3120
function.eio-set-max-poll-reqs.php                 03-Dec-2023 00:02                2393
function.eio-set-max-poll-time.php                 03-Dec-2023 00:02                2463
function.eio-set-min-parallel.php                  03-Dec-2023 00:02                3109
function.eio-stat.php                              03-Dec-2023 00:02                9430
function.eio-statvfs.php                           03-Dec-2023 00:02                7881
function.eio-symlink.php                           03-Dec-2023 00:02               10326
function.eio-sync-file-range.php                   03-Dec-2023 00:02                6588
function.eio-sync.php                              03-Dec-2023 00:02                2728
function.eio-syncfs.php                            03-Dec-2023 00:02                4871
function.eio-truncate.php                          03-Dec-2023 00:02                5656
function.eio-unlink.php                            03-Dec-2023 00:02                4876
function.eio-utime.php                             03-Dec-2023 00:02                5640
function.eio-write.php                             03-Dec-2023 00:02                6403
function.empty.php                                 03-Dec-2023 00:02                9408
function.enchant-broker-describe.php               03-Dec-2023 00:02                5845
function.enchant-broker-dict-exists.php            03-Dec-2023 00:02                5509
function.enchant-broker-free-dict.php              03-Dec-2023 00:02                4626
function.enchant-broker-free.php                   03-Dec-2023 00:02                4190
function.enchant-broker-get-dict-path.php          03-Dec-2023 00:02                4996
function.enchant-broker-get-error.php              03-Dec-2023 00:02                3524
function.enchant-broker-init.php                   03-Dec-2023 00:02                3409
function.enchant-broker-list-dicts.php             03-Dec-2023 00:02                6726
function.enchant-broker-request-dict.php           03-Dec-2023 00:02                6940
function.enchant-broker-request-pwl-dict.php       03-Dec-2023 00:02                5263
function.enchant-broker-set-dict-path.php          03-Dec-2023 00:02                5205
function.enchant-broker-set-ordering.php           03-Dec-2023 00:02                4519
function.enchant-dict-add-to-personal.php          03-Dec-2023 00:02                2175
function.enchant-dict-add-to-session.php           03-Dec-2023 00:02                4358
function.enchant-dict-add.php                      03-Dec-2023 00:02                6182
function.enchant-dict-check.php                    03-Dec-2023 00:02                3919
function.enchant-dict-describe.php                 03-Dec-2023 00:02                6272
function.enchant-dict-get-error.php                03-Dec-2023 00:02                3724
function.enchant-dict-is-added.php                 03-Dec-2023 00:02                4268
function.enchant-dict-is-in-session.php            03-Dec-2023 00:02                2161
function.enchant-dict-quick-check.php              03-Dec-2023 00:02                7852
function.enchant-dict-store-replacement.php        03-Dec-2023 00:02                4461
function.enchant-dict-suggest.php                  03-Dec-2023 00:02                7347
function.end.php                                   03-Dec-2023 00:02                6542
function.enum-exists.php                           03-Dec-2023 00:02                5161
function.error-clear-last.php                      03-Dec-2023 00:02                4565
function.error-get-last.php                        03-Dec-2023 00:02                4747
function.error-log.php                             03-Dec-2023 00:02               10313
function.error-reporting.php                       03-Dec-2023 00:02                9169
function.escapeshellarg.php                        03-Dec-2023 00:02                5031
function.escapeshellcmd.php                        03-Dec-2023 00:02                6318
function.eval.php                                  03-Dec-2023 00:02                8875
function.exec.php                                  03-Dec-2023 00:02                7142
function.exif-imagetype.php                        03-Dec-2023 00:02                7071
function.exif-read-data.php                        03-Dec-2023 00:02               21152
function.exif-tagname.php                          03-Dec-2023 00:02                4535
function.exif-thumbnail.php                        03-Dec-2023 00:02                7634
function.exit.php                                  03-Dec-2023 00:02                8924
function.exp.php                                   03-Dec-2023 00:02                4168
function.expect-expectl.php                        03-Dec-2023 00:02               10521
function.expect-popen.php                          03-Dec-2023 00:02                4453
function.explode.php                               03-Dec-2023 00:02               14707
function.expm1.php                                 03-Dec-2023 00:02                3328
function.extension-loaded.php                      03-Dec-2023 00:02                5889
function.extract.php                               03-Dec-2023 00:02               12947
function.ezmlm-hash.php                            03-Dec-2023 00:02                4112
function.fann-cascadetrain-on-data.php             03-Dec-2023 00:02                6132
function.fann-cascadetrain-on-file.php             03-Dec-2023 00:02                5180
function.fann-clear-scaling-params.php             03-Dec-2023 00:02                2499
function.fann-copy.php                             03-Dec-2023 00:02                3091
function.fann-create-from-file.php                 03-Dec-2023 00:02                3103
function.fann-create-shortcut-array.php            03-Dec-2023 00:02                3957
function.fann-create-shortcut.php                  03-Dec-2023 00:02                4869
function.fann-create-sparse-array.php              03-Dec-2023 00:02                4542
function.fann-create-sparse.php                    03-Dec-2023 00:02                5192
function.fann-create-standard-array.php            03-Dec-2023 00:02                4270
function.fann-create-standard.php                  03-Dec-2023 00:02                4937
function.fann-create-train-from-callback.php       03-Dec-2023 00:02                8904
function.fann-create-train.php                     03-Dec-2023 00:02                4382
function.fann-descale-input.php                    03-Dec-2023 00:02                3535
function.fann-descale-output.php                   03-Dec-2023 00:02                3551
function.fann-descale-train.php                    03-Dec-2023 00:02                3505
function.fann-destroy-train.php                    03-Dec-2023 00:02                2463
function.fann-destroy.php                          03-Dec-2023 00:02                2486
function.fann-duplicate-train-data.php             03-Dec-2023 00:02                2638
function.fann-get-activation-function.php          03-Dec-2023 00:02                5035
function.fann-get-activation-steepness.php         03-Dec-2023 00:02                5448
function.fann-get-bias-array.php                   03-Dec-2023 00:02                2460
function.fann-get-bit-fail-limit.php               03-Dec-2023 00:02                3583
function.fann-get-bit-fail.php                     03-Dec-2023 00:02                4806
function.fann-get-cascade-activation-functions-..> 03-Dec-2023 00:02                3695
function.fann-get-cascade-activation-functions.php 03-Dec-2023 00:02                4151
function.fann-get-cascade-activation-steepnesse..> 03-Dec-2023 00:02                3751
function.fann-get-cascade-activation-steepnesse..> 03-Dec-2023 00:02                3902
function.fann-get-cascade-candidate-change-frac..> 03-Dec-2023 00:02                5023
function.fann-get-cascade-candidate-limit.php      03-Dec-2023 00:02                3383
function.fann-get-cascade-candidate-stagnation-..> 03-Dec-2023 00:02                4134
function.fann-get-cascade-max-cand-epochs.php      03-Dec-2023 00:02                3265
function.fann-get-cascade-max-out-epochs.php       03-Dec-2023 00:02                3186
function.fann-get-cascade-min-cand-epochs.php      03-Dec-2023 00:02                3592
function.fann-get-cascade-min-out-epochs.php       03-Dec-2023 00:02                3549
function.fann-get-cascade-num-candidate-groups.php 03-Dec-2023 00:02                3663
function.fann-get-cascade-num-candidates.php       03-Dec-2023 00:02                5857
function.fann-get-cascade-output-change-fractio..> 03-Dec-2023 00:02                4951
function.fann-get-cascade-output-stagnation-epo..> 03-Dec-2023 00:02                4077
function.fann-get-cascade-weight-multiplier.php    03-Dec-2023 00:02                3341
function.fann-get-connection-array.php             03-Dec-2023 00:02                2487
function.fann-get-connection-rate.php              03-Dec-2023 00:02                2558
function.fann-get-errno.php                        03-Dec-2023 00:02                3009
function.fann-get-errstr.php                       03-Dec-2023 00:02                3012
function.fann-get-layer-array.php                  03-Dec-2023 00:02                2561
function.fann-get-learning-momentum.php            03-Dec-2023 00:02                3586
function.fann-get-learning-rate.php                03-Dec-2023 00:02                3429
function.fann-get-mse.php                          03-Dec-2023 00:02                3046
function.fann-get-network-type.php                 03-Dec-2023 00:02                2528
function.fann-get-num-input.php                    03-Dec-2023 00:02                2415
function.fann-get-num-layers.php                   03-Dec-2023 00:02                2470
function.fann-get-num-output.php                   03-Dec-2023 00:02                2434
function.fann-get-quickprop-decay.php              03-Dec-2023 00:02                3198
function.fann-get-quickprop-mu.php                 03-Dec-2023 00:02                3091
function.fann-get-rprop-decrease-factor.php        03-Dec-2023 00:02                3152
function.fann-get-rprop-delta-max.php              03-Dec-2023 00:02                3229
function.fann-get-rprop-delta-min.php              03-Dec-2023 00:02                3025
function.fann-get-rprop-delta-zero.php             03-Dec-2023 00:02                3428
function.fann-get-rprop-increase-factor.php        03-Dec-2023 00:02                3177
function.fann-get-sarprop-step-error-shift.php     03-Dec-2023 00:02                3509
function.fann-get-sarprop-step-error-threshold-..> 03-Dec-2023 00:02                3661
function.fann-get-sarprop-temperature.php          03-Dec-2023 00:02                3423
function.fann-get-sarprop-weight-decay-shift.php   03-Dec-2023 00:02                3490
function.fann-get-total-connections.php            03-Dec-2023 00:02                2607
function.fann-get-total-neurons.php                03-Dec-2023 00:02                2654
function.fann-get-train-error-function.php         03-Dec-2023 00:02                3368
function.fann-get-train-stop-function.php          03-Dec-2023 00:02                3356
function.fann-get-training-algorithm.php           03-Dec-2023 00:02                3528
function.fann-init-weights.php                     03-Dec-2023 00:02                4156
function.fann-length-train-data.php                03-Dec-2023 00:02                2613
function.fann-merge-train-data.php                 03-Dec-2023 00:02                2867
function.fann-num-input-train-data.php             03-Dec-2023 00:02                3344
function.fann-num-output-train-data.php            03-Dec-2023 00:02                3342
function.fann-print-error.php                      03-Dec-2023 00:02                2835
function.fann-randomize-weights.php                03-Dec-2023 00:02                3656
function.fann-read-train-from-file.php             03-Dec-2023 00:02                4856
function.fann-reset-errno.php                      03-Dec-2023 00:02                3026
function.fann-reset-errstr.php                     03-Dec-2023 00:02                3007
function.fann-reset-mse.php                        03-Dec-2023 00:02                3285
function.fann-run.php                              03-Dec-2023 00:02                2670
function.fann-save-train.php                       03-Dec-2023 00:02                3269
function.fann-save.php                             03-Dec-2023 00:02                4071
function.fann-scale-input-train-data.php           03-Dec-2023 00:02                3859
function.fann-scale-input.php                      03-Dec-2023 00:02                3549
function.fann-scale-output-train-data.php          03-Dec-2023 00:02                3887
function.fann-scale-output.php                     03-Dec-2023 00:02                3553
function.fann-scale-train-data.php                 03-Dec-2023 00:02                3857
function.fann-scale-train.php                      03-Dec-2023 00:02                3523
function.fann-set-activation-function-hidden.php   03-Dec-2023 00:02                4274
function.fann-set-activation-function-layer.php    03-Dec-2023 00:02                4734
function.fann-set-activation-function-output.php   03-Dec-2023 00:02                4290
function.fann-set-activation-function.php          03-Dec-2023 00:02                5998
function.fann-set-activation-steepness-hidden.php  03-Dec-2023 00:02                4575
function.fann-set-activation-steepness-layer.php   03-Dec-2023 00:02                4986
function.fann-set-activation-steepness-output.php  03-Dec-2023 00:02                4556
function.fann-set-activation-steepness.php         03-Dec-2023 00:02                5828
function.fann-set-bit-fail-limit.php               03-Dec-2023 00:02                3218
function.fann-set-callback.php                     03-Dec-2023 00:02                5272
function.fann-set-cascade-activation-functions.php 03-Dec-2023 00:02                3889
function.fann-set-cascade-activation-steepnesse..> 03-Dec-2023 00:02                4102
function.fann-set-cascade-candidate-change-frac..> 03-Dec-2023 00:02                3569
function.fann-set-cascade-candidate-limit.php      03-Dec-2023 00:02                3376
function.fann-set-cascade-candidate-stagnation-..> 03-Dec-2023 00:02                3631
function.fann-set-cascade-max-cand-epochs.php      03-Dec-2023 00:02                3377
function.fann-set-cascade-max-out-epochs.php       03-Dec-2023 00:02                3328
function.fann-set-cascade-min-cand-epochs.php      03-Dec-2023 00:02                3709
function.fann-set-cascade-min-out-epochs.php       03-Dec-2023 00:02                3691
function.fann-set-cascade-num-candidate-groups.php 03-Dec-2023 00:02                3462
function.fann-set-cascade-output-change-fractio..> 03-Dec-2023 00:02                3526
function.fann-set-cascade-output-stagnation-epo..> 03-Dec-2023 00:02                3592
function.fann-set-cascade-weight-multiplier.php    03-Dec-2023 00:02                3361
function.fann-set-error-log.php                    03-Dec-2023 00:02                2785
function.fann-set-input-scaling-params.php         03-Dec-2023 00:02                4160
function.fann-set-learning-momentum.php            03-Dec-2023 00:02                3617
function.fann-set-learning-rate.php                03-Dec-2023 00:02                3543
function.fann-set-output-scaling-params.php        03-Dec-2023 00:02                4180
function.fann-set-quickprop-decay.php              03-Dec-2023 00:02                3289
function.fann-set-quickprop-mu.php                 03-Dec-2023 00:02                3144
function.fann-set-rprop-decrease-factor.php        03-Dec-2023 00:02                3346
function.fann-set-rprop-delta-max.php              03-Dec-2023 00:02                3473
function.fann-set-rprop-delta-min.php              03-Dec-2023 00:02                3264
function.fann-set-rprop-delta-zero.php             03-Dec-2023 00:02                3676
function.fann-set-rprop-increase-factor.php        03-Dec-2023 00:02                3372
function.fann-set-sarprop-step-error-shift.php     03-Dec-2023 00:02                3759
function.fann-set-sarprop-step-error-threshold-..> 03-Dec-2023 00:02                3953
function.fann-set-sarprop-temperature.php          03-Dec-2023 00:02                3670
function.fann-set-sarprop-weight-decay-shift.php   03-Dec-2023 00:02                3753
function.fann-set-scaling-params.php               03-Dec-2023 00:02                5104
function.fann-set-train-error-function.php         03-Dec-2023 00:02                3558
function.fann-set-train-stop-function.php          03-Dec-2023 00:02                3546
function.fann-set-training-algorithm.php           03-Dec-2023 00:02                3494
function.fann-set-weight-array.php                 03-Dec-2023 00:02                2987
function.fann-set-weight.php                       03-Dec-2023 00:02                3327
function.fann-shuffle-train-data.php               03-Dec-2023 00:02                2663
function.fann-subset-train-data.php                03-Dec-2023 00:02                3912
function.fann-test-data.php                        03-Dec-2023 00:02                3998
function.fann-test.php                             03-Dec-2023 00:02                4281
function.fann-train-epoch.php                      03-Dec-2023 00:02                4357
function.fann-train-on-data.php                    03-Dec-2023 00:02                6143
function.fann-train-on-file.php                    03-Dec-2023 00:02                6128
function.fann-train.php                            03-Dec-2023 00:02                4320
function.fastcgi-finish-request.php                03-Dec-2023 00:02                2250
function.fbird-add-user.php                        03-Dec-2023 00:02                2375
function.fbird-affected-rows.php                   03-Dec-2023 00:02                2373
function.fbird-backup.php                          03-Dec-2023 00:02                1752
function.fbird-blob-add.php                        03-Dec-2023 00:02                2725
function.fbird-blob-cancel.php                     03-Dec-2023 00:02                3525
function.fbird-blob-close.php                      03-Dec-2023 00:02                2756
function.fbird-blob-create.php                     03-Dec-2023 00:02                2756
function.fbird-blob-echo.php                       03-Dec-2023 00:02                2544
function.fbird-blob-get.php                        03-Dec-2023 00:02                2537
function.fbird-blob-import.php                     03-Dec-2023 00:02                2752
function.fbird-blob-info.php                       03-Dec-2023 00:02                1784
function.fbird-blob-open.php                       03-Dec-2023 00:02                2534
function.fbird-close.php                           03-Dec-2023 00:02                2296
function.fbird-commit-ret.php                      03-Dec-2023 00:02                1777
function.fbird-commit.php                          03-Dec-2023 00:02                1745
function.fbird-connect.php                         03-Dec-2023 00:02                2302
function.fbird-db-info.php                         03-Dec-2023 00:02                1758
function.fbird-delete-user.php                     03-Dec-2023 00:02                2370
function.fbird-drop-db.php                         03-Dec-2023 00:02                2318
function.fbird-errcode.php                         03-Dec-2023 00:02                2117
function.fbird-errmsg.php                          03-Dec-2023 00:02                2110
function.fbird-execute.php                         03-Dec-2023 00:02                2122
function.fbird-fetch-assoc.php                     03-Dec-2023 00:02                2386
function.fbird-fetch-object.php                    03-Dec-2023 00:02                2397
function.fbird-fetch-row.php                       03-Dec-2023 00:02                2374
function.fbird-field-info.php                      03-Dec-2023 00:02                2192
function.fbird-free-event-handler.php              03-Dec-2023 00:02                2296
function.fbird-free-query.php                      03-Dec-2023 00:02                1813
function.fbird-free-result.php                     03-Dec-2023 00:02                1798
function.fbird-gen-id.php                          03-Dec-2023 00:02                1755
function.fbird-maintain-db.php                     03-Dec-2023 00:02                1800
function.fbird-modify-user.php                     03-Dec-2023 00:02                2386
function.fbird-name-result.php                     03-Dec-2023 00:02                2369
function.fbird-num-fields.php                      03-Dec-2023 00:02                2181
function.fbird-num-params.php                      03-Dec-2023 00:02                2364
function.fbird-param-info.php                      03-Dec-2023 00:02                2369
function.fbird-pconnect.php                        03-Dec-2023 00:02                2319
function.fbird-prepare.php                         03-Dec-2023 00:02                1748
function.fbird-query.php                           03-Dec-2023 00:02                2683
function.fbird-restore.php                         03-Dec-2023 00:02                1755
function.fbird-rollback-ret.php                    03-Dec-2023 00:02                1807
function.fbird-rollback.php                        03-Dec-2023 00:02                1779
function.fbird-server-info.php                     03-Dec-2023 00:02                1810
function.fbird-service-attach.php                  03-Dec-2023 00:02                1849
function.fbird-service-detach.php                  03-Dec-2023 00:02                1861
function.fbird-set-event-handler.php               03-Dec-2023 00:02                2479
function.fbird-trans.php                           03-Dec-2023 00:02                1754
function.fbird-wait-event.php                      03-Dec-2023 00:02                2404
function.fclose.php                                03-Dec-2023 00:02                4230
function.fdatasync.php                             03-Dec-2023 00:02                5867
function.fdf-add-doc-javascript.php                03-Dec-2023 00:02                5158
function.fdf-add-template.php                      03-Dec-2023 00:02                2523
function.fdf-close.php                             03-Dec-2023 00:02                2987
function.fdf-create.php                            03-Dec-2023 00:02                5488
function.fdf-enum-values.php                       03-Dec-2023 00:02                2373
function.fdf-errno.php                             03-Dec-2023 00:02                2694
function.fdf-error.php                             03-Dec-2023 00:02                3079
function.fdf-get-ap.php                            03-Dec-2023 00:02                3849
function.fdf-get-attachment.php                    03-Dec-2023 00:02                5826
function.fdf-get-encoding.php                      03-Dec-2023 00:02                3255
function.fdf-get-file.php                          03-Dec-2023 00:02                3075
function.fdf-get-flags.php                         03-Dec-2023 00:02                2135
function.fdf-get-opt.php                           03-Dec-2023 00:02                2273
function.fdf-get-status.php                        03-Dec-2023 00:02                3094
function.fdf-get-value.php                         03-Dec-2023 00:02                4382
function.fdf-get-version.php                       03-Dec-2023 00:02                3454
function.fdf-header.php                            03-Dec-2023 00:02                2283
function.fdf-next-field-name.php                   03-Dec-2023 00:02                5192
function.fdf-open-string.php                       03-Dec-2023 00:02                4697
function.fdf-open.php                              03-Dec-2023 00:02                5708
function.fdf-remove-item.php                       03-Dec-2023 00:02                2147
function.fdf-save-string.php                       03-Dec-2023 00:02                5439
function.fdf-save.php                              03-Dec-2023 00:02                3835
function.fdf-set-ap.php                            03-Dec-2023 00:02                4022
function.fdf-set-encoding.php                      03-Dec-2023 00:02                3473
function.fdf-set-file.php                          03-Dec-2023 00:02                6383
function.fdf-set-flags.php                         03-Dec-2023 00:02                4003
function.fdf-set-javascript-action.php             03-Dec-2023 00:02                4198
function.fdf-set-on-import-javascript.php          03-Dec-2023 00:02                2953
function.fdf-set-opt.php                           03-Dec-2023 00:02                4228
function.fdf-set-status.php                        03-Dec-2023 00:02                3524
function.fdf-set-submit-form-action.php            03-Dec-2023 00:02                4443
function.fdf-set-target-frame.php                  03-Dec-2023 00:02                3524
function.fdf-set-value.php                         03-Dec-2023 00:02                4967
function.fdf-set-version.php                       03-Dec-2023 00:02                3748
function.fdiv.php                                  03-Dec-2023 00:02                5899
function.feof.php                                  03-Dec-2023 00:02                7433
function.fflush.php                                03-Dec-2023 00:02                5429
function.fgetc.php                                 03-Dec-2023 00:02                6321
function.fgetcsv.php                               03-Dec-2023 00:02               12446
function.fgets.php                                 03-Dec-2023 00:02                8261
function.fgetss.php                                03-Dec-2023 00:02                9202
function.file-exists.php                           03-Dec-2023 00:02                6879
function.file-get-contents.php                     03-Dec-2023 00:02               17348
function.file-put-contents.php                     03-Dec-2023 00:02               12694
function.file.php                                  03-Dec-2023 00:02               11298
function.fileatime.php                             03-Dec-2023 00:02                6767
function.filectime.php                             03-Dec-2023 00:02                6830
function.filegroup.php                             03-Dec-2023 00:02                5477
function.fileinode.php                             03-Dec-2023 00:02                5091
function.filemtime.php                             03-Dec-2023 00:02                6600
function.fileowner.php                             03-Dec-2023 00:02                5441
function.fileperms.php                             03-Dec-2023 00:02               16096
function.filesize.php                              03-Dec-2023 00:02                5476
function.filetype.php                              03-Dec-2023 00:02                6558
function.filter-has-var.php                        03-Dec-2023 00:02                2879
function.filter-id.php                             03-Dec-2023 00:02                2687
function.filter-input-array.php                    03-Dec-2023 00:02               10500
function.filter-input.php                          03-Dec-2023 00:02                7590
function.filter-list.php                           03-Dec-2023 00:02                3380
function.filter-var-array.php                      03-Dec-2023 00:02               11085
function.filter-var.php                            03-Dec-2023 00:02               14002
function.finfo-buffer.php                          03-Dec-2023 00:02                7667
function.finfo-close.php                           03-Dec-2023 00:02                3406
function.finfo-file.php                            03-Dec-2023 00:02                8283
function.finfo-open.php                            03-Dec-2023 00:02                9742
function.finfo-set-flags.php                       03-Dec-2023 00:02                4470
function.floatval.php                              03-Dec-2023 00:02                6717
function.flock.php                                 03-Dec-2023 00:02               12426
function.floor.php                                 03-Dec-2023 00:02                4891
function.flush.php                                 03-Dec-2023 00:02                4757
function.fmod.php                                  03-Dec-2023 00:02                4214
function.fnmatch.php                               03-Dec-2023 00:02                7578
function.fopen.php                                 03-Dec-2023 00:02               22658
function.forward-static-call-array.php             03-Dec-2023 00:02                9393
function.forward-static-call.php                   03-Dec-2023 00:02                8875
function.fpassthru.php                             03-Dec-2023 00:02                7216
function.fpm-get-status.php                        03-Dec-2023 00:02                2640
function.fprintf.php                               03-Dec-2023 00:02               22297
function.fputcsv.php                               03-Dec-2023 00:02                9974
function.fputs.php                                 03-Dec-2023 00:02                1657
function.fread.php                                 03-Dec-2023 00:02               14696
function.frenchtojd.php                            03-Dec-2023 00:02                3944
function.fscanf.php                                03-Dec-2023 00:02                9275
function.fseek.php                                 03-Dec-2023 00:02                7446
function.fsockopen.php                             03-Dec-2023 00:02               15543
function.fstat.php                                 03-Dec-2023 00:02                5848
function.fsync.php                                 03-Dec-2023 00:02                5600
function.ftell.php                                 03-Dec-2023 00:02                6057
function.ftok.php                                  03-Dec-2023 00:02                3496
function.ftp-alloc.php                             03-Dec-2023 00:02                7971
function.ftp-append.php                            03-Dec-2023 00:02                4132
function.ftp-cdup.php                              03-Dec-2023 00:02                5835
function.ftp-chdir.php                             03-Dec-2023 00:02                6642
function.ftp-chmod.php                             03-Dec-2023 00:02                6079
function.ftp-close.php                             03-Dec-2023 00:02                5234
function.ftp-connect.php                           03-Dec-2023 00:02                6256
function.ftp-delete.php                            03-Dec-2023 00:02                5468
function.ftp-exec.php                              03-Dec-2023 00:02                5802
function.ftp-fget.php                              03-Dec-2023 00:02                9452
function.ftp-fput.php                              03-Dec-2023 00:02                8864
function.ftp-get-option.php                        03-Dec-2023 00:02                5078
function.ftp-get.php                               03-Dec-2023 00:02                8798
function.ftp-login.php                             03-Dec-2023 00:02                5712
function.ftp-mdtm.php                              03-Dec-2023 00:02                6176
function.ftp-mkdir.php                             03-Dec-2023 00:02                5546
function.ftp-mlsd.php                              03-Dec-2023 00:02                8877
function.ftp-nb-continue.php                       03-Dec-2023 00:02                4536
function.ftp-nb-fget.php                           03-Dec-2023 00:02                9902
function.ftp-nb-fput.php                           03-Dec-2023 00:02                9688
function.ftp-nb-get.php                            03-Dec-2023 00:02               13470
function.ftp-nb-put.php                            03-Dec-2023 00:02               10920
function.ftp-nlist.php                             03-Dec-2023 00:02                5610
function.ftp-pasv.php                              03-Dec-2023 00:02                6278
function.ftp-put.php                               03-Dec-2023 00:02                8514
function.ftp-pwd.php                               03-Dec-2023 00:02                5069
function.ftp-quit.php                              03-Dec-2023 00:02                1653
function.ftp-raw.php                               03-Dec-2023 00:02                4561
function.ftp-rawlist.php                           03-Dec-2023 00:02                7769
function.ftp-rename.php                            03-Dec-2023 00:02                5982
function.ftp-rmdir.php                             03-Dec-2023 00:02                5570
function.ftp-set-option.php                        03-Dec-2023 00:02                5864
function.ftp-site.php                              03-Dec-2023 00:02                6431
function.ftp-size.php                              03-Dec-2023 00:02                5912
function.ftp-ssl-connect.php                       03-Dec-2023 00:02                8562
function.ftp-systype.php                           03-Dec-2023 00:02                4516
function.ftruncate.php                             03-Dec-2023 00:02                6334
function.func-get-arg.php                          03-Dec-2023 00:02                6656
function.func-get-args.php                         03-Dec-2023 00:02               11612
function.func-num-args.php                         03-Dec-2023 00:02                5727
function.function-exists.php                       03-Dec-2023 00:02                5507
function.fwrite.php                                03-Dec-2023 00:02               14186
function.gc-collect-cycles.php                     03-Dec-2023 00:02                2494
function.gc-disable.php                            03-Dec-2023 00:02                2562
function.gc-enable.php                             03-Dec-2023 00:02                2535
function.gc-enabled.php                            03-Dec-2023 00:02                3248
function.gc-mem-caches.php                         03-Dec-2023 00:02                2434
function.gc-status.php                             03-Dec-2023 00:02                5761
function.gd-info.php                               03-Dec-2023 00:02                7247
function.geoip-asnum-by-name.php                   03-Dec-2023 00:02                4019
function.geoip-continent-code-by-name.php          03-Dec-2023 00:02                5533
function.geoip-country-code-by-name.php            03-Dec-2023 00:02                5268
function.geoip-country-code3-by-name.php           03-Dec-2023 00:02                4833
function.geoip-country-name-by-name.php            03-Dec-2023 00:02                4798
function.geoip-database-info.php                   03-Dec-2023 00:02                4093
function.geoip-db-avail.php                        03-Dec-2023 00:02                4207
function.geoip-db-filename.php                     03-Dec-2023 00:02                3969
function.geoip-db-get-all-info.php                 03-Dec-2023 00:02                6618
function.geoip-domain-by-name.php                  03-Dec-2023 00:02                4241
function.geoip-id-by-name.php                      03-Dec-2023 00:02                5367
function.geoip-isp-by-name.php                     03-Dec-2023 00:02                4245
function.geoip-netspeedcell-by-name.php            03-Dec-2023 00:02                4983
function.geoip-org-by-name.php                     03-Dec-2023 00:02                4264
function.geoip-record-by-name.php                  03-Dec-2023 00:02                7469
function.geoip-region-by-name.php                  03-Dec-2023 00:02                4927
function.geoip-region-name-by-code.php             03-Dec-2023 00:02                6885
function.geoip-setup-custom-directory.php          03-Dec-2023 00:02                4096
function.geoip-time-zone-by-country-and-region.php 03-Dec-2023 00:02                7095
function.get-browser.php                           03-Dec-2023 00:02                7531
function.get-called-class.php                      03-Dec-2023 00:02                5923
function.get-cfg-var.php                           03-Dec-2023 00:02                3649
function.get-class-methods.php                     03-Dec-2023 00:02                6769
function.get-class-vars.php                        03-Dec-2023 00:02                9481
function.get-class.php                             03-Dec-2023 00:02               11909
function.get-current-user.php                      03-Dec-2023 00:02                4326
function.get-debug-type.php                        03-Dec-2023 00:02                9609
function.get-declared-classes.php                  03-Dec-2023 00:02                5277
function.get-declared-interfaces.php               03-Dec-2023 00:02                4242
function.get-declared-traits.php                   03-Dec-2023 00:02                2809
function.get-defined-constants.php                 03-Dec-2023 00:02                7378
function.get-defined-functions.php                 03-Dec-2023 00:02                5626
function.get-defined-vars.php                      03-Dec-2023 00:02                6292
function.get-extension-funcs.php                   03-Dec-2023 00:02                5225
function.get-headers.php                           03-Dec-2023 00:02                8406
function.get-html-translation-table.php            03-Dec-2023 00:02               12988
function.get-include-path.php                      03-Dec-2023 00:02                4163
function.get-included-files.php                    03-Dec-2023 00:02                5940
function.get-loaded-extensions.php                 03-Dec-2023 00:02                5427
function.get-magic-quotes-gpc.php                  03-Dec-2023 00:02                3872
function.get-magic-quotes-runtime.php              03-Dec-2023 00:02                3574
function.get-mangled-object-vars.php               03-Dec-2023 00:02                8043
function.get-meta-tags.php                         03-Dec-2023 00:02                7503
function.get-object-vars.php                       03-Dec-2023 00:02                6025
function.get-parent-class.php                      03-Dec-2023 00:02                7308
function.get-required-files.php                    03-Dec-2023 00:02                1865
function.get-resource-id.php                       03-Dec-2023 00:02                4654
function.get-resource-type.php                     03-Dec-2023 00:02                5154
function.get-resources.php                         03-Dec-2023 00:02                7564
function.getallheaders.php                         03-Dec-2023 00:02                4609
function.getcwd.php                                03-Dec-2023 00:02                5156
function.getdate.php                               03-Dec-2023 00:02                9213
function.getenv.php                                03-Dec-2023 00:02                7970
function.gethostbyaddr.php                         03-Dec-2023 00:02                4164
function.gethostbyname.php                         03-Dec-2023 00:02                4551
function.gethostbynamel.php                        03-Dec-2023 00:02                5044
function.gethostname.php                           03-Dec-2023 00:02                3920
function.getimagesize.php                          03-Dec-2023 00:02               16989
function.getimagesizefromstring.php                03-Dec-2023 00:02                5389
function.getlastmod.php                            03-Dec-2023 00:02                4954
function.getmxrr.php                               03-Dec-2023 00:02                5785
function.getmygid.php                              03-Dec-2023 00:02                3102
function.getmyinode.php                            03-Dec-2023 00:02                3405
function.getmypid.php                              03-Dec-2023 00:02                3458
function.getmyuid.php                              03-Dec-2023 00:02                3084
function.getopt.php                                03-Dec-2023 00:02               14889
function.getprotobyname.php                        03-Dec-2023 00:02                4486
function.getprotobynumber.php                      03-Dec-2023 00:02                3124
function.getrandmax.php                            03-Dec-2023 00:02                2972
function.getrusage.php                             03-Dec-2023 00:02               11149
function.getservbyname.php                         03-Dec-2023 00:02                6225
function.getservbyport.php                         03-Dec-2023 00:02                3578
function.gettext.php                               03-Dec-2023 00:02                5645
function.gettimeofday.php                          03-Dec-2023 00:02                4502
function.gettype.php                               03-Dec-2023 00:02                9613
function.glob.php                                  03-Dec-2023 00:02                9623
function.gmdate.php                                03-Dec-2023 00:02                7399
function.gmmktime.php                              03-Dec-2023 00:02               10545
function.gmp-abs.php                               03-Dec-2023 00:02                4149
function.gmp-add.php                               03-Dec-2023 00:02                4183
function.gmp-and.php                               03-Dec-2023 00:02                4607
function.gmp-binomial.php                          03-Dec-2023 00:02                3650
function.gmp-clrbit.php                            03-Dec-2023 00:02                5342
function.gmp-cmp.php                               03-Dec-2023 00:02                5041
function.gmp-com.php                               03-Dec-2023 00:02                3596
function.gmp-div-q.php                             03-Dec-2023 00:02                9435
function.gmp-div-qr.php                            03-Dec-2023 00:02                6238
function.gmp-div-r.php                             03-Dec-2023 00:02                5695
function.gmp-div.php                               03-Dec-2023 00:02                1696
function.gmp-divexact.php                          03-Dec-2023 00:02                5249
function.gmp-export.php                            03-Dec-2023 00:02                5189
function.gmp-fact.php                              03-Dec-2023 00:02                4581
function.gmp-gcd.php                               03-Dec-2023 00:02                4238
function.gmp-gcdext.php                            03-Dec-2023 00:02                8631
function.gmp-hamdist.php                           03-Dec-2023 00:02                5797
function.gmp-import.php                            03-Dec-2023 00:02                5626
function.gmp-init.php                              03-Dec-2023 00:02                5360
function.gmp-intval.php                            03-Dec-2023 00:02                4770
function.gmp-invert.php                            03-Dec-2023 00:02                4897
function.gmp-jacobi.php                            03-Dec-2023 00:02                4570
function.gmp-kronecker.php                         03-Dec-2023 00:02                3661
function.gmp-lcm.php                               03-Dec-2023 00:02                3425
function.gmp-legendre.php                          03-Dec-2023 00:02                4606
function.gmp-mod.php                               03-Dec-2023 00:02                4223
function.gmp-mul.php                               03-Dec-2023 00:02                4363
function.gmp-neg.php                               03-Dec-2023 00:02                4085
function.gmp-nextprime.php                         03-Dec-2023 00:02                4713
function.gmp-or.php                                03-Dec-2023 00:02                4795
function.gmp-perfect-power.php                     03-Dec-2023 00:02                3046
function.gmp-perfect-square.php                    03-Dec-2023 00:02                5285
function.gmp-popcount.php                          03-Dec-2023 00:02                4522
function.gmp-pow.php                               03-Dec-2023 00:02                5379
function.gmp-powm.php                              03-Dec-2023 00:02                4921
function.gmp-prob-prime.php                        03-Dec-2023 00:02                5424
function.gmp-random-bits.php                       03-Dec-2023 00:02                5945
function.gmp-random-range.php                      03-Dec-2023 00:02                7095
function.gmp-random-seed.php                       03-Dec-2023 00:02                7238
function.gmp-random.php                            03-Dec-2023 00:02                6275
function.gmp-root.php                              03-Dec-2023 00:02                2963
function.gmp-rootrem.php                           03-Dec-2023 00:02                3086
function.gmp-scan0.php                             03-Dec-2023 00:02                5183
function.gmp-scan1.php                             03-Dec-2023 00:02                5195
function.gmp-setbit.php                            03-Dec-2023 00:02               11290
function.gmp-sign.php                              03-Dec-2023 00:02                4276
function.gmp-sqrt.php                              03-Dec-2023 00:02                4610
function.gmp-sqrtrm.php                            03-Dec-2023 00:02                5996
function.gmp-strval.php                            03-Dec-2023 00:02                4340
function.gmp-sub.php                               03-Dec-2023 00:02                4422
function.gmp-testbit.php                           03-Dec-2023 00:02                5499
function.gmp-xor.php                               03-Dec-2023 00:02                4825
function.gmstrftime.php                            03-Dec-2023 00:02                8793
function.gnupg-adddecryptkey.php                   03-Dec-2023 00:02                5031
function.gnupg-addencryptkey.php                   03-Dec-2023 00:02                4621
function.gnupg-addsignkey.php                      03-Dec-2023 00:02                5038
function.gnupg-cleardecryptkeys.php                03-Dec-2023 00:02                4211
function.gnupg-clearencryptkeys.php                03-Dec-2023 00:02                4216
function.gnupg-clearsignkeys.php                   03-Dec-2023 00:02                4158
function.gnupg-decrypt.php                         03-Dec-2023 00:02                5845
function.gnupg-decryptverify.php                   03-Dec-2023 00:02                6943
function.gnupg-deletekey.php                       03-Dec-2023 00:02                4843
function.gnupg-encrypt.php                         03-Dec-2023 00:02                5748
function.gnupg-encryptsign.php                     03-Dec-2023 00:02                6648
function.gnupg-export.php                          03-Dec-2023 00:02                4956
function.gnupg-getengineinfo.php                   03-Dec-2023 00:02                5385
function.gnupg-geterror.php                        03-Dec-2023 00:02                4155
function.gnupg-geterrorinfo.php                    03-Dec-2023 00:02                5488
function.gnupg-getprotocol.php                     03-Dec-2023 00:02                4195
function.gnupg-gettrustlist.php                    03-Dec-2023 00:02                4982
function.gnupg-import.php                          03-Dec-2023 00:02                5208
function.gnupg-init.php                            03-Dec-2023 00:02                6864
function.gnupg-keyinfo.php                         03-Dec-2023 00:02                5135
function.gnupg-listsignatures.php                  03-Dec-2023 00:02                5206
function.gnupg-setarmor.php                        03-Dec-2023 00:02                5373
function.gnupg-seterrormode.php                    03-Dec-2023 00:02                5315
function.gnupg-setsignmode.php                     03-Dec-2023 00:02                5250
function.gnupg-sign.php                            03-Dec-2023 00:02                5990
function.gnupg-verify.php                          03-Dec-2023 00:02                8076
function.grapheme-extract.php                      03-Dec-2023 00:02                8530
function.grapheme-stripos.php                      03-Dec-2023 00:02                7971
function.grapheme-stristr.php                      03-Dec-2023 00:02                7528
function.grapheme-strlen.php                       03-Dec-2023 00:02                5339
function.grapheme-strpos.php                       03-Dec-2023 00:02                7643
function.grapheme-strripos.php                     03-Dec-2023 00:02                7426
function.grapheme-strrpos.php                      03-Dec-2023 00:02                7090
function.grapheme-strstr.php                       03-Dec-2023 00:02                7135
function.grapheme-substr.php                       03-Dec-2023 00:02                7648
function.gregoriantojd.php                         03-Dec-2023 00:02                7648
function.gzclose.php                               03-Dec-2023 00:02                4192
function.gzcompress.php                            03-Dec-2023 00:02                5733
function.gzdecode.php                              03-Dec-2023 00:02                3508
function.gzdeflate.php                             03-Dec-2023 00:02                5384
function.gzencode.php                              03-Dec-2023 00:02                6569
function.gzeof.php                                 03-Dec-2023 00:02                3928
function.gzfile.php                                03-Dec-2023 00:02                4578
function.gzgetc.php                                03-Dec-2023 00:02                4559
function.gzgets.php                                03-Dec-2023 00:02                5961
function.gzgetss.php                               03-Dec-2023 00:02                5914
function.gzinflate.php                             03-Dec-2023 00:02                5223
function.gzopen.php                                03-Dec-2023 00:02                5443
function.gzpassthru.php                            03-Dec-2023 00:02                4631
function.gzputs.php                                03-Dec-2023 00:02                1642
function.gzread.php                                03-Dec-2023 00:02                6472
function.gzrewind.php                              03-Dec-2023 00:02                3182
function.gzseek.php                                03-Dec-2023 00:02                6066
function.gztell.php                                03-Dec-2023 00:02                3387
function.gzuncompress.php                          03-Dec-2023 00:02                5183
function.gzwrite.php                               03-Dec-2023 00:02                6275
function.halt-compiler.php                         03-Dec-2023 00:02                4977
function.hash-algos.php                            03-Dec-2023 00:02                5717
function.hash-copy.php                             03-Dec-2023 00:02                5468
function.hash-equals.php                           03-Dec-2023 00:02                6719
function.hash-file.php                             03-Dec-2023 00:02                7107
function.hash-final.php                            03-Dec-2023 00:02                4623
function.hash-hkdf.php                             03-Dec-2023 00:02                9382
function.hash-hmac-algos.php                       03-Dec-2023 00:02                5225
function.hash-hmac-file.php                        03-Dec-2023 00:02                7722
function.hash-hmac.php                             03-Dec-2023 00:02                7414
function.hash-init.php                             03-Dec-2023 00:02               10033
function.hash-pbkdf2.php                           03-Dec-2023 00:02               11215
function.hash-update-file.php                      03-Dec-2023 00:02                5534
function.hash-update-stream.php                    03-Dec-2023 00:02                7257
function.hash-update.php                           03-Dec-2023 00:02                4289
function.hash.php                                  03-Dec-2023 00:02                6854
function.header-register-callback.php              03-Dec-2023 00:02                6701
function.header-remove.php                         03-Dec-2023 00:02                5976
function.header.php                                03-Dec-2023 00:02               17943
function.headers-list.php                          03-Dec-2023 00:02                5909
function.headers-sent.php                          03-Dec-2023 00:02                7914
function.hebrev.php                                03-Dec-2023 00:02                3160
function.hebrevc.php                               03-Dec-2023 00:02                3592
function.hex2bin.php                               03-Dec-2023 00:02                4801
function.hexdec.php                                03-Dec-2023 00:02                5875
function.highlight-file.php                        03-Dec-2023 00:02                5229
function.highlight-string.php                      03-Dec-2023 00:02                5456
function.hrtime.php                                03-Dec-2023 00:02                4672
function.html-entity-decode.php                    03-Dec-2023 00:02               13777
function.htmlentities.php                          03-Dec-2023 00:02               16505
function.htmlspecialchars-decode.php               03-Dec-2023 00:02                8388
function.htmlspecialchars.php                      03-Dec-2023 00:02               19791
function.http-build-query.php                      03-Dec-2023 00:02               15354
function.http-response-code.php                    03-Dec-2023 00:02                6739
function.hypot.php                                 03-Dec-2023 00:02                2882
function.ibase-add-user.php                        03-Dec-2023 00:02                4127
function.ibase-affected-rows.php                   03-Dec-2023 00:02                3416
function.ibase-backup.php                          03-Dec-2023 00:02                9576
function.ibase-blob-add.php                        03-Dec-2023 00:02                3970
function.ibase-blob-cancel.php                     03-Dec-2023 00:02                3513
function.ibase-blob-close.php                      03-Dec-2023 00:02                3864
function.ibase-blob-create.php                     03-Dec-2023 00:02                3850
function.ibase-blob-echo.php                       03-Dec-2023 00:02                3900
function.ibase-blob-get.php                        03-Dec-2023 00:02                6466
function.ibase-blob-import.php                     03-Dec-2023 00:02                7791
function.ibase-blob-info.php                       03-Dec-2023 00:02                3255
function.ibase-blob-open.php                       03-Dec-2023 00:02                3963
function.ibase-close.php                           03-Dec-2023 00:02                3566
function.ibase-commit-ret.php                      03-Dec-2023 00:02                3031
function.ibase-commit.php                          03-Dec-2023 00:02                2832
function.ibase-connect.php                         03-Dec-2023 00:02               10098
function.ibase-db-info.php                         03-Dec-2023 00:02                2411
function.ibase-delete-user.php                     03-Dec-2023 00:02                3365
function.ibase-drop-db.php                         03-Dec-2023 00:02                3464
function.ibase-errcode.php                         03-Dec-2023 00:02                2574
function.ibase-errmsg.php                          03-Dec-2023 00:02                2565
function.ibase-execute.php                         03-Dec-2023 00:02                7279
function.ibase-fetch-assoc.php                     03-Dec-2023 00:02                4511
function.ibase-fetch-object.php                    03-Dec-2023 00:02                6437
function.ibase-fetch-row.php                       03-Dec-2023 00:02                4276
function.ibase-field-info.php                      03-Dec-2023 00:02                6879
function.ibase-free-event-handler.php              03-Dec-2023 00:02                3357
function.ibase-free-query.php                      03-Dec-2023 00:02                2646
function.ibase-free-result.php                     03-Dec-2023 00:02                2761
function.ibase-gen-id.php                          03-Dec-2023 00:02                2636
function.ibase-maintain-db.php                     03-Dec-2023 00:02                2745
function.ibase-modify-user.php                     03-Dec-2023 00:02                4129
function.ibase-name-result.php                     03-Dec-2023 00:02                5653
function.ibase-num-fields.php                      03-Dec-2023 00:02                6436
function.ibase-num-params.php                      03-Dec-2023 00:02                3413
function.ibase-param-info.php                      03-Dec-2023 00:02                3653
function.ibase-pconnect.php                        03-Dec-2023 00:02                7395
function.ibase-prepare.php                         03-Dec-2023 00:02                3419
function.ibase-query.php                           03-Dec-2023 00:02                7002
function.ibase-restore.php                         03-Dec-2023 00:02                9675
function.ibase-rollback-ret.php                    03-Dec-2023 00:02                3072
function.ibase-rollback.php                        03-Dec-2023 00:02                2877
function.ibase-server-info.php                     03-Dec-2023 00:02                9612
function.ibase-service-attach.php                  03-Dec-2023 00:02               10739
function.ibase-service-detach.php                  03-Dec-2023 00:02                5943
function.ibase-set-event-handler.php               03-Dec-2023 00:02                7456
function.ibase-trans.php                           03-Dec-2023 00:02                5450
function.ibase-wait-event.php                      03-Dec-2023 00:02                4585
function.iconv-get-encoding.php                    03-Dec-2023 00:02                5617
function.iconv-mime-decode-headers.php             03-Dec-2023 00:02               10244
function.iconv-mime-decode.php                     03-Dec-2023 00:02                8153
function.iconv-mime-encode.php                     03-Dec-2023 00:02               11615
function.iconv-set-encoding.php                    03-Dec-2023 00:02                4889
function.iconv-strlen.php                          03-Dec-2023 00:02                4786
function.iconv-strpos.php                          03-Dec-2023 00:02                7048
function.iconv-strrpos.php                         03-Dec-2023 00:02                6297
function.iconv-substr.php                          03-Dec-2023 00:02                7959
function.iconv.php                                 03-Dec-2023 00:02                8537
function.idate.php                                 03-Dec-2023 00:02               10860
function.idn-to-ascii.php                          03-Dec-2023 00:02                6864
function.idn-to-utf8.php                           03-Dec-2023 00:02                6870
function.igbinary-serialize.php                    03-Dec-2023 00:02                9647
function.igbinary-unserialize.php                  03-Dec-2023 00:02                9078
function.ignore-user-abort.php                     03-Dec-2023 00:02                7132
function.image-type-to-extension.php               03-Dec-2023 00:02                5054
function.image-type-to-mime-type.php               03-Dec-2023 00:02                7912
function.image2wbmp.php                            03-Dec-2023 00:02                6203
function.imageaffine.php                           03-Dec-2023 00:02                4463
function.imageaffinematrixconcat.php               03-Dec-2023 00:02                6375
function.imageaffinematrixget.php                  03-Dec-2023 00:02                5889
function.imagealphablending.php                    03-Dec-2023 00:02                7351
function.imageantialias.php                        03-Dec-2023 00:02               10651
function.imagearc.php                              03-Dec-2023 00:02               13241
function.imageavif.php                             03-Dec-2023 00:02                5668
function.imagebmp.php                              03-Dec-2023 00:02                7501
function.imagechar.php                             03-Dec-2023 00:02                9627
function.imagecharup.php                           03-Dec-2023 00:02                9492
function.imagecolorallocate.php                    03-Dec-2023 00:02                9640
function.imagecolorallocatealpha.php               03-Dec-2023 00:02               17709
function.imagecolorat.php                          03-Dec-2023 00:02                9933
function.imagecolorclosest.php                     03-Dec-2023 00:02               11921
function.imagecolorclosestalpha.php                03-Dec-2023 00:02               12354
function.imagecolorclosesthwb.php                  03-Dec-2023 00:02                6396
function.imagecolordeallocate.php                  03-Dec-2023 00:02                5739
function.imagecolorexact.php                       03-Dec-2023 00:02                8281
function.imagecolorexactalpha.php                  03-Dec-2023 00:02                9167
function.imagecolormatch.php                       03-Dec-2023 00:02                8279
function.imagecolorresolve.php                     03-Dec-2023 00:02                7460
function.imagecolorresolvealpha.php                03-Dec-2023 00:02                8124
function.imagecolorset.php                         03-Dec-2023 00:02                8451
function.imagecolorsforindex.php                   03-Dec-2023 00:02                7206
function.imagecolorstotal.php                      03-Dec-2023 00:02                5769
function.imagecolortransparent.php                 03-Dec-2023 00:02                8899
function.imageconvolution.php                      03-Dec-2023 00:02               11514
function.imagecopy.php                             03-Dec-2023 00:02                8980
function.imagecopymerge.php                        03-Dec-2023 00:02                9134
function.imagecopymergegray.php                    03-Dec-2023 00:02                9657
function.imagecopyresampled.php                    03-Dec-2023 00:02               18598
function.imagecopyresized.php                      03-Dec-2023 00:02               13506
function.imagecreate.php                           03-Dec-2023 00:02                8226
function.imagecreatefromavif.php                   03-Dec-2023 00:02                2778
function.imagecreatefrombmp.php                    03-Dec-2023 00:02                5464
function.imagecreatefromgd.php                     03-Dec-2023 00:02                6144
function.imagecreatefromgd2.php                    03-Dec-2023 00:02                6324
function.imagecreatefromgd2part.php                03-Dec-2023 00:02                8693
function.imagecreatefromgif.php                    03-Dec-2023 00:02                9621
function.imagecreatefromjpeg.php                   03-Dec-2023 00:02                9375
function.imagecreatefrompng.php                    03-Dec-2023 00:02                9300
function.imagecreatefromstring.php                 03-Dec-2023 00:02                7953
function.imagecreatefromtga.php                    03-Dec-2023 00:02                3419
function.imagecreatefromwbmp.php                   03-Dec-2023 00:02                9264
function.imagecreatefromwebp.php                   03-Dec-2023 00:02                5616
function.imagecreatefromxbm.php                    03-Dec-2023 00:02                5456
function.imagecreatefromxpm.php                    03-Dec-2023 00:02                6101
function.imagecreatetruecolor.php                  03-Dec-2023 00:02                7002
function.imagecrop.php                             03-Dec-2023 00:02                7597
function.imagecropauto.php                         03-Dec-2023 00:02               10448
function.imagedashedline.php                       03-Dec-2023 00:02               12330
function.imagedestroy.php                          03-Dec-2023 00:02                5012
function.imageellipse.php                          03-Dec-2023 00:02                9777
function.imagefill.php                             03-Dec-2023 00:02                7366
function.imagefilledarc.php                        03-Dec-2023 00:02               17833
function.imagefilledellipse.php                    03-Dec-2023 00:02                9478
function.imagefilledpolygon.php                    03-Dec-2023 00:02               11687
function.imagefilledrectangle.php                  03-Dec-2023 00:02                8036
function.imagefilltoborder.php                     03-Dec-2023 00:02               10924
function.imagefilter.php                           03-Dec-2023 00:02               31736
function.imageflip.php                             03-Dec-2023 00:02                9310
function.imagefontheight.php                       03-Dec-2023 00:02                6253
function.imagefontwidth.php                        03-Dec-2023 00:02                6206
function.imageftbbox.php                           03-Dec-2023 00:02               13732
function.imagefttext.php                           03-Dec-2023 00:02               15299
function.imagegammacorrect.php                     03-Dec-2023 00:02                5736
function.imagegd.php                               03-Dec-2023 00:02               10395
function.imagegd2.php                              03-Dec-2023 00:02               11014
function.imagegetclip.php                          03-Dec-2023 00:02                6018
function.imagegetinterpolation.php                 03-Dec-2023 00:02                3698
function.imagegif.php                              03-Dec-2023 00:02               16359
function.imagegrabscreen.php                       03-Dec-2023 00:02                4671
function.imagegrabwindow.php                       03-Dec-2023 00:02                9498
function.imageinterlace.php                        03-Dec-2023 00:02                6527
function.imageistruecolor.php                      03-Dec-2023 00:02                7271
function.imagejpeg.php                             03-Dec-2023 00:02               14634
function.imagelayereffect.php                      03-Dec-2023 00:02               11317
function.imageline.php                             03-Dec-2023 00:02               15207
function.imageloadfont.php                         03-Dec-2023 00:02                9215
function.imageopenpolygon.php                      03-Dec-2023 00:02               10047
function.imagepalettecopy.php                      03-Dec-2023 00:02                7368
function.imagepalettetotruecolor.php               03-Dec-2023 00:02                9645
function.imagepng.php                              03-Dec-2023 00:02                8504
function.imagepolygon.php                          03-Dec-2023 00:02               10352
function.imagerectangle.php                        03-Dec-2023 00:02               10211
function.imageresolution.php                       03-Dec-2023 00:02                7204
function.imagerotate.php                           03-Dec-2023 00:02                8827
function.imagesavealpha.php                        03-Dec-2023 00:02                7458
function.imagescale.php                            03-Dec-2023 00:02                6200
function.imagesetbrush.php                         03-Dec-2023 00:02                8986
function.imagesetclip.php                          03-Dec-2023 00:02                4940
function.imagesetinterpolation.php                 03-Dec-2023 00:02               10172
function.imagesetpixel.php                         03-Dec-2023 00:02               11240
function.imagesetstyle.php                         03-Dec-2023 00:02               11998
function.imagesetthickness.php                     03-Dec-2023 00:02                8254
function.imagesettile.php                          03-Dec-2023 00:02                8145
function.imagestring.php                           03-Dec-2023 00:02                9842
function.imagestringup.php                         03-Dec-2023 00:02                9014
function.imagesx.php                               03-Dec-2023 00:02                4504
function.imagesy.php                               03-Dec-2023 00:02                4513
function.imagetruecolortopalette.php               03-Dec-2023 00:02                6612
function.imagettfbbox.php                          03-Dec-2023 00:02               19110
function.imagettftext.php                          03-Dec-2023 00:02               17674
function.imagetypes.php                            03-Dec-2023 00:02                3121
function.imagewbmp.php                             03-Dec-2023 00:02               14760
function.imagewebp.php                             03-Dec-2023 00:02                7058
function.imagexbm.php                              03-Dec-2023 00:02               11452
function.imap-8bit.php                             03-Dec-2023 00:02                2979
function.imap-alerts.php                           03-Dec-2023 00:02                3122
function.imap-append.php                           03-Dec-2023 00:02                9112
function.imap-base64.php                           03-Dec-2023 00:02                3366
function.imap-binary.php                           03-Dec-2023 00:02                2930
function.imap-body.php                             03-Dec-2023 00:02                5235
function.imap-bodystruct.php                       03-Dec-2023 00:02                4562
function.imap-check.php                            03-Dec-2023 00:02                5948
function.imap-clearflag-full.php                   03-Dec-2023 00:02                5511
function.imap-close.php                            03-Dec-2023 00:02                4143
function.imap-create.php                           03-Dec-2023 00:02                1740
function.imap-createmailbox.php                    03-Dec-2023 00:02               13685
function.imap-delete.php                           03-Dec-2023 00:02                9446
function.imap-deletemailbox.php                    03-Dec-2023 00:02                4812
function.imap-errors.php                           03-Dec-2023 00:02                3324
function.imap-expunge.php                          03-Dec-2023 00:02                3516
function.imap-fetch-overview.php                   03-Dec-2023 00:02               11040
function.imap-fetchbody.php                        03-Dec-2023 00:02                5809
function.imap-fetchheader.php                      03-Dec-2023 00:02                5493
function.imap-fetchmime.php                        03-Dec-2023 00:02                6013
function.imap-fetchstructure.php                   03-Dec-2023 00:02                9226
function.imap-fetchtext.php                        03-Dec-2023 00:02                1721
function.imap-gc.php                               03-Dec-2023 00:02                4883
function.imap-get-quota.php                        03-Dec-2023 00:02               12068
function.imap-get-quotaroot.php                    03-Dec-2023 00:02                9027
function.imap-getacl.php                           03-Dec-2023 00:02                5719
function.imap-getmailboxes.php                     03-Dec-2023 00:02               11698
function.imap-getsubscribed.php                    03-Dec-2023 00:02                7418
function.imap-header.php                           03-Dec-2023 00:02                1936
function.imap-headerinfo.php                       03-Dec-2023 00:02               11573
function.imap-headers.php                          03-Dec-2023 00:02                3378
function.imap-is-open.php                          03-Dec-2023 00:02                4035
function.imap-last-error.php                       03-Dec-2023 00:02                3036
function.imap-list.php                             03-Dec-2023 00:02                8627
function.imap-listmailbox.php                      03-Dec-2023 00:02                1726
function.imap-listscan.php                         03-Dec-2023 00:02                6861
function.imap-listsubscribed.php                   03-Dec-2023 00:02                1747
function.imap-lsub.php                             03-Dec-2023 00:02                5953
function.imap-mail-compose.php                     03-Dec-2023 00:02               14445
function.imap-mail-copy.php                        03-Dec-2023 00:02                5901
function.imap-mail-move.php                        03-Dec-2023 00:02                6331
function.imap-mail.php                             03-Dec-2023 00:02                6535
function.imap-mailboxmsginfo.php                   03-Dec-2023 00:02                9284
function.imap-mime-header-decode.php               03-Dec-2023 00:02                6258
function.imap-msgno.php                            03-Dec-2023 00:02                4106
function.imap-mutf7-to-utf8.php                    03-Dec-2023 00:02                3152
function.imap-num-msg.php                          03-Dec-2023 00:02                3954
function.imap-num-recent.php                       03-Dec-2023 00:02                3839
function.imap-open.php                             03-Dec-2023 00:02               20870
function.imap-ping.php                             03-Dec-2023 00:02                4767
function.imap-qprint.php                           03-Dec-2023 00:02                2976
function.imap-rename.php                           03-Dec-2023 00:02                1743
function.imap-renamemailbox.php                    03-Dec-2023 00:02                5403
function.imap-reopen.php                           03-Dec-2023 00:02                8213
function.imap-rfc822-parse-adrlist.php             03-Dec-2023 00:02                7671
function.imap-rfc822-parse-headers.php             03-Dec-2023 00:02                3610
function.imap-rfc822-write-address.php             03-Dec-2023 00:02                5055
function.imap-savebody.php                         03-Dec-2023 00:02                5986
function.imap-scan.php                             03-Dec-2023 00:02                1708
function.imap-scanmailbox.php                      03-Dec-2023 00:02                1738
function.imap-search.php                           03-Dec-2023 00:02               13157
function.imap-set-quota.php                        03-Dec-2023 00:02                6530
function.imap-setacl.php                           03-Dec-2023 00:02                5226
function.imap-setflag-full.php                     03-Dec-2023 00:02                7673
function.imap-sort.php                             03-Dec-2023 00:02                7451
function.imap-status.php                           03-Dec-2023 00:02               10267
function.imap-subscribe.php                        03-Dec-2023 00:02                4290
function.imap-thread.php                           03-Dec-2023 00:02                7667
function.imap-timeout.php                          03-Dec-2023 00:02                4189
function.imap-uid.php                              03-Dec-2023 00:02                4490
function.imap-undelete.php                         03-Dec-2023 00:02                4826
function.imap-unsubscribe.php                      03-Dec-2023 00:02                4367
function.imap-utf7-decode.php                      03-Dec-2023 00:02                3558
function.imap-utf7-encode.php                      03-Dec-2023 00:02                3153
function.imap-utf8-to-mutf7.php                    03-Dec-2023 00:02                3155
function.imap-utf8.php                             03-Dec-2023 00:02                4093
function.implode.php                               03-Dec-2023 00:02                7341
function.in-array.php                              03-Dec-2023 00:02               11470
function.include-once.php                          03-Dec-2023 00:02                2259
function.include.php                               03-Dec-2023 00:02               19711
function.inet-ntop.php                             03-Dec-2023 00:02                6141
function.inet-pton.php                             03-Dec-2023 00:02                4703
function.inflate-add.php                           03-Dec-2023 00:02                5380
function.inflate-get-read-len.php                  03-Dec-2023 00:02                3267
function.inflate-get-status.php                    03-Dec-2023 00:02                3116
function.inflate-init.php                          03-Dec-2023 00:02                6429
function.ini-alter.php                             03-Dec-2023 00:02                1721
function.ini-get-all.php                           03-Dec-2023 00:02                9653
function.ini-get.php                               03-Dec-2023 00:02               10239
function.ini-parse-quantity.php                    03-Dec-2023 00:02                7347
function.ini-restore.php                           03-Dec-2023 00:02                6317
function.ini-set.php                               03-Dec-2023 00:02                6239
function.inotify-add-watch.php                     03-Dec-2023 00:02                3952
function.inotify-init.php                          03-Dec-2023 00:02                8743
function.inotify-queue-len.php                     03-Dec-2023 00:02                3785
function.inotify-read.php                          03-Dec-2023 00:02                4406
function.inotify-rm-watch.php                      03-Dec-2023 00:02                3417
function.intdiv.php                                03-Dec-2023 00:02                6715
function.interface-exists.php                      03-Dec-2023 00:02                5213
function.intl-error-name.php                       03-Dec-2023 00:02                4934
function.intl-get-error-code.php                   03-Dec-2023 00:02                4529
function.intl-get-error-message.php                03-Dec-2023 00:02                4538
function.intl-is-failure.php                       03-Dec-2023 00:02                5373
function.intval.php                                03-Dec-2023 00:02               13737
function.ip2long.php                               03-Dec-2023 00:02                8978
function.iptcembed.php                             03-Dec-2023 00:02               11302
function.iptcparse.php                             03-Dec-2023 00:02                4431
function.is-a.php                                  03-Dec-2023 00:02                6450
function.is-array.php                              03-Dec-2023 00:02                5642
function.is-bool.php                               03-Dec-2023 00:02                5585
function.is-callable.php                           03-Dec-2023 00:02               10789
function.is-countable.php                          03-Dec-2023 00:02                6336
function.is-dir.php                                03-Dec-2023 00:02                6506
function.is-double.php                             03-Dec-2023 00:02                1719
function.is-executable.php                         03-Dec-2023 00:02                6266
function.is-file.php                               03-Dec-2023 00:02                5833
function.is-finite.php                             03-Dec-2023 00:02                5773
function.is-float.php                              03-Dec-2023 00:02                5229
function.is-infinite.php                           03-Dec-2023 00:02                4948
function.is-int.php                                03-Dec-2023 00:02                6618
function.is-integer.php                            03-Dec-2023 00:02                1708
function.is-iterable.php                           03-Dec-2023 00:02                5710
function.is-link.php                               03-Dec-2023 00:02                5544
function.is-long.php                               03-Dec-2023 00:02                1693
function.is-nan.php                                03-Dec-2023 00:02                5660
function.is-null.php                               03-Dec-2023 00:02                5982
function.is-numeric.php                            03-Dec-2023 00:02               12010
function.is-object.php                             03-Dec-2023 00:02                7083
function.is-readable.php                           03-Dec-2023 00:02                6043
function.is-real.php                               03-Dec-2023 00:02                1901
function.is-resource.php                           03-Dec-2023 00:02                4902
function.is-scalar.php                             03-Dec-2023 00:02                7890
function.is-soap-fault.php                         03-Dec-2023 00:02                7999
function.is-string.php                             03-Dec-2023 00:02                6645
function.is-subclass-of.php                        03-Dec-2023 00:02               12240
function.is-tainted.php                            03-Dec-2023 00:02                2252
function.is-uploaded-file.php                      03-Dec-2023 00:02                6669
function.is-writable.php                           03-Dec-2023 00:02                5763
function.is-writeable.php                          03-Dec-2023 00:02                1736
function.isset.php                                 03-Dec-2023 00:02               16087
function.iterator-apply.php                        03-Dec-2023 00:02                6480
function.iterator-count.php                        03-Dec-2023 00:02                8437
function.iterator-to-array.php                     03-Dec-2023 00:02                7096
function.jddayofweek.php                           03-Dec-2023 00:02                3540
function.jdmonthname.php                           03-Dec-2023 00:02                4510
function.jdtofrench.php                            03-Dec-2023 00:02                3121
function.jdtogregorian.php                         03-Dec-2023 00:02                3152
function.jdtojewish.php                            03-Dec-2023 00:02                6964
function.jdtojulian.php                            03-Dec-2023 00:02                3186
function.jdtounix.php                              03-Dec-2023 00:02                4323
function.jewishtojd.php                            03-Dec-2023 00:02                4504
function.join.php                                  03-Dec-2023 00:02                1648
function.jpeg2wbmp.php                             03-Dec-2023 00:02                6235
function.json-decode.php                           03-Dec-2023 00:02               18856
function.json-encode.php                           03-Dec-2023 00:02               29432
function.json-last-error-msg.php                   03-Dec-2023 00:02                3027
function.json-last-error.php                       03-Dec-2023 00:02               13210
function.json-validate.php                         03-Dec-2023 00:02                7937
function.juliantojd.php                            03-Dec-2023 00:02                4502
function.key-exists.php                            03-Dec-2023 00:02                1714
function.key.php                                   03-Dec-2023 00:02                7617
function.krsort.php                                03-Dec-2023 00:02                8231
function.ksort.php                                 03-Dec-2023 00:02               10136
function.lcfirst.php                               03-Dec-2023 00:02                5847
function.lcg-value.php                             03-Dec-2023 00:02                5153
function.lchgrp.php                                03-Dec-2023 00:02                5905
function.lchown.php                                03-Dec-2023 00:02                5725
function.ldap-8859-to-t61.php                      03-Dec-2023 00:02                3201
function.ldap-add-ext.php                          03-Dec-2023 00:02                5528
function.ldap-add.php                              03-Dec-2023 00:02               10099
function.ldap-bind-ext.php                         03-Dec-2023 00:02                5545
function.ldap-bind.php                             03-Dec-2023 00:02                9122
function.ldap-close.php                            03-Dec-2023 00:02                1691
function.ldap-compare.php                          03-Dec-2023 00:02                9833
function.ldap-connect.php                          03-Dec-2023 00:02                9352
function.ldap-control-paged-result-response.php    03-Dec-2023 00:02                5562
function.ldap-control-paged-result.php             03-Dec-2023 00:02               14112
function.ldap-count-entries.php                    03-Dec-2023 00:02                5647
function.ldap-count-references.php                 03-Dec-2023 00:02                4764
function.ldap-delete-ext.php                       03-Dec-2023 00:02                5112
function.ldap-delete.php                           03-Dec-2023 00:02                5057
function.ldap-dn2ufn.php                           03-Dec-2023 00:02                2555
function.ldap-err2str.php                          03-Dec-2023 00:02                4550
function.ldap-errno.php                            03-Dec-2023 00:02                7532
function.ldap-error.php                            03-Dec-2023 00:02                4519
function.ldap-escape.php                           03-Dec-2023 00:02                6118
function.ldap-exop-passwd.php                      03-Dec-2023 00:02                9930
function.ldap-exop-refresh.php                     03-Dec-2023 00:02                4968
function.ldap-exop-whoami.php                      03-Dec-2023 00:02                3852
function.ldap-exop.php                             03-Dec-2023 00:02               11740
function.ldap-explode-dn.php                       03-Dec-2023 00:02                3409
function.ldap-first-attribute.php                  03-Dec-2023 00:02                5448
function.ldap-first-entry.php                      03-Dec-2023 00:02                5855
function.ldap-first-reference.php                  03-Dec-2023 00:02                2369
function.ldap-free-result.php                      03-Dec-2023 00:02                3983
function.ldap-get-attributes.php                   03-Dec-2023 00:02                8295
function.ldap-get-dn.php                           03-Dec-2023 00:02                4274
function.ldap-get-entries.php                      03-Dec-2023 00:02                6083
function.ldap-get-option.php                       03-Dec-2023 00:02               12598
function.ldap-get-values-len.php                   03-Dec-2023 00:02                5438
function.ldap-get-values.php                       03-Dec-2023 00:02                8550
function.ldap-list.php                             03-Dec-2023 00:02               14399
function.ldap-mod-add.php                          03-Dec-2023 00:02                6536
function.ldap-mod-del.php                          03-Dec-2023 00:02                6081
function.ldap-mod-replace.php                      03-Dec-2023 00:02                6481
function.ldap-mod_add-ext.php                      03-Dec-2023 00:02                5523
function.ldap-mod_del-ext.php                      03-Dec-2023 00:02                5539
function.ldap-mod_replace-ext.php                  03-Dec-2023 00:02                5601
function.ldap-modify-batch.php                     03-Dec-2023 00:02               18633
function.ldap-modify.php                           03-Dec-2023 00:02                2112
function.ldap-next-attribute.php                   03-Dec-2023 00:02                5212
function.ldap-next-entry.php                       03-Dec-2023 00:02                5909
function.ldap-next-reference.php                   03-Dec-2023 00:02                2339
function.ldap-parse-exop.php                       03-Dec-2023 00:02                5688
function.ldap-parse-reference.php                  03-Dec-2023 00:02                2347
function.ldap-parse-result.php                     03-Dec-2023 00:02                9182
function.ldap-read.php                             03-Dec-2023 00:02               11702
function.ldap-rename-ext.php                       03-Dec-2023 00:02                5752
function.ldap-rename.php                           03-Dec-2023 00:02                6740
function.ldap-sasl-bind.php                        03-Dec-2023 00:02                5954
function.ldap-search.php                           03-Dec-2023 00:02               14586
function.ldap-set-option.php                       03-Dec-2023 00:02               15132
function.ldap-set-rebind-proc.php                  03-Dec-2023 00:02                3164
function.ldap-sort.php                             03-Dec-2023 00:02                6994
function.ldap-start-tls.php                        03-Dec-2023 00:02                1976
function.ldap-t61-to-8859.php                      03-Dec-2023 00:02                2041
function.ldap-unbind.php                           03-Dec-2023 00:02                3742
function.levenshtein.php                           03-Dec-2023 00:02               12054
function.libxml-clear-errors.php                   03-Dec-2023 00:02                2696
function.libxml-disable-entity-loader.php          03-Dec-2023 00:02                4671
function.libxml-get-errors.php                     03-Dec-2023 00:02               10341
function.libxml-get-external-entity-loader.php     03-Dec-2023 00:02                3341
function.libxml-get-last-error.php                 03-Dec-2023 00:02                2893
function.libxml-set-external-entity-loader.php     03-Dec-2023 00:02                9803
function.libxml-set-streams-context.php            03-Dec-2023 00:02                5050
function.libxml-use-internal-errors.php            03-Dec-2023 00:02                6433
function.link.php                                  03-Dec-2023 00:02                5707
function.linkinfo.php                              03-Dec-2023 00:02                4530
function.list.php                                  03-Dec-2023 00:02               16998
function.localeconv.php                            03-Dec-2023 00:02                9124
function.localtime.php                             03-Dec-2023 00:02                8618
function.log.php                                   03-Dec-2023 00:02                3862
function.log10.php                                 03-Dec-2023 00:02                2600
function.log1p.php                                 03-Dec-2023 00:02                3398
function.long2ip.php                               03-Dec-2023 00:02                4100
function.lstat.php                                 03-Dec-2023 00:02                6338
function.ltrim.php                                 03-Dec-2023 00:02                9488
function.lzf-compress.php                          03-Dec-2023 00:02                2840
function.lzf-decompress.php                        03-Dec-2023 00:02                2908
function.lzf-optimized-for.php                     03-Dec-2023 00:02                2005
function.mail.php                                  03-Dec-2023 00:02               25999
function.mailparse-determine-best-xfer-encoding..> 03-Dec-2023 00:02                4141
function.mailparse-msg-create.php                  03-Dec-2023 00:02                3346
function.mailparse-msg-extract-part-file.php       03-Dec-2023 00:02                5052
function.mailparse-msg-extract-part.php            03-Dec-2023 00:02                4012
function.mailparse-msg-extract-whole-part-file.php 03-Dec-2023 00:02                3999
function.mailparse-msg-free.php                    03-Dec-2023 00:02                3453
function.mailparse-msg-get-part-data.php           03-Dec-2023 00:02                2461
function.mailparse-msg-get-part.php                03-Dec-2023 00:02                2682
function.mailparse-msg-get-structure.php           03-Dec-2023 00:02                2481
function.mailparse-msg-parse-file.php              03-Dec-2023 00:02                4107
function.mailparse-msg-parse.php                   03-Dec-2023 00:02                3282
function.mailparse-rfc822-parse-addresses.php      03-Dec-2023 00:02                5425
function.mailparse-stream-encode.php               03-Dec-2023 00:02                5558
function.mailparse-uudecode-all.php                03-Dec-2023 00:02                6783
function.max.php                                   03-Dec-2023 00:02               12148
function.mb-check-encoding.php                     03-Dec-2023 00:02                4700
function.mb-chr.php                                03-Dec-2023 00:02                6735
function.mb-convert-case.php                       03-Dec-2023 00:02               10771
function.mb-convert-encoding.php                   03-Dec-2023 00:02               10207
function.mb-convert-kana.php                       03-Dec-2023 00:02                9684
function.mb-convert-variables.php                  03-Dec-2023 00:02                6300
function.mb-decode-mimeheader.php                  03-Dec-2023 00:02                3013
function.mb-decode-numericentity.php               03-Dec-2023 00:02               33487
function.mb-detect-encoding.php                    03-Dec-2023 00:02               14788
function.mb-detect-order.php                       03-Dec-2023 00:02                8470
function.mb-encode-mimeheader.php                  03-Dec-2023 00:02                9264
function.mb-encode-numericentity.php               03-Dec-2023 00:02               12163
function.mb-encoding-aliases.php                   03-Dec-2023 00:02                6148
function.mb-ereg-match.php                         03-Dec-2023 00:02                5211
function.mb-ereg-replace-callback.php              03-Dec-2023 00:02               11941
function.mb-ereg-replace.php                       03-Dec-2023 00:02                6648
function.mb-ereg-search-getpos.php                 03-Dec-2023 00:02                3885
function.mb-ereg-search-getregs.php                03-Dec-2023 00:02                4228
function.mb-ereg-search-init.php                   03-Dec-2023 00:02                5727
function.mb-ereg-search-pos.php                    03-Dec-2023 00:02                5611
function.mb-ereg-search-regs.php                   03-Dec-2023 00:02                5363
function.mb-ereg-search-setpos.php                 03-Dec-2023 00:02                4403
function.mb-ereg-search.php                        03-Dec-2023 00:02                5276
function.mb-ereg.php                               03-Dec-2023 00:02                6111
function.mb-eregi-replace.php                      03-Dec-2023 00:02                6532
function.mb-eregi.php                              03-Dec-2023 00:02                6155
function.mb-get-info.php                           03-Dec-2023 00:02                5889
function.mb-http-input.php                         03-Dec-2023 00:02                4690
function.mb-http-output.php                        03-Dec-2023 00:02                4676
function.mb-internal-encoding.php                  03-Dec-2023 00:02                6620
function.mb-language.php                           03-Dec-2023 00:02                6145
function.mb-list-encodings.php                     03-Dec-2023 00:02                4997
function.mb-ord.php                                03-Dec-2023 00:02                6470
function.mb-output-handler.php                     03-Dec-2023 00:02                5039
function.mb-parse-str.php                          03-Dec-2023 00:02                4333
function.mb-preferred-mime-name.php                03-Dec-2023 00:02                4240
function.mb-regex-encoding.php                     03-Dec-2023 00:02                4270
function.mb-regex-set-options.php                  03-Dec-2023 00:02                8268
function.mb-scrub.php                              03-Dec-2023 00:02                3785
function.mb-send-mail.php                          03-Dec-2023 00:02                9202
function.mb-split.php                              03-Dec-2023 00:02                4407
function.mb-str-pad.php                            03-Dec-2023 00:02                7879
function.mb-str-split.php                          03-Dec-2023 00:02                5000
function.mb-strcut.php                             03-Dec-2023 00:02                7124
function.mb-strimwidth.php                         03-Dec-2023 00:02                7487
function.mb-stripos.php                            03-Dec-2023 00:02                6089
function.mb-stristr.php                            03-Dec-2023 00:02                6199
function.mb-strlen.php                             03-Dec-2023 00:02                4752
function.mb-strpos.php                             03-Dec-2023 00:02                5951
function.mb-strrchr.php                            03-Dec-2023 00:02                6047
function.mb-strrichr.php                           03-Dec-2023 00:02                6087
function.mb-strripos.php                           03-Dec-2023 00:02                6004
function.mb-strrpos.php                            03-Dec-2023 00:02                6225
function.mb-strstr.php                             03-Dec-2023 00:02                6004
function.mb-strtolower.php                         03-Dec-2023 00:02                6981
function.mb-strtoupper.php                         03-Dec-2023 00:02                6895
function.mb-strwidth.php                           03-Dec-2023 00:02                8744
function.mb-substitute-character.php               03-Dec-2023 00:02                6631
function.mb-substr-count.php                       03-Dec-2023 00:02                5657
function.mb-substr.php                             03-Dec-2023 00:02                6150
function.mcrypt-create-iv.php                      03-Dec-2023 00:02                6453
function.mcrypt-decrypt.php                        03-Dec-2023 00:02                5432
function.mcrypt-enc-get-algorithms-name.php        03-Dec-2023 00:02                5204
function.mcrypt-enc-get-block-size.php             03-Dec-2023 00:02                2914
function.mcrypt-enc-get-iv-size.php                03-Dec-2023 00:02                3039
function.mcrypt-enc-get-key-size.php               03-Dec-2023 00:02                2918
function.mcrypt-enc-get-modes-name.php             03-Dec-2023 00:02                5106
function.mcrypt-enc-get-supported-key-sizes.php    03-Dec-2023 00:02                4890
function.mcrypt-enc-is-block-algorithm-mode.php    03-Dec-2023 00:02                3281
function.mcrypt-enc-is-block-algorithm.php         03-Dec-2023 00:02                3105
function.mcrypt-enc-is-block-mode.php              03-Dec-2023 00:02                3109
function.mcrypt-enc-self-test.php                  03-Dec-2023 00:02                2942
function.mcrypt-encrypt.php                        03-Dec-2023 00:02               13383
function.mcrypt-generic-deinit.php                 03-Dec-2023 00:02                3871
function.mcrypt-generic-init.php                   03-Dec-2023 00:02                4994
function.mcrypt-generic.php                        03-Dec-2023 00:02                5768
function.mcrypt-get-block-size.php                 03-Dec-2023 00:02                6345
function.mcrypt-get-cipher-name.php                03-Dec-2023 00:02                4703
function.mcrypt-get-iv-size.php                    03-Dec-2023 00:02                6328
function.mcrypt-get-key-size.php                   03-Dec-2023 00:02                6473
function.mcrypt-list-algorithms.php                03-Dec-2023 00:02                4669
function.mcrypt-list-modes.php                     03-Dec-2023 00:02                4563
function.mcrypt-module-close.php                   03-Dec-2023 00:02                3292
function.mcrypt-module-get-algo-block-size.php     03-Dec-2023 00:02                3378
function.mcrypt-module-get-algo-key-size.php       03-Dec-2023 00:02                3445
function.mcrypt-module-get-supported-key-sizes.php 03-Dec-2023 00:02                4532
function.mcrypt-module-is-block-algorithm-mode.php 03-Dec-2023 00:02                3958
function.mcrypt-module-is-block-algorithm.php      03-Dec-2023 00:02                3705
function.mcrypt-module-is-block-mode.php           03-Dec-2023 00:02                3987
function.mcrypt-module-open.php                    03-Dec-2023 00:02               13835
function.mcrypt-module-self-test.php               03-Dec-2023 00:02                4786
function.md5-file.php                              03-Dec-2023 00:02                4925
function.md5.php                                   03-Dec-2023 00:02                5821
function.mdecrypt-generic.php                      03-Dec-2023 00:02               10756
function.memcache-debug.php                        03-Dec-2023 00:02                3226
function.memory-get-peak-usage.php                 03-Dec-2023 00:02                3500
function.memory-get-usage.php                      03-Dec-2023 00:02                5357
function.memory-reset-peak-usage.php               03-Dec-2023 00:02                4965
function.metaphone.php                             03-Dec-2023 00:02                7884
function.method-exists.php                         03-Dec-2023 00:02                6353
function.mhash-count.php                           03-Dec-2023 00:02                3563
function.mhash-get-block-size.php                  03-Dec-2023 00:02                3425
function.mhash-get-hash-name.php                   03-Dec-2023 00:02                3322
function.mhash-keygen-s2k.php                      03-Dec-2023 00:02                4437
function.mhash.php                                 03-Dec-2023 00:02                3362
function.microtime.php                             03-Dec-2023 00:02                7650
function.mime-content-type.php                     03-Dec-2023 00:02                4800
function.min.php                                   03-Dec-2023 00:02               12731
function.mkdir.php                                 03-Dec-2023 00:02                9233
function.mktime.php                                03-Dec-2023 00:02               18248
function.money-format.php                          03-Dec-2023 00:02               18599
function.mongodb.bson-fromjson.php                 03-Dec-2023 00:02                5739
function.mongodb.bson-fromphp.php                  03-Dec-2023 00:02                5892
function.mongodb.bson-tocanonicalextendedjson.php  03-Dec-2023 00:02               13825
function.mongodb.bson-tojson.php                   03-Dec-2023 00:02               14790
function.mongodb.bson-tophp.php                    03-Dec-2023 00:02                8911
function.mongodb.bson-torelaxedextendedjson.php    03-Dec-2023 00:02               13522
function.mongodb.driver.monitoring.addsubscribe..> 03-Dec-2023 00:02                5163
function.mongodb.driver.monitoring.removesubscr..> 03-Dec-2023 00:02                5008
function.move-uploaded-file.php                    03-Dec-2023 00:02                8402
function.mqseries-back.php                         03-Dec-2023 00:02                6317
function.mqseries-begin.php                        03-Dec-2023 00:02                7224
function.mqseries-close.php                        03-Dec-2023 00:02                6374
function.mqseries-cmit.php                         03-Dec-2023 00:02                6247
function.mqseries-conn.php                         03-Dec-2023 00:02                5727
function.mqseries-connx.php                        03-Dec-2023 00:02               12375
function.mqseries-disc.php                         03-Dec-2023 00:02                5500
function.mqseries-get.php                          03-Dec-2023 00:02               11816
function.mqseries-inq.php                          03-Dec-2023 00:02                8795
function.mqseries-open.php                         03-Dec-2023 00:02                6926
function.mqseries-put.php                          03-Dec-2023 00:02               12203
function.mqseries-put1.php                         03-Dec-2023 00:02                5932
function.mqseries-set.php                          03-Dec-2023 00:02                5669
function.mqseries-strerror.php                     03-Dec-2023 00:02                4130
function.msg-get-queue.php                         03-Dec-2023 00:02                5471
function.msg-queue-exists.php                      03-Dec-2023 00:02                3250
function.msg-receive.php                           03-Dec-2023 00:02               10532
function.msg-remove-queue.php                      03-Dec-2023 00:02                4451
function.msg-send.php                              03-Dec-2023 00:02                8314
function.msg-set-queue.php                         03-Dec-2023 00:02                5055
function.msg-stat-queue.php                        03-Dec-2023 00:02                6507
function.mt-getrandmax.php                         03-Dec-2023 00:02                3271
function.mt-rand.php                               03-Dec-2023 00:02               10088
function.mt-srand.php                              03-Dec-2023 00:02                7640
function.mysql-affected-rows.php                   03-Dec-2023 00:02               11988
function.mysql-client-encoding.php                 03-Dec-2023 00:02                6045
function.mysql-close.php                           03-Dec-2023 00:02                7165
function.mysql-connect.php                         03-Dec-2023 00:02               16453
function.mysql-create-db.php                       03-Dec-2023 00:02                8202
function.mysql-data-seek.php                       03-Dec-2023 00:02               11649
function.mysql-db-name.php                         03-Dec-2023 00:02                7688
function.mysql-db-query.php                        03-Dec-2023 00:02                9509
function.mysql-drop-db.php                         03-Dec-2023 00:02                7496
function.mysql-errno.php                           03-Dec-2023 00:02                8035
function.mysql-error.php                           03-Dec-2023 00:02                8006
function.mysql-escape-string.php                   03-Dec-2023 00:02                6475
function.mysql-fetch-array.php                     03-Dec-2023 00:02               14939
function.mysql-fetch-assoc.php                     03-Dec-2023 00:02               11265
function.mysql-fetch-field.php                     03-Dec-2023 00:02               12690
function.mysql-fetch-lengths.php                   03-Dec-2023 00:02                7385
function.mysql-fetch-object.php                    03-Dec-2023 00:02               11503
function.mysql-fetch-row.php                       03-Dec-2023 00:02                7561
function.mysql-field-flags.php                     03-Dec-2023 00:02                8267
function.mysql-field-len.php                       03-Dec-2023 00:02                6732
function.mysql-field-name.php                      03-Dec-2023 00:02                8800
function.mysql-field-seek.php                      03-Dec-2023 00:02                4788
function.mysql-field-table.php                     03-Dec-2023 00:02                7418
function.mysql-field-type.php                      03-Dec-2023 00:02               11426
function.mysql-free-result.php                     03-Dec-2023 00:02                7430
function.mysql-get-client-info.php                 03-Dec-2023 00:02                5148
function.mysql-get-host-info.php                   03-Dec-2023 00:02                6812
function.mysql-get-proto-info.php                  03-Dec-2023 00:02                6459
function.mysql-get-server-info.php                 03-Dec-2023 00:02                6913
function.mysql-info.php                            03-Dec-2023 00:02                6172
function.mysql-insert-id.php                       03-Dec-2023 00:02                8093
function.mysql-list-dbs.php                        03-Dec-2023 00:02                8561
function.mysql-list-fields.php                     03-Dec-2023 00:02                8567
function.mysql-list-processes.php                  03-Dec-2023 00:02                7312
function.mysql-list-tables.php                     03-Dec-2023 00:02                9263
function.mysql-num-fields.php                      03-Dec-2023 00:02                6395
function.mysql-num-rows.php                        03-Dec-2023 00:02                8013
function.mysql-pconnect.php                        03-Dec-2023 00:02                7746
function.mysql-ping.php                            03-Dec-2023 00:02                7681
function.mysql-query.php                           03-Dec-2023 00:02               13439
function.mysql-real-escape-string.php              03-Dec-2023 00:02               14781
function.mysql-result.php                          03-Dec-2023 00:02                9441
function.mysql-select-db.php                       03-Dec-2023 00:02                7446
function.mysql-set-charset.php                     03-Dec-2023 00:02                5619
function.mysql-stat.php                            03-Dec-2023 00:02                9026
function.mysql-tablename.php                       03-Dec-2023 00:02                7865
function.mysql-thread-id.php                       03-Dec-2023 00:02                6397
function.mysql-unbuffered-query.php                03-Dec-2023 00:02                6715
function.mysql-xdevapi-expression.php              03-Dec-2023 00:02                4680
function.mysql-xdevapi-getsession.php              03-Dec-2023 00:02               12976
function.mysqli-connect.php                        03-Dec-2023 00:02                2320
function.mysqli-escape-string.php                  03-Dec-2023 00:02                1938
function.mysqli-execute.php                        03-Dec-2023 00:02                2505
function.mysqli-get-client-stats.php               03-Dec-2023 00:02                8311
function.mysqli-get-links-stats.php                03-Dec-2023 00:02                3201
function.mysqli-report.php                         03-Dec-2023 00:02                1737
function.mysqli-set-opt.php                        03-Dec-2023 00:02                1824
function.natcasesort.php                           03-Dec-2023 00:02                7717
function.natsort.php                               03-Dec-2023 00:02               10939
function.net-get-interfaces.php                    03-Dec-2023 00:02                4487
function.next.php                                  03-Dec-2023 00:02                9234
function.ngettext.php                              03-Dec-2023 00:02                5362
function.nl-langinfo.php                           03-Dec-2023 00:02               14822
function.nl2br.php                                 03-Dec-2023 00:02                6639
function.number-format.php                         03-Dec-2023 00:02                8459
function.oauth-get-sbs.php                         03-Dec-2023 00:02                2931
function.oauth-urlencode.php                       03-Dec-2023 00:02                2470
function.ob-clean.php                              03-Dec-2023 00:02                2957
function.ob-end-clean.php                          03-Dec-2023 00:02                5248
function.ob-end-flush.php                          03-Dec-2023 00:02                6022
function.ob-flush.php                              03-Dec-2023 00:02                3560
function.ob-get-clean.php                          03-Dec-2023 00:02                5325
function.ob-get-contents.php                       03-Dec-2023 00:02                4372
function.ob-get-flush.php                          03-Dec-2023 00:02                5647
function.ob-get-length.php                         03-Dec-2023 00:02                4327
function.ob-get-level.php                          03-Dec-2023 00:02                2824
function.ob-get-status.php                         03-Dec-2023 00:02                6813
function.ob-gzhandler.php                          03-Dec-2023 00:02                5713
function.ob-iconv-handler.php                      03-Dec-2023 00:02                5145
function.ob-implicit-flush.php                     03-Dec-2023 00:02                4191
function.ob-list-handlers.php                      03-Dec-2023 00:02                5824
function.ob-start.php                              03-Dec-2023 00:02               16513
function.ob-tidyhandler.php                        03-Dec-2023 00:02                4218
function.oci-bind-array-by-name.php                03-Dec-2023 00:02               12818
function.oci-bind-by-name.php                      03-Dec-2023 00:02               77806
function.oci-cancel.php                            03-Dec-2023 00:02                2481
function.oci-client-version.php                    03-Dec-2023 00:02                3905
function.oci-close.php                             03-Dec-2023 00:02               18341
function.oci-commit.php                            03-Dec-2023 00:02               10700
function.oci-connect.php                           03-Dec-2023 00:02               34591
function.oci-define-by-name.php                    03-Dec-2023 00:02               23667
function.oci-error.php                             03-Dec-2023 00:02               11338
function.oci-execute.php                           03-Dec-2023 00:02               20554
function.oci-fetch-all.php                         03-Dec-2023 00:02               24196
function.oci-fetch-array.php                       03-Dec-2023 00:02               63461
function.oci-fetch-assoc.php                       03-Dec-2023 00:02                8619
function.oci-fetch-object.php                      03-Dec-2023 00:02               18072
function.oci-fetch-row.php                         03-Dec-2023 00:02                8562
function.oci-fetch.php                             03-Dec-2023 00:02               13425
function.oci-field-is-null.php                     03-Dec-2023 00:02                7401
function.oci-field-name.php                        03-Dec-2023 00:02                9546
function.oci-field-precision.php                   03-Dec-2023 00:02                8391
function.oci-field-scale.php                       03-Dec-2023 00:02                8369
function.oci-field-size.php                        03-Dec-2023 00:02                9985
function.oci-field-type-raw.php                    03-Dec-2023 00:02                7616
function.oci-field-type.php                        03-Dec-2023 00:02               10224
function.oci-free-descriptor.php                   03-Dec-2023 00:02                3389
function.oci-free-statement.php                    03-Dec-2023 00:02                2761
function.oci-get-implicit-resultset.php            03-Dec-2023 00:02               28078
function.oci-internal-debug.php                    03-Dec-2023 00:02                2888
function.oci-lob-copy.php                          03-Dec-2023 00:02                4303
function.oci-lob-is-equal.php                      03-Dec-2023 00:02                3128
function.oci-new-collection.php                    03-Dec-2023 00:02                4704
function.oci-new-connect.php                       03-Dec-2023 00:02               15810
function.oci-new-cursor.php                        03-Dec-2023 00:02                7561
function.oci-new-descriptor.php                    03-Dec-2023 00:02               17820
function.oci-num-fields.php                        03-Dec-2023 00:02                6751
function.oci-num-rows.php                          03-Dec-2023 00:02                7743
function.oci-parse.php                             03-Dec-2023 00:02               12302
function.oci-password-change.php                   03-Dec-2023 00:02               12812
function.oci-pconnect.php                          03-Dec-2023 00:02               14223
function.oci-register-taf-callback.php             03-Dec-2023 00:02                5322
function.oci-result.php                            03-Dec-2023 00:02                8526
function.oci-rollback.php                          03-Dec-2023 00:02               14001
function.oci-server-version.php                    03-Dec-2023 00:02                4577
function.oci-set-action.php                        03-Dec-2023 00:02                8312
function.oci-set-call-timout.php                   03-Dec-2023 00:02                5692
function.oci-set-client-identifier.php             03-Dec-2023 00:02                8000
function.oci-set-client-info.php                   03-Dec-2023 00:02                8234
function.oci-set-db-operation.php                  03-Dec-2023 00:02                7644
function.oci-set-edition.php                       03-Dec-2023 00:02                9521
function.oci-set-module-name.php                   03-Dec-2023 00:02                8368
function.oci-set-prefetch-lob.php                  03-Dec-2023 00:02                8561
function.oci-set-prefetch.php                      03-Dec-2023 00:02               20456
function.oci-statement-type.php                    03-Dec-2023 00:02                6854
function.oci-unregister-taf-callback.php           03-Dec-2023 00:02                3438
function.ocibindbyname.php                         03-Dec-2023 00:02                1962
function.ocicancel.php                             03-Dec-2023 00:02                1904
function.ocicloselob.php                           03-Dec-2023 00:02                1903
function.ocicollappend.php                         03-Dec-2023 00:02                1968
function.ocicollassign.php                         03-Dec-2023 00:02                1973
function.ocicollassignelem.php                     03-Dec-2023 00:02                2018
function.ocicollgetelem.php                        03-Dec-2023 00:02                1985
function.ocicollmax.php                            03-Dec-2023 00:02                1937
function.ocicollsize.php                           03-Dec-2023 00:02                1940
function.ocicolltrim.php                           03-Dec-2023 00:02                1950
function.ocicolumnisnull.php                       03-Dec-2023 00:02                1974
function.ocicolumnname.php                         03-Dec-2023 00:02                1966
function.ocicolumnprecision.php                    03-Dec-2023 00:02                2009
function.ocicolumnscale.php                        03-Dec-2023 00:02                1973
function.ocicolumnsize.php                         03-Dec-2023 00:02                1954
function.ocicolumntype.php                         03-Dec-2023 00:02                1958
function.ocicolumntyperaw.php                      03-Dec-2023 00:02                1981
function.ocicommit.php                             03-Dec-2023 00:02                1918
function.ocidefinebyname.php                       03-Dec-2023 00:02                1964
function.ocierror.php                              03-Dec-2023 00:02                1895
function.ociexecute.php                            03-Dec-2023 00:02                1899
function.ocifetch.php                              03-Dec-2023 00:02                1889
function.ocifetchinto.php                          03-Dec-2023 00:02                2625
function.ocifetchstatement.php                     03-Dec-2023 00:02                1982
function.ocifreecollection.php                     03-Dec-2023 00:02                2000
function.ocifreecursor.php                         03-Dec-2023 00:02                1972
function.ocifreedesc.php                           03-Dec-2023 00:02                1916
function.ocifreestatement.php                      03-Dec-2023 00:02                1991
function.ociinternaldebug.php                      03-Dec-2023 00:02                2005
function.ociloadlob.php                            03-Dec-2023 00:02                1901
function.ocilogoff.php                             03-Dec-2023 00:02                1888
function.ocilogon.php                              03-Dec-2023 00:02                1903
function.ocinewcollection.php                      03-Dec-2023 00:02                1989
function.ocinewcursor.php                          03-Dec-2023 00:02                1957
function.ocinewdescriptor.php                      03-Dec-2023 00:02                1979
function.ocinlogon.php                             03-Dec-2023 00:02                1928
function.ocinumcols.php                            03-Dec-2023 00:02                1913
function.ociparse.php                              03-Dec-2023 00:02                1883
function.ociplogon.php                             03-Dec-2023 00:02                1898
function.ociresult.php                             03-Dec-2023 00:02                1896
function.ocirollback.php                           03-Dec-2023 00:02                1918
function.ocirowcount.php                           03-Dec-2023 00:02                1920
function.ocisavelob.php                            03-Dec-2023 00:02                1901
function.ocisavelobfile.php                        03-Dec-2023 00:02                1939
function.ociserverversion.php                      03-Dec-2023 00:02                1993
function.ocisetprefetch.php                        03-Dec-2023 00:02                1979
function.ocistatementtype.php                      03-Dec-2023 00:02                1999
function.ociwritelobtofile.php                     03-Dec-2023 00:02                1980
function.ociwritetemporarylob.php                  03-Dec-2023 00:02                2003
function.octdec.php                                03-Dec-2023 00:02                5665
function.odbc-autocommit.php                       03-Dec-2023 00:02                4730
function.odbc-binmode.php                          03-Dec-2023 00:02                6492
function.odbc-close-all.php                        03-Dec-2023 00:02                2558
function.odbc-close.php                            03-Dec-2023 00:02                2830
function.odbc-columnprivileges.php                 03-Dec-2023 00:02                8382
function.odbc-columns.php                          03-Dec-2023 00:02               11100
function.odbc-commit.php                           03-Dec-2023 00:02                2528
function.odbc-connect.php                          03-Dec-2023 00:02                8445
function.odbc-connection-string-is-quoted.php      03-Dec-2023 00:02                3509
function.odbc-connection-string-quote.php          03-Dec-2023 00:02                5632
function.odbc-connection-string-should-quote.php   03-Dec-2023 00:02                3773
function.odbc-cursor.php                           03-Dec-2023 00:02                2391
function.odbc-data-source.php                      03-Dec-2023 00:02                5541
function.odbc-do.php                               03-Dec-2023 00:02                1673
function.odbc-error.php                            03-Dec-2023 00:02                3970
function.odbc-errormsg.php                         03-Dec-2023 00:02                4023
function.odbc-exec.php                             03-Dec-2023 00:02                3872
function.odbc-execute.php                          03-Dec-2023 00:02                6801
function.odbc-fetch-array.php                      03-Dec-2023 00:02                3925
function.odbc-fetch-into.php                       03-Dec-2023 00:02                4773
function.odbc-fetch-object.php                     03-Dec-2023 00:02                3930
function.odbc-fetch-row.php                        03-Dec-2023 00:02                4101
function.odbc-field-len.php                        03-Dec-2023 00:02                3232
function.odbc-field-name.php                       03-Dec-2023 00:02                2781
function.odbc-field-num.php                        03-Dec-2023 00:02                2794
function.odbc-field-precision.php                  03-Dec-2023 00:02                2246
function.odbc-field-scale.php                      03-Dec-2023 00:02                2813
function.odbc-field-type.php                       03-Dec-2023 00:02                2783
function.odbc-foreignkeys.php                      03-Dec-2023 00:02                8616
function.odbc-free-result.php                      03-Dec-2023 00:02                3293
function.odbc-gettypeinfo.php                      03-Dec-2023 00:02                4355
function.odbc-longreadlen.php                      03-Dec-2023 00:02                3300
function.odbc-next-result.php                      03-Dec-2023 00:02                8770
function.odbc-num-fields.php                       03-Dec-2023 00:02                2520
function.odbc-num-rows.php                         03-Dec-2023 00:02                3178
function.odbc-pconnect.php                         03-Dec-2023 00:02                4413
function.odbc-prepare.php                          03-Dec-2023 00:02                6109
function.odbc-primarykeys.php                      03-Dec-2023 00:02                7573
function.odbc-procedurecolumns.php                 03-Dec-2023 00:02               11303
function.odbc-procedures.php                       03-Dec-2023 00:02                9191
function.odbc-result-all.php                       03-Dec-2023 00:02                2910
function.odbc-result.php                           03-Dec-2023 00:02                5340
function.odbc-rollback.php                         03-Dec-2023 00:02                2547
function.odbc-setoption.php                        03-Dec-2023 00:02                6810
function.odbc-specialcolumns.php                   03-Dec-2023 00:02                7067
function.odbc-statistics.php                       03-Dec-2023 00:02                9349
function.odbc-tableprivileges.php                  03-Dec-2023 00:02                8004
function.odbc-tables.php                           03-Dec-2023 00:02               12026
function.opcache-compile-file.php                  03-Dec-2023 00:02                3681
function.opcache-get-configuration.php             03-Dec-2023 00:02                3248
function.opcache-get-status.php                    03-Dec-2023 00:02                3692
function.opcache-invalidate.php                    03-Dec-2023 00:02                4063
function.opcache-is-script-cached.php              03-Dec-2023 00:02                3323
function.opcache-reset.php                         03-Dec-2023 00:02                3356
function.openal-buffer-create.php                  03-Dec-2023 00:02                2798
function.openal-buffer-data.php                    03-Dec-2023 00:02                4400
function.openal-buffer-destroy.php                 03-Dec-2023 00:02                2990
function.openal-buffer-get.php                     03-Dec-2023 00:02                3538
function.openal-buffer-loadwav.php                 03-Dec-2023 00:02                3490
function.openal-context-create.php                 03-Dec-2023 00:02                3244
function.openal-context-current.php                03-Dec-2023 00:02                3045
function.openal-context-destroy.php                03-Dec-2023 00:02                3031
function.openal-context-process.php                03-Dec-2023 00:02                3449
function.openal-context-suspend.php                03-Dec-2023 00:02                3443
function.openal-device-close.php                   03-Dec-2023 00:02                2997
function.openal-device-open.php                    03-Dec-2023 00:02                3241
function.openal-listener-get.php                   03-Dec-2023 00:02                3153
function.openal-listener-set.php                   03-Dec-2023 00:02                3454
function.openal-source-create.php                  03-Dec-2023 00:02                2994
function.openal-source-destroy.php                 03-Dec-2023 00:02                2998
function.openal-source-get.php                     03-Dec-2023 00:02                4649
function.openal-source-pause.php                   03-Dec-2023 00:02                3329
function.openal-source-play.php                    03-Dec-2023 00:02                3328
function.openal-source-rewind.php                  03-Dec-2023 00:02                3338
function.openal-source-set.php                     03-Dec-2023 00:02                5181
function.openal-source-stop.php                    03-Dec-2023 00:02                3310
function.openal-stream.php                         03-Dec-2023 00:02                3922
function.opendir.php                               03-Dec-2023 00:02                7645
function.openlog.php                               03-Dec-2023 00:02                8396
function.openssl-cipher-iv-length.php              03-Dec-2023 00:02                4236
function.openssl-cipher-key-length.php             03-Dec-2023 00:02                4141
function.openssl-cms-decrypt.php                   03-Dec-2023 00:02                4634
function.openssl-cms-encrypt.php                   03-Dec-2023 00:02                5573
function.openssl-cms-read.php                      03-Dec-2023 00:02                3013
function.openssl-cms-sign.php                      03-Dec-2023 00:02                7212
function.openssl-cms-verify.php                    03-Dec-2023 00:02                6109
function.openssl-csr-export-to-file.php            03-Dec-2023 00:02                8157
function.openssl-csr-export.php                    03-Dec-2023 00:02                8084
function.openssl-csr-get-public-key.php            03-Dec-2023 00:02                8685
function.openssl-csr-get-subject.php               03-Dec-2023 00:02                9266
function.openssl-csr-new.php                       03-Dec-2023 00:02               20821
function.openssl-csr-sign.php                      03-Dec-2023 00:02               12882
function.openssl-decrypt.php                       03-Dec-2023 00:02                7096
function.openssl-dh-compute-key.php                03-Dec-2023 00:02               16203
function.openssl-digest.php                        03-Dec-2023 00:02                4189
function.openssl-encrypt.php                       03-Dec-2023 00:02               17330
function.openssl-error-string.php                  03-Dec-2023 00:02                3674
function.openssl-free-key.php                      03-Dec-2023 00:02                3747
function.openssl-get-cert-locations.php            03-Dec-2023 00:02                3977
function.openssl-get-cipher-methods.php            03-Dec-2023 00:02               13792
function.openssl-get-curve-names.php               03-Dec-2023 00:02                6957
function.openssl-get-md-methods.php                03-Dec-2023 00:02                6744
function.openssl-get-privatekey.php                03-Dec-2023 00:02                1895
function.openssl-get-publickey.php                 03-Dec-2023 00:02                1866
function.openssl-open.php                          03-Dec-2023 00:02                9607
function.openssl-pbkdf2.php                        03-Dec-2023 00:02                7160
function.openssl-pkcs12-export-to-file.php         03-Dec-2023 00:02                7031
function.openssl-pkcs12-export.php                 03-Dec-2023 00:02                7029
function.openssl-pkcs12-read.php                   03-Dec-2023 00:02                5325
function.openssl-pkcs7-decrypt.php                 03-Dec-2023 00:02                7160
function.openssl-pkcs7-encrypt.php                 03-Dec-2023 00:02               10028
function.openssl-pkcs7-read.php                    03-Dec-2023 00:02                6707
function.openssl-pkcs7-sign.php                    03-Dec-2023 00:02               11306
function.openssl-pkcs7-verify.php                  03-Dec-2023 00:02                7520
function.openssl-pkey-derive.php                   03-Dec-2023 00:02                7708
function.openssl-pkey-export-to-file.php           03-Dec-2023 00:02                6054
function.openssl-pkey-export.php                   03-Dec-2023 00:02                5917
function.openssl-pkey-free.php                     03-Dec-2023 00:02                3982
function.openssl-pkey-get-details.php              03-Dec-2023 00:02                9045
function.openssl-pkey-get-private.php              03-Dec-2023 00:02                5792
function.openssl-pkey-get-public.php               03-Dec-2023 00:02                5344
function.openssl-pkey-new.php                      03-Dec-2023 00:02                6826
function.openssl-private-decrypt.php               03-Dec-2023 00:02                6145
function.openssl-private-encrypt.php               03-Dec-2023 00:02                5974
function.openssl-public-decrypt.php                03-Dec-2023 00:02                6028
function.openssl-public-encrypt.php                03-Dec-2023 00:02                6229
function.openssl-random-pseudo-bytes.php           03-Dec-2023 00:02                8803
function.openssl-seal.php                          03-Dec-2023 00:02               10825
function.openssl-sign.php                          03-Dec-2023 00:02               12067
function.openssl-spki-export-challenge.php         03-Dec-2023 00:02                7436
function.openssl-spki-export.php                   03-Dec-2023 00:02                8194
function.openssl-spki-new.php                      03-Dec-2023 00:02                8888
function.openssl-spki-verify.php                   03-Dec-2023 00:02                7593
function.openssl-verify.php                        03-Dec-2023 00:02               12675
function.openssl-x509-check-private-key.php        03-Dec-2023 00:02                5497
function.openssl-x509-checkpurpose.php             03-Dec-2023 00:02                6979
function.openssl-x509-export-to-file.php           03-Dec-2023 00:02                4703
function.openssl-x509-export.php                   03-Dec-2023 00:02                4665
function.openssl-x509-fingerprint.php              03-Dec-2023 00:02                4932
function.openssl-x509-free.php                     03-Dec-2023 00:02                4007
function.openssl-x509-parse.php                    03-Dec-2023 00:02                4507
function.openssl-x509-read.php                     03-Dec-2023 00:02                4409
function.openssl-x509-verify.php                   03-Dec-2023 00:02               12268
function.ord.php                                   03-Dec-2023 00:02                7195
function.output-add-rewrite-var.php                03-Dec-2023 00:02                8108
function.output-reset-rewrite-vars.php             03-Dec-2023 00:02                6472
function.pack.php                                  03-Dec-2023 00:02               11884
function.parse-ini-file.php                        03-Dec-2023 00:02               19719
function.parse-ini-string.php                      03-Dec-2023 00:02                6708
function.parse-str.php                             03-Dec-2023 00:02                9970
function.parse-url.php                             03-Dec-2023 00:02               15362
function.passthru.php                              03-Dec-2023 00:02                7085
function.password-algos.php                        03-Dec-2023 00:02                3190
function.password-get-info.php                     03-Dec-2023 00:02                3464
function.password-hash.php                         03-Dec-2023 00:02               21240
function.password-needs-rehash.php                 03-Dec-2023 00:02                6591
function.password-verify.php                       03-Dec-2023 00:02                5447
function.pathinfo.php                              03-Dec-2023 00:02               13777
function.pclose.php                                03-Dec-2023 00:02                4815
function.pcntl-alarm.php                           03-Dec-2023 00:02                2813
function.pcntl-async-signals.php                   03-Dec-2023 00:02                3891
function.pcntl-errno.php                           03-Dec-2023 00:02                1758
function.pcntl-exec.php                            03-Dec-2023 00:02                3540
function.pcntl-fork.php                            03-Dec-2023 00:02                5017
function.pcntl-get-last-error.php                  03-Dec-2023 00:02                2724
function.pcntl-getpriority.php                     03-Dec-2023 00:02                5046
function.pcntl-rfork.php                           03-Dec-2023 00:02                7617
function.pcntl-setpriority.php                     03-Dec-2023 00:02                4960
function.pcntl-signal-dispatch.php                 03-Dec-2023 00:02                5532
function.pcntl-signal-get-handler.php              03-Dec-2023 00:02                6589
function.pcntl-signal.php                          03-Dec-2023 00:02               10819
function.pcntl-sigprocmask.php                     03-Dec-2023 00:02                5657
function.pcntl-sigtimedwait.php                    03-Dec-2023 00:02                4843
function.pcntl-sigwaitinfo.php                     03-Dec-2023 00:02                7172
function.pcntl-strerror.php                        03-Dec-2023 00:02                2871
function.pcntl-unshare.php                         03-Dec-2023 00:02                4257
function.pcntl-wait.php                            03-Dec-2023 00:02                7885
function.pcntl-waitpid.php                         03-Dec-2023 00:02                9212
function.pcntl-wexitstatus.php                     03-Dec-2023 00:02                3567
function.pcntl-wifexited.php                       03-Dec-2023 00:02                3314
function.pcntl-wifsignaled.php                     03-Dec-2023 00:02                3366
function.pcntl-wifstopped.php                      03-Dec-2023 00:02                3367
function.pcntl-wstopsig.php                        03-Dec-2023 00:02                3572
function.pcntl-wtermsig.php                        03-Dec-2023 00:02                3762
function.pfsockopen.php                            03-Dec-2023 00:02                5112
function.pg-affected-rows.php                      03-Dec-2023 00:02                6745
function.pg-cancel-query.php                       03-Dec-2023 00:02                7258
function.pg-client-encoding.php                    03-Dec-2023 00:02                6605
function.pg-close.php                              03-Dec-2023 00:02                6538
function.pg-connect-poll.php                       03-Dec-2023 00:02                3645
function.pg-connect.php                            03-Dec-2023 00:02               10702
function.pg-connection-busy.php                    03-Dec-2023 00:02                5576
function.pg-connection-reset.php                   03-Dec-2023 00:02                5594
function.pg-connection-status.php                  03-Dec-2023 00:02                5352
function.pg-consume-input.php                      03-Dec-2023 00:02                3411
function.pg-convert.php                            03-Dec-2023 00:02                8275
function.pg-copy-from.php                          03-Dec-2023 00:02                7658
function.pg-copy-to.php                            03-Dec-2023 00:02                7085
function.pg-dbname.php                             03-Dec-2023 00:02                5089
function.pg-delete.php                             03-Dec-2023 00:02                8539
function.pg-end-copy.php                           03-Dec-2023 00:02                7075
function.pg-escape-bytea.php                       03-Dec-2023 00:02                7603
function.pg-escape-identifier.php                  03-Dec-2023 00:02                7612
function.pg-escape-literal.php                     03-Dec-2023 00:02                7977
function.pg-escape-string.php                      03-Dec-2023 00:02                7462
function.pg-execute.php                            03-Dec-2023 00:02               10151
function.pg-fetch-all-columns.php                  03-Dec-2023 00:02                6835
function.pg-fetch-all.php                          03-Dec-2023 00:02                8519
function.pg-fetch-array.php                        03-Dec-2023 00:02               11749
function.pg-fetch-assoc.php                        03-Dec-2023 00:02                8862
function.pg-fetch-object.php                       03-Dec-2023 00:02               10465
function.pg-fetch-result.php                       03-Dec-2023 00:02                8511
function.pg-fetch-row.php                          03-Dec-2023 00:02                8987
function.pg-field-is-null.php                      03-Dec-2023 00:02                7863
function.pg-field-name.php                         03-Dec-2023 00:02                8804
function.pg-field-num.php                          03-Dec-2023 00:02                6393
function.pg-field-prtlen.php                       03-Dec-2023 00:02               10179
function.pg-field-size.php                         03-Dec-2023 00:02                9051
function.pg-field-table.php                        03-Dec-2023 00:02                8207
function.pg-field-type-oid.php                     03-Dec-2023 00:02                7279
function.pg-field-type.php                         03-Dec-2023 00:02                7069
function.pg-flush.php                              03-Dec-2023 00:02                3412
function.pg-free-result.php                        03-Dec-2023 00:02                7149
function.pg-get-notify.php                         03-Dec-2023 00:02                6888
function.pg-get-pid.php                            03-Dec-2023 00:02                5037
function.pg-get-result.php                         03-Dec-2023 00:02                8473
function.pg-host.php                               03-Dec-2023 00:02                6132
function.pg-insert.php                             03-Dec-2023 00:02                9004
function.pg-last-error.php                         03-Dec-2023 00:02                7189
function.pg-last-notice.php                        03-Dec-2023 00:02                7544
function.pg-last-oid.php                           03-Dec-2023 00:02                7277
function.pg-lo-close.php                           03-Dec-2023 00:02                7018
function.pg-lo-create.php                          03-Dec-2023 00:02                8551
function.pg-lo-export.php                          03-Dec-2023 00:02                7939
function.pg-lo-import.php                          03-Dec-2023 00:02                7346
function.pg-lo-open.php                            03-Dec-2023 00:02                8759
function.pg-lo-read-all.php                        03-Dec-2023 00:02                6313
function.pg-lo-read.php                            03-Dec-2023 00:02                6832
function.pg-lo-seek.php                            03-Dec-2023 00:02                7440
function.pg-lo-tell.php                            03-Dec-2023 00:02                6823
function.pg-lo-truncate.php                        03-Dec-2023 00:02                6410
function.pg-lo-unlink.php                          03-Dec-2023 00:02                6901
function.pg-lo-write.php                           03-Dec-2023 00:02                7871
function.pg-meta-data.php                          03-Dec-2023 00:02                7094
function.pg-num-fields.php                         03-Dec-2023 00:02                5872
function.pg-num-rows.php                           03-Dec-2023 00:02                5845
function.pg-options.php                            03-Dec-2023 00:02                5446
function.pg-parameter-status.php                   03-Dec-2023 00:02                8162
function.pg-pconnect.php                           03-Dec-2023 00:02                9371
function.pg-ping.php                               03-Dec-2023 00:02                5830
function.pg-port.php                               03-Dec-2023 00:02                5604
function.pg-prepare.php                            03-Dec-2023 00:02               10098
function.pg-put-line.php                           03-Dec-2023 00:02                8507
function.pg-query-params.php                       03-Dec-2023 00:02               10519
function.pg-query.php                              03-Dec-2023 00:02               12113
function.pg-result-error-field.php                 03-Dec-2023 00:02                8487
function.pg-result-error.php                       03-Dec-2023 00:02                7933
function.pg-result-seek.php                        03-Dec-2023 00:02                7125
function.pg-result-status.php                      03-Dec-2023 00:02                7609
function.pg-select.php                             03-Dec-2023 00:02               10255
function.pg-send-execute.php                       03-Dec-2023 00:02               10099
function.pg-send-prepare.php                       03-Dec-2023 00:02               10472
function.pg-send-query-params.php                  03-Dec-2023 00:02                7748
function.pg-send-query.php                         03-Dec-2023 00:02                9524
function.pg-set-client-encoding.php                03-Dec-2023 00:02                8708
function.pg-set-error-context-visibility.php       03-Dec-2023 00:02                6494
function.pg-set-error-verbosity.php                03-Dec-2023 00:02                8305
function.pg-socket.php                             03-Dec-2023 00:02                3566
function.pg-trace.php                              03-Dec-2023 00:02                8636
function.pg-transaction-status.php                 03-Dec-2023 00:02                6138
function.pg-tty.php                                03-Dec-2023 00:02                5891
function.pg-unescape-bytea.php                     03-Dec-2023 00:02                6099
function.pg-untrace.php                            03-Dec-2023 00:02                6476
function.pg-update.php                             03-Dec-2023 00:02                9393
function.pg-version.php                            03-Dec-2023 00:02                6309
function.php-ini-loaded-file.php                   03-Dec-2023 00:02                4510
function.php-ini-scanned-files.php                 03-Dec-2023 00:02                6182
function.php-sapi-name.php                         03-Dec-2023 00:02                5739
function.php-strip-whitespace.php                  03-Dec-2023 00:02                4743
function.php-uname.php                             03-Dec-2023 00:02                8940
function.phpcredits.php                            03-Dec-2023 00:02                7799
function.phpdbg-break-file.php                     03-Dec-2023 00:02                3838
function.phpdbg-break-function.php                 03-Dec-2023 00:02                3596
function.phpdbg-break-method.php                   03-Dec-2023 00:02                3879
function.phpdbg-break-next.php                     03-Dec-2023 00:02                3308
function.phpdbg-clear.php                          03-Dec-2023 00:02                3579
function.phpdbg-color.php                          03-Dec-2023 00:02                3537
function.phpdbg-end-oplog.php                      03-Dec-2023 00:02                2443
function.phpdbg-exec.php                           03-Dec-2023 00:02                2815
function.phpdbg-get-executable.php                 03-Dec-2023 00:02                2442
function.phpdbg-prompt.php                         03-Dec-2023 00:02                2767
function.phpdbg-start-oplog.php                    03-Dec-2023 00:02                2246
function.phpinfo.php                               03-Dec-2023 00:02                9257
function.phpversion.php                            03-Dec-2023 00:02               10396
function.pi.php                                    03-Dec-2023 00:02                2941
function.png2wbmp.php                              03-Dec-2023 00:02                6212
function.popen.php                                 03-Dec-2023 00:02                8356
function.pos.php                                   03-Dec-2023 00:02                1613
function.posix-access.php                          03-Dec-2023 00:02                6030
function.posix-ctermid.php                         03-Dec-2023 00:02                4242
function.posix-eaccess.php                         03-Dec-2023 00:02                6823
function.posix-errno.php                           03-Dec-2023 00:02                1764
function.posix-fpathconf.php                       03-Dec-2023 00:02                5868
function.posix-get-last-error.php                  03-Dec-2023 00:02                4120
function.posix-getcwd.php                          03-Dec-2023 00:02                4092
function.posix-getegid.php                         03-Dec-2023 00:02                5156
function.posix-geteuid.php                         03-Dec-2023 00:02                5162
function.posix-getgid.php                          03-Dec-2023 00:02                4602
function.posix-getgrgid.php                        03-Dec-2023 00:02                6241
function.posix-getgrnam.php                        03-Dec-2023 00:02                6133
function.posix-getgroups.php                       03-Dec-2023 00:02                4013
function.posix-getlogin.php                        03-Dec-2023 00:02                3456
function.posix-getpgid.php                         03-Dec-2023 00:02                4420
function.posix-getpgrp.php                         03-Dec-2023 00:02                2478
function.posix-getpid.php                          03-Dec-2023 00:02                3248
function.posix-getppid.php                         03-Dec-2023 00:02                2872
function.posix-getpwnam.php                        03-Dec-2023 00:02                6560
function.posix-getpwuid.php                        03-Dec-2023 00:02                6561
function.posix-getrlimit.php                       03-Dec-2023 00:02                8052
function.posix-getsid.php                          03-Dec-2023 00:02                4506
function.posix-getuid.php                          03-Dec-2023 00:02                3284
function.posix-initgroups.php                      03-Dec-2023 00:02                3042
function.posix-isatty.php                          03-Dec-2023 00:02                4029
function.posix-kill.php                            03-Dec-2023 00:02                3225
function.posix-mkfifo.php                          03-Dec-2023 00:02                3274
function.posix-mknod.php                           03-Dec-2023 00:02                6781
function.posix-pathconf.php                        03-Dec-2023 00:02                5455
function.posix-setegid.php                         03-Dec-2023 00:02                4948
function.posix-seteuid.php                         03-Dec-2023 00:02                3358
function.posix-setgid.php                          03-Dec-2023 00:02                5145
function.posix-setpgid.php                         03-Dec-2023 00:02                3146
function.posix-setrlimit.php                       03-Dec-2023 00:02                4210
function.posix-setsid.php                          03-Dec-2023 00:02                2462
function.posix-setuid.php                          03-Dec-2023 00:02                5323
function.posix-strerror.php                        03-Dec-2023 00:02                4681
function.posix-sysconf.php                         03-Dec-2023 00:02                3594
function.posix-times.php                           03-Dec-2023 00:02                4495
function.posix-ttyname.php                         03-Dec-2023 00:02                4648
function.posix-uname.php                           03-Dec-2023 00:02                4658
function.pow.php                                   03-Dec-2023 00:02                6638
function.preg-filter.php                           03-Dec-2023 00:02                9268
function.preg-grep.php                             03-Dec-2023 00:02                5718
function.preg-last-error-msg.php                   03-Dec-2023 00:02                3986
function.preg-last-error.php                       03-Dec-2023 00:02                4033
function.preg-match-all.php                        03-Dec-2023 00:02               24308
function.preg-match.php                            03-Dec-2023 00:02               22613
function.preg-quote.php                            03-Dec-2023 00:02                8314
function.preg-replace-callback-array.php           03-Dec-2023 00:02                9837
function.preg-replace-callback.php                 03-Dec-2023 00:02               15420
function.preg-replace.php                          03-Dec-2023 00:02               20882
function.preg-split.php                            03-Dec-2023 00:02               12157
function.prev.php                                  03-Dec-2023 00:02                8861
function.print-r.php                               03-Dec-2023 00:02                8825
function.print.php                                 03-Dec-2023 00:02               12806
function.printf.php                                03-Dec-2023 00:02               27758
function.proc-close.php                            03-Dec-2023 00:02                3512
function.proc-get-status.php                       03-Dec-2023 00:02                6020
function.proc-nice.php                             03-Dec-2023 00:02                4276
function.proc-open.php                             03-Dec-2023 00:02               21112
function.proc-terminate.php                        03-Dec-2023 00:02                4590
function.property-exists.php                       03-Dec-2023 00:02                8248
function.ps-add-bookmark.php                       03-Dec-2023 00:02                4878
function.ps-add-launchlink.php                     03-Dec-2023 00:02                5367
function.ps-add-locallink.php                      03-Dec-2023 00:02                6097
function.ps-add-note.php                           03-Dec-2023 00:02                6726
function.ps-add-pdflink.php                        03-Dec-2023 00:02                6414
function.ps-add-weblink.php                        03-Dec-2023 00:02                5453
function.ps-arc.php                                03-Dec-2023 00:02                4843
function.ps-arcn.php                               03-Dec-2023 00:02                4849
function.ps-begin-page.php                         03-Dec-2023 00:02                6696
function.ps-begin-pattern.php                      03-Dec-2023 00:02               12988
function.ps-begin-template.php                     03-Dec-2023 00:02               11085
function.ps-circle.php                             03-Dec-2023 00:02                4485
function.ps-clip.php                               03-Dec-2023 00:02                2911
function.ps-close-image.php                        03-Dec-2023 00:02                3769
function.ps-close.php                              03-Dec-2023 00:02                3564
function.ps-closepath-stroke.php                   03-Dec-2023 00:02                2984
function.ps-closepath.php                          03-Dec-2023 00:02                3160
function.ps-continue-text.php                      03-Dec-2023 00:02                3931
function.ps-curveto.php                            03-Dec-2023 00:02                4664
function.ps-delete.php                             03-Dec-2023 00:02                3428
function.ps-end-page.php                           03-Dec-2023 00:02                3154
function.ps-end-pattern.php                        03-Dec-2023 00:02                3085
function.ps-end-template.php                       03-Dec-2023 00:02                3092
function.ps-fill-stroke.php                        03-Dec-2023 00:02                3205
function.ps-fill.php                               03-Dec-2023 00:02                3138
function.ps-findfont.php                           03-Dec-2023 00:02                6849
function.ps-get-buffer.php                         03-Dec-2023 00:02                3144
function.ps-get-parameter.php                      03-Dec-2023 00:02                7574
function.ps-get-value.php                          03-Dec-2023 00:02                9330
function.ps-hyphenate.php                          03-Dec-2023 00:02                7020
function.ps-include-file.php                       03-Dec-2023 00:02                2922
function.ps-lineto.php                             03-Dec-2023 00:02                8000
function.ps-makespotcolor.php                      03-Dec-2023 00:02               10008
function.ps-moveto.php                             03-Dec-2023 00:02                3614
function.ps-new.php                                03-Dec-2023 00:02                2922
function.ps-open-file.php                          03-Dec-2023 00:02                3507
function.ps-open-image-file.php                    03-Dec-2023 00:02                4687
function.ps-open-image.php                         03-Dec-2023 00:02                6502
function.ps-open-memory-image.php                  03-Dec-2023 00:02                2705
function.ps-place-image.php                        03-Dec-2023 00:02                4922
function.ps-rect.php                               03-Dec-2023 00:02                4657
function.ps-restore.php                            03-Dec-2023 00:02                3267
function.ps-rotate.php                             03-Dec-2023 00:02               11940
function.ps-save.php                               03-Dec-2023 00:02                3014
function.ps-scale.php                              03-Dec-2023 00:02                3538
function.ps-set-border-color.php                   03-Dec-2023 00:02                4602
function.ps-set-border-dash.php                    03-Dec-2023 00:02                4244
function.ps-set-border-style.php                   03-Dec-2023 00:02                4306
function.ps-set-info.php                           03-Dec-2023 00:02                5776
function.ps-set-parameter.php                      03-Dec-2023 00:02                3714
function.ps-set-text-pos.php                       03-Dec-2023 00:02                9092
function.ps-set-value.php                          03-Dec-2023 00:02                4549
function.ps-setcolor.php                           03-Dec-2023 00:02                5481
function.ps-setdash.php                            03-Dec-2023 00:02                3410
function.ps-setflat.php                            03-Dec-2023 00:02                2911
function.ps-setfont.php                            03-Dec-2023 00:02                3843
function.ps-setgray.php                            03-Dec-2023 00:02                3137
function.ps-setlinecap.php                         03-Dec-2023 00:02                3693
function.ps-setlinejoin.php                        03-Dec-2023 00:02                3711
function.ps-setlinewidth.php                       03-Dec-2023 00:02                3575
function.ps-setmiterlimit.php                      03-Dec-2023 00:02                3995
function.ps-setoverprintmode.php                   03-Dec-2023 00:02                2948
function.ps-setpolydash.php                        03-Dec-2023 00:02                7550
function.ps-shading-pattern.php                    03-Dec-2023 00:02                4050
function.ps-shading.php                            03-Dec-2023 00:02                6527
function.ps-shfill.php                             03-Dec-2023 00:02                3801
function.ps-show-boxed.php                         03-Dec-2023 00:02               12142
function.ps-show-xy.php                            03-Dec-2023 00:02                3970
function.ps-show-xy2.php                           03-Dec-2023 00:02                2735
function.ps-show.php                               03-Dec-2023 00:02                5623
function.ps-show2.php                              03-Dec-2023 00:02                3059
function.ps-string-geometry.php                    03-Dec-2023 00:02                4677
function.ps-stringwidth.php                        03-Dec-2023 00:02                4139
function.ps-stroke.php                             03-Dec-2023 00:02                3350
function.ps-symbol-name.php                        03-Dec-2023 00:02                3736
function.ps-symbol-width.php                       03-Dec-2023 00:02                4228
function.ps-symbol.php                             03-Dec-2023 00:02                3547
function.ps-translate.php                          03-Dec-2023 00:02               13905
function.pspell-add-to-personal.php                03-Dec-2023 00:02                6253
function.pspell-add-to-session.php                 03-Dec-2023 00:02                3895
function.pspell-check.php                          03-Dec-2023 00:02                4812
function.pspell-clear-session.php                  03-Dec-2023 00:02                5709
function.pspell-config-create.php                  03-Dec-2023 00:02                7798
function.pspell-config-data-dir.php                03-Dec-2023 00:02                3189
function.pspell-config-dict-dir.php                03-Dec-2023 00:02                3188
function.pspell-config-ignore.php                  03-Dec-2023 00:02                5539
function.pspell-config-mode.php                    03-Dec-2023 00:02                6205
function.pspell-config-personal.php                03-Dec-2023 00:02                6324
function.pspell-config-repl.php                    03-Dec-2023 00:02                6627
function.pspell-config-runtogether.php             03-Dec-2023 00:02                6088
function.pspell-config-save-repl.php               03-Dec-2023 00:02                5026
function.pspell-new-config.php                     03-Dec-2023 00:02                6301
function.pspell-new-personal.php                   03-Dec-2023 00:02               10129
function.pspell-new.php                            03-Dec-2023 00:02                8718
function.pspell-save-wordlist.php                  03-Dec-2023 00:02                5902
function.pspell-store-replacement.php              03-Dec-2023 00:02                7465
function.pspell-suggest.php                        03-Dec-2023 00:02                5426
function.putenv.php                                03-Dec-2023 00:02                5063
function.quoted-printable-decode.php               03-Dec-2023 00:02                5047
function.quoted-printable-encode.php               03-Dec-2023 00:02                4987
function.quotemeta.php                             03-Dec-2023 00:02                5636
function.rad2deg.php                               03-Dec-2023 00:02                3495
function.radius-acct-open.php                      03-Dec-2023 00:02                3121
function.radius-add-server.php                     03-Dec-2023 00:02                7303
function.radius-auth-open.php                      03-Dec-2023 00:02                3118
function.radius-close.php                          03-Dec-2023 00:02                2446
function.radius-config.php                         03-Dec-2023 00:02                3824
function.radius-create-request.php                 03-Dec-2023 00:02                4922
function.radius-cvt-addr.php                       03-Dec-2023 00:02                6113
function.radius-cvt-int.php                        03-Dec-2023 00:02                5515
function.radius-cvt-string.php                     03-Dec-2023 00:02                5567
function.radius-demangle-mppe-key.php              03-Dec-2023 00:02                3002
function.radius-demangle.php                       03-Dec-2023 00:02                2733
function.radius-get-attr.php                       03-Dec-2023 00:02                6492
function.radius-get-tagged-attr-data.php           03-Dec-2023 00:02                6382
function.radius-get-tagged-attr-tag.php            03-Dec-2023 00:02                6437
function.radius-get-vendor-attr.php                03-Dec-2023 00:02                7980
function.radius-put-addr.php                       03-Dec-2023 00:02                5008
function.radius-put-attr.php                       03-Dec-2023 00:02                8289
function.radius-put-int.php                        03-Dec-2023 00:02                7028
function.radius-put-string.php                     03-Dec-2023 00:02                7406
function.radius-put-vendor-addr.php                03-Dec-2023 00:02                5024
function.radius-put-vendor-attr.php                03-Dec-2023 00:02                7189
function.radius-put-vendor-int.php                 03-Dec-2023 00:02                5703
function.radius-put-vendor-string.php              03-Dec-2023 00:02                6094
function.radius-request-authenticator.php          03-Dec-2023 00:02                3001
function.radius-salt-encrypt-attr.php              03-Dec-2023 00:02                3984
function.radius-send-request.php                   03-Dec-2023 00:02                3621
function.radius-server-secret.php                  03-Dec-2023 00:02                2517
function.radius-strerror.php                       03-Dec-2023 00:02                2486
function.rand.php                                  03-Dec-2023 00:02               10040
function.random-bytes.php                          03-Dec-2023 00:02                9591
function.random-int.php                            03-Dec-2023 00:02                9368
function.range.php                                 03-Dec-2023 00:02               14983
function.rar-wrapper-cache-stats.php               03-Dec-2023 00:02                2292
function.rawurldecode.php                          03-Dec-2023 00:02                4459
function.rawurlencode.php                          03-Dec-2023 00:02                6150
function.read-exif-data.php                        03-Dec-2023 00:02                1730
function.readdir.php                               03-Dec-2023 00:02               10030
function.readfile.php                              03-Dec-2023 00:02                9658
function.readgzfile.php                            03-Dec-2023 00:02                4272
function.readline-add-history.php                  03-Dec-2023 00:02                2607
function.readline-callback-handler-install.php     03-Dec-2023 00:02                9285
function.readline-callback-handler-remove.php      03-Dec-2023 00:02                3756
function.readline-callback-read-char.php           03-Dec-2023 00:02                3813
function.readline-clear-history.php                03-Dec-2023 00:02                2157
function.readline-completion-function.php          03-Dec-2023 00:02                2914
function.readline-info.php                         03-Dec-2023 00:02                3282
function.readline-list-history.php                 03-Dec-2023 00:02                2099
function.readline-on-new-line.php                  03-Dec-2023 00:02                2640
function.readline-read-history.php                 03-Dec-2023 00:02                2632
function.readline-redisplay.php                    03-Dec-2023 00:02                2217
function.readline-write-history.php                03-Dec-2023 00:02                2585
function.readline.php                              03-Dec-2023 00:02                4647
function.readlink.php                              03-Dec-2023 00:02                4446
function.realpath-cache-get.php                    03-Dec-2023 00:02                4211
function.realpath-cache-size.php                   03-Dec-2023 00:02                3714
function.realpath.php                              03-Dec-2023 00:02                8477
function.recode-file.php                           03-Dec-2023 00:02                5411
function.recode-string.php                         03-Dec-2023 00:02                4908
function.recode.php                                03-Dec-2023 00:02                1723
function.register-shutdown-function.php            03-Dec-2023 00:02                7653
function.register-tick-function.php                03-Dec-2023 00:02                5392
function.rename.php                                03-Dec-2023 00:02                5552
function.require-once.php                          03-Dec-2023 00:02                1789
function.require.php                               03-Dec-2023 00:02                1869
function.reset.php                                 03-Dec-2023 00:02                9354
function.restore-error-handler.php                 03-Dec-2023 00:02                6114
function.restore-exception-handler.php             03-Dec-2023 00:02                6526
function.restore-include-path.php                  03-Dec-2023 00:02                4844
function.return.php                                03-Dec-2023 00:02                4247
function.rewind.php                                03-Dec-2023 00:02                6266
function.rewinddir.php                             03-Dec-2023 00:02                3421
function.rmdir.php                                 03-Dec-2023 00:02                4824
function.rnp-backend-string.php                    03-Dec-2023 00:02                2185
function.rnp-backend-version.php                   03-Dec-2023 00:02                2106
function.rnp-decrypt.php                           03-Dec-2023 00:02                3017
function.rnp-dump-packets-to-json.php              03-Dec-2023 00:02                2873
function.rnp-dump-packets.php                      03-Dec-2023 00:02                2827
function.rnp-ffi-create.php                        03-Dec-2023 00:02                2980
function.rnp-ffi-destroy.php                       03-Dec-2023 00:02                2390
function.rnp-ffi-set-pass-provider.php             03-Dec-2023 00:02                6248
function.rnp-import-keys.php                       03-Dec-2023 00:02                3215
function.rnp-import-signatures.php                 03-Dec-2023 00:02                3205
function.rnp-key-export-autocrypt.php              03-Dec-2023 00:02                4091
function.rnp-key-export-revocation.php             03-Dec-2023 00:02                4798
function.rnp-key-export.php                        03-Dec-2023 00:02                3122
function.rnp-key-get-info.php                      03-Dec-2023 00:02                7147
function.rnp-key-remove.php                        03-Dec-2023 00:02                3237
function.rnp-key-revoke.php                        03-Dec-2023 00:02                4484
function.rnp-list-keys.php                         03-Dec-2023 00:02                2924
function.rnp-load-keys-from-path.php               03-Dec-2023 00:02                3497
function.rnp-load-keys.php                         03-Dec-2023 00:02                3453
function.rnp-locate-key.php                        03-Dec-2023 00:02                3286
function.rnp-op-encrypt.php                        03-Dec-2023 00:02                7550
function.rnp-op-generate-key.php                   03-Dec-2023 00:02                7162
function.rnp-op-sign-cleartext.php                 03-Dec-2023 00:02                4870
function.rnp-op-sign-detached.php                  03-Dec-2023 00:02                4749
function.rnp-op-sign.php                           03-Dec-2023 00:02                5830
function.rnp-op-verify-detached.php                03-Dec-2023 00:02                6762
function.rnp-op-verify.php                         03-Dec-2023 00:02                6557
function.rnp-save-keys-to-path.php                 03-Dec-2023 00:02                3511
function.rnp-save-keys.php                         03-Dec-2023 00:02                3484
function.rnp-supported-features.php                03-Dec-2023 00:02                2695
function.rnp-version-string-full.php               03-Dec-2023 00:02                2191
function.rnp-version-string.php                    03-Dec-2023 00:02                2088
function.round.php                                 03-Dec-2023 00:02               23544
function.rpmaddtag.php                             03-Dec-2023 00:02                3144
function.rpmdbinfo.php                             03-Dec-2023 00:02                4731
function.rpmdbsearch.php                           03-Dec-2023 00:02                5523
function.rpmgetsymlink.php                         03-Dec-2023 00:02                2650
function.rpminfo.php                               03-Dec-2023 00:02                4915
function.rpmvercmp.php                             03-Dec-2023 00:02                4394
function.rrd-create.php                            03-Dec-2023 00:02                2664
function.rrd-error.php                             03-Dec-2023 00:02                2018
function.rrd-fetch.php                             03-Dec-2023 00:02                2748
function.rrd-first.php                             03-Dec-2023 00:02                2673
function.rrd-graph.php                             03-Dec-2023 00:02                2925
function.rrd-info.php                              03-Dec-2023 00:02                2312
function.rrd-last.php                              03-Dec-2023 00:02                2315
function.rrd-lastupdate.php                        03-Dec-2023 00:02                2442
function.rrd-restore.php                           03-Dec-2023 00:02                2982
function.rrd-tune.php                              03-Dec-2023 00:02                2720
function.rrd-update.php                            03-Dec-2023 00:02                2793
function.rrd-version.php                           03-Dec-2023 00:02                2112
function.rrd-xport.php                             03-Dec-2023 00:02                2488
function.rrdc-disconnect.php                       03-Dec-2023 00:02                2502
function.rsort.php                                 03-Dec-2023 00:02                8566
function.rtrim.php                                 03-Dec-2023 00:02                9513
function.runkit7-constant-add.php                  03-Dec-2023 00:02                4230
function.runkit7-constant-redefine.php             03-Dec-2023 00:02                4094
function.runkit7-constant-remove.php               03-Dec-2023 00:02                3434
function.runkit7-function-add.php                  03-Dec-2023 00:02                8762
function.runkit7-function-copy.php                 03-Dec-2023 00:02                5226
function.runkit7-function-redefine.php             03-Dec-2023 00:02                9175
function.runkit7-function-remove.php               03-Dec-2023 00:02                3924
function.runkit7-function-rename.php               03-Dec-2023 00:02                4145
function.runkit7-import.php                        03-Dec-2023 00:02                3529
function.runkit7-method-add.php                    03-Dec-2023 00:02               10393
function.runkit7-method-copy.php                   03-Dec-2023 00:02                6791
function.runkit7-method-redefine.php               03-Dec-2023 00:02               10829
function.runkit7-method-remove.php                 03-Dec-2023 00:02                6185
function.runkit7-method-rename.php                 03-Dec-2023 00:02                6291
function.runkit7-object-id.php                     03-Dec-2023 00:02                3624
function.runkit7-superglobals.php                  03-Dec-2023 00:02                2564
function.runkit7-zval-inspect.php                  03-Dec-2023 00:02                5022
function.sapi-windows-cp-conv.php                  03-Dec-2023 00:02                4294
function.sapi-windows-cp-get.php                   03-Dec-2023 00:02                3329
function.sapi-windows-cp-is-utf8.php               03-Dec-2023 00:02                2667
function.sapi-windows-cp-set.php                   03-Dec-2023 00:02                2842
function.sapi-windows-generate-ctrl-event.php      03-Dec-2023 00:02                7356
function.sapi-windows-set-ctrl-handler.php         03-Dec-2023 00:02                6894
function.sapi-windows-vt100-support.php            03-Dec-2023 00:02                9687
function.scandir.php                               03-Dec-2023 00:02                8359
function.scoutapm-get-calls.php                    03-Dec-2023 00:02                4352
function.scoutapm-list-instrumented-functions.php  03-Dec-2023 00:02                3677
function.seaslog-get-author.php                    03-Dec-2023 00:02                3007
function.seaslog-get-version.php                   03-Dec-2023 00:02                2993
function.sem-acquire.php                           03-Dec-2023 00:02                4855
function.sem-get.php                               03-Dec-2023 00:02                6619
function.sem-release.php                           03-Dec-2023 00:02                4079
function.sem-remove.php                            03-Dec-2023 00:02                4060
function.serialize.php                             03-Dec-2023 00:02               10824
function.session-abort.php                         03-Dec-2023 00:02                3263
function.session-cache-expire.php                  03-Dec-2023 00:02                6581
function.session-cache-limiter.php                 03-Dec-2023 00:02                8084
function.session-commit.php                        03-Dec-2023 00:02                1823
function.session-create-id.php                     03-Dec-2023 00:02                9749
function.session-decode.php                        03-Dec-2023 00:02                3668
function.session-destroy.php                       03-Dec-2023 00:02                9312
function.session-encode.php                        03-Dec-2023 00:02                3494
function.session-gc.php                            03-Dec-2023 00:02                7546
function.session-get-cookie-params.php             03-Dec-2023 00:02                4925
function.session-id.php                            03-Dec-2023 00:02                5182
function.session-module-name.php                   03-Dec-2023 00:02                2634
function.session-name.php                          03-Dec-2023 00:02                5487
function.session-regenerate-id.php                 03-Dec-2023 00:02               16140
function.session-register-shutdown.php             03-Dec-2023 00:02                2671
function.session-reset.php                         03-Dec-2023 00:02                3353
function.session-save-path.php                     03-Dec-2023 00:02                3761
function.session-set-cookie-params.php             03-Dec-2023 00:02                7081
function.session-set-save-handler.php              03-Dec-2023 00:02               29290
function.session-start.php                         03-Dec-2023 00:02               14339
function.session-status.php                        03-Dec-2023 00:02                2912
function.session-unset.php                         03-Dec-2023 00:02                3205
function.session-write-close.php                   03-Dec-2023 00:02                3117
function.set-error-handler.php                     03-Dec-2023 00:02               24942
function.set-exception-handler.php                 03-Dec-2023 00:02                6783
function.set-file-buffer.php                       03-Dec-2023 00:02                1789
function.set-include-path.php                      03-Dec-2023 00:02                6122
function.set-time-limit.php                        03-Dec-2023 00:02                4476
function.setcookie.php                             03-Dec-2023 00:02               25477
function.setlocale.php                             03-Dec-2023 00:02               14195
function.setrawcookie.php                          03-Dec-2023 00:02                5414
function.settype.php                               03-Dec-2023 00:02                6220
function.sha1-file.php                             03-Dec-2023 00:02                5412
function.sha1.php                                  03-Dec-2023 00:02                5678
function.shell-exec.php                            03-Dec-2023 00:02                3892
function.shm-attach.php                            03-Dec-2023 00:02                5625
function.shm-detach.php                            03-Dec-2023 00:02                4321
function.shm-get-var.php                           03-Dec-2023 00:02                4283
function.shm-has-var.php                           03-Dec-2023 00:02                4103
function.shm-put-var.php                           03-Dec-2023 00:02                5145
function.shm-remove-var.php                        03-Dec-2023 00:02                3980
function.shm-remove.php                            03-Dec-2023 00:02                3761
function.shmop-close.php                           03-Dec-2023 00:02                3765
function.shmop-delete.php                          03-Dec-2023 00:02                3445
function.shmop-open.php                            03-Dec-2023 00:02                9010
function.shmop-read.php                            03-Dec-2023 00:02                6289
function.shmop-size.php                            03-Dec-2023 00:02                3570
function.shmop-write.php                           03-Dec-2023 00:02                5870
function.show-source.php                           03-Dec-2023 00:02                1731
function.shuffle.php                               03-Dec-2023 00:02                7069
function.simdjson-decode.php                       03-Dec-2023 00:02               16249
function.simdjson-is-valid.php                     03-Dec-2023 00:02                9965
function.simdjson-key-count.php                    03-Dec-2023 00:02                4270
function.simdjson-key-exists.php                   03-Dec-2023 00:02                4130
function.simdjson-key-value.php                    03-Dec-2023 00:02                6572
function.similar-text.php                          03-Dec-2023 00:02                7090
function.simplexml-import-dom.php                  03-Dec-2023 00:02                6566
function.simplexml-load-file.php                   03-Dec-2023 00:02                9733
function.simplexml-load-string.php                 03-Dec-2023 00:02                9102
function.sin.php                                   03-Dec-2023 00:02                4515
function.sinh.php                                  03-Dec-2023 00:02                3142
function.sizeof.php                                03-Dec-2023 00:02                1632
function.sleep.php                                 03-Dec-2023 00:02                6910
function.snmp-get-quick-print.php                  03-Dec-2023 00:02                3534
function.snmp-get-valueretrieval.php               03-Dec-2023 00:02                4278
function.snmp-read-mib.php                         03-Dec-2023 00:02                4613
function.snmp-set-enum-print.php                   03-Dec-2023 00:02                5075
function.snmp-set-oid-numeric-print.php            03-Dec-2023 00:02                2323
function.snmp-set-oid-output-format.php            03-Dec-2023 00:02                7116
function.snmp-set-quick-print.php                  03-Dec-2023 00:02                6933
function.snmp-set-valueretrieval.php               03-Dec-2023 00:02                9044
function.snmp2-get.php                             03-Dec-2023 00:02                5439
function.snmp2-getnext.php                         03-Dec-2023 00:02                5822
function.snmp2-real-walk.php                       03-Dec-2023 00:02                6098
function.snmp2-set.php                             03-Dec-2023 00:02               10348
function.snmp2-walk.php                            03-Dec-2023 00:02                6555
function.snmp3-get.php                             03-Dec-2023 00:02                8255
function.snmp3-getnext.php                         03-Dec-2023 00:02                8598
function.snmp3-real-walk.php                       03-Dec-2023 00:02                9116
function.snmp3-set.php                             03-Dec-2023 00:02               12828
function.snmp3-walk.php                            03-Dec-2023 00:02                9531
function.snmpget.php                               03-Dec-2023 00:02                5433
function.snmpgetnext.php                           03-Dec-2023 00:02                5697
function.snmprealwalk.php                          03-Dec-2023 00:02                5973
function.snmpset.php                               03-Dec-2023 00:02               10379
function.snmpwalk.php                              03-Dec-2023 00:02                6576
function.snmpwalkoid.php                           03-Dec-2023 00:02                7236
function.socket-accept.php                         03-Dec-2023 00:02                5591
function.socket-addrinfo-bind.php                  03-Dec-2023 00:02                5297
function.socket-addrinfo-connect.php               03-Dec-2023 00:02                5090
function.socket-addrinfo-explain.php               03-Dec-2023 00:02                4414
function.socket-addrinfo-lookup.php                03-Dec-2023 00:02                5647
function.socket-atmark.php                         03-Dec-2023 00:02                4839
function.socket-bind.php                           03-Dec-2023 00:02               10602
function.socket-clear-error.php                    03-Dec-2023 00:02                3558
function.socket-close.php                          03-Dec-2023 00:02                4574
function.socket-cmsg-space.php                     03-Dec-2023 00:02                3494
function.socket-connect.php                        03-Dec-2023 00:02                7113
function.socket-create-listen.php                  03-Dec-2023 00:02                6903
function.socket-create-pair.php                    03-Dec-2023 00:02               19313
function.socket-create.php                         03-Dec-2023 00:02               11678
function.socket-export-stream.php                  03-Dec-2023 00:02                3338
function.socket-get-option.php                     03-Dec-2023 00:02               26947
function.socket-get-status.php                     03-Dec-2023 00:02                1810
function.socket-getopt.php                         03-Dec-2023 00:02                1793
function.socket-getpeername.php                    03-Dec-2023 00:02                7629
function.socket-getsockname.php                    03-Dec-2023 00:02                6948
function.socket-import-stream.php                  03-Dec-2023 00:02                4958
function.socket-last-error.php                     03-Dec-2023 00:02                7058
function.socket-listen.php                         03-Dec-2023 00:02                7058
function.socket-read.php                           03-Dec-2023 00:02                7648
function.socket-recv.php                           03-Dec-2023 00:02                2395
function.socket-recvfrom.php                       03-Dec-2023 00:02               12750
function.socket-recvmsg.php                        03-Dec-2023 00:02                4224
function.socket-select.php                         03-Dec-2023 00:02               14927
function.socket-send.php                           03-Dec-2023 00:02                6334
function.socket-sendmsg.php                        03-Dec-2023 00:02                4300
function.socket-sendto.php                         03-Dec-2023 00:02                9395
function.socket-set-block.php                      03-Dec-2023 00:02                5941
function.socket-set-blocking.php                   03-Dec-2023 00:02                1830
function.socket-set-nonblock.php                   03-Dec-2023 00:02                6334
function.socket-set-option.php                     03-Dec-2023 00:02               11035
function.socket-set-timeout.php                    03-Dec-2023 00:02                1798
function.socket-setopt.php                         03-Dec-2023 00:02                1787
function.socket-shutdown.php                       03-Dec-2023 00:02                4742
function.socket-strerror.php                       03-Dec-2023 00:02                7040
function.socket-write.php                          03-Dec-2023 00:02                7038
function.socket-wsaprotocol-info-export.php        03-Dec-2023 00:02                4863
function.socket-wsaprotocol-info-import.php        03-Dec-2023 00:02                4251
function.socket-wsaprotocol-info-release.php       03-Dec-2023 00:02                3421
function.sodium-add.php                            03-Dec-2023 00:02                3039
function.sodium-base642bin.php                     03-Dec-2023 00:02                4217
function.sodium-bin2base64.php                     03-Dec-2023 00:02                3863
function.sodium-bin2hex.php                        03-Dec-2023 00:02                2554
function.sodium-compare.php                        03-Dec-2023 00:02                3027
function.sodium-crypto-aead-aes256gcm-decrypt.php  03-Dec-2023 00:02                4255
function.sodium-crypto-aead-aes256gcm-encrypt.php  03-Dec-2023 00:02                4042
function.sodium-crypto-aead-aes256gcm-is-availa..> 03-Dec-2023 00:02                2652
function.sodium-crypto-aead-aes256gcm-keygen.php   03-Dec-2023 00:02                2744
function.sodium-crypto-aead-chacha20poly1305-de..> 03-Dec-2023 00:02                4171
function.sodium-crypto-aead-chacha20poly1305-en..> 03-Dec-2023 00:02                3916
function.sodium-crypto-aead-chacha20poly1305-ie..> 03-Dec-2023 00:02                4401
function.sodium-crypto-aead-chacha20poly1305-ie..> 03-Dec-2023 00:02                4082
function.sodium-crypto-aead-chacha20poly1305-ie..> 03-Dec-2023 00:02                2938
function.sodium-crypto-aead-chacha20poly1305-ke..> 03-Dec-2023 00:02                2873
function.sodium-crypto-aead-xchacha20poly1305-i..> 03-Dec-2023 00:02                4579
function.sodium-crypto-aead-xchacha20poly1305-i..> 03-Dec-2023 00:02                4300
function.sodium-crypto-aead-xchacha20poly1305-i..> 03-Dec-2023 00:02                2914
function.sodium-crypto-auth-keygen.php             03-Dec-2023 00:02                2565
function.sodium-crypto-auth-verify.php             03-Dec-2023 00:02                3530
function.sodium-crypto-auth.php                    03-Dec-2023 00:02                3154
function.sodium-crypto-box-keypair-from-secretk..> 03-Dec-2023 00:02                3233
function.sodium-crypto-box-keypair.php             03-Dec-2023 00:02                2846
function.sodium-crypto-box-open.php                03-Dec-2023 00:02                3662
function.sodium-crypto-box-publickey-from-secre..> 03-Dec-2023 00:02                3120
function.sodium-crypto-box-publickey.php           03-Dec-2023 00:02                2833
function.sodium-crypto-box-seal-open.php           03-Dec-2023 00:02                5733
function.sodium-crypto-box-seal.php                03-Dec-2023 00:02                6943
function.sodium-crypto-box-secretkey.php           03-Dec-2023 00:02                2800
function.sodium-crypto-box-seed-keypair.php        03-Dec-2023 00:02                2859
function.sodium-crypto-box.php                     03-Dec-2023 00:02                3967
function.sodium-crypto-core-ristretto255-add.php   03-Dec-2023 00:02                5874
function.sodium-crypto-core-ristretto255-from-h..> 03-Dec-2023 00:02                5305
function.sodium-crypto-core-ristretto255-is-val..> 03-Dec-2023 00:02                5414
function.sodium-crypto-core-ristretto255-random..> 03-Dec-2023 00:02                5496
function.sodium-crypto-core-ristretto255-scalar..> 03-Dec-2023 00:02                6142
function.sodium-crypto-core-ristretto255-scalar..> 03-Dec-2023 00:02                3453
function.sodium-crypto-core-ristretto255-scalar..> 03-Dec-2023 00:02                5275
function.sodium-crypto-core-ristretto255-scalar..> 03-Dec-2023 00:02                3656
function.sodium-crypto-core-ristretto255-scalar..> 03-Dec-2023 00:02                5259
function.sodium-crypto-core-ristretto255-scalar..> 03-Dec-2023 00:02                5656
function.sodium-crypto-core-ristretto255-scalar..> 03-Dec-2023 00:02                3397
function.sodium-crypto-core-ristretto255-scalar..> 03-Dec-2023 00:02                6133
function.sodium-crypto-core-ristretto255-sub.php   03-Dec-2023 00:02                5911
function.sodium-crypto-generichash-final.php       03-Dec-2023 00:02                6582
function.sodium-crypto-generichash-init.php        03-Dec-2023 00:02                6532
function.sodium-crypto-generichash-keygen.php      03-Dec-2023 00:02                2375
function.sodium-crypto-generichash-update.php      03-Dec-2023 00:02                6319
function.sodium-crypto-generichash.php             03-Dec-2023 00:02                3429
function.sodium-crypto-kdf-derive-from-key.php     03-Dec-2023 00:02                3662
function.sodium-crypto-kdf-keygen.php              03-Dec-2023 00:02                2477
function.sodium-crypto-kx-client-session-keys.php  03-Dec-2023 00:02                3188
function.sodium-crypto-kx-keypair.php              03-Dec-2023 00:02                4892
function.sodium-crypto-kx-publickey.php            03-Dec-2023 00:02                2652
function.sodium-crypto-kx-secretkey.php            03-Dec-2023 00:02                2663
function.sodium-crypto-kx-seed-keypair.php         03-Dec-2023 00:02                2598
function.sodium-crypto-kx-server-session-keys.php  03-Dec-2023 00:02                3254
function.sodium-crypto-pwhash-scryptsalsa208sha..> 03-Dec-2023 00:02                3148
function.sodium-crypto-pwhash-scryptsalsa208sha..> 03-Dec-2023 00:02                3298
function.sodium-crypto-pwhash-scryptsalsa208sha..> 03-Dec-2023 00:02                5570
function.sodium-crypto-pwhash-str-needs-rehash.php 03-Dec-2023 00:02                3672
function.sodium-crypto-pwhash-str-verify.php       03-Dec-2023 00:02                4524
function.sodium-crypto-pwhash-str.php              03-Dec-2023 00:02                7851
function.sodium-crypto-pwhash.php                  03-Dec-2023 00:02                9005
function.sodium-crypto-scalarmult-base.php         03-Dec-2023 00:02                2035
function.sodium-crypto-scalarmult-ristretto255-..> 03-Dec-2023 00:02                3366
function.sodium-crypto-scalarmult-ristretto255.php 03-Dec-2023 00:02                3659
function.sodium-crypto-scalarmult.php              03-Dec-2023 00:02                2875
function.sodium-crypto-secretbox-keygen.php        03-Dec-2023 00:02                6161
function.sodium-crypto-secretbox-open.php          03-Dec-2023 00:02                8303
function.sodium-crypto-secretbox.php               03-Dec-2023 00:02                8290
function.sodium-crypto-secretstream-xchacha20po..> 03-Dec-2023 00:02               10663
function.sodium-crypto-secretstream-xchacha20po..> 03-Dec-2023 00:02               10085
function.sodium-crypto-secretstream-xchacha20po..> 03-Dec-2023 00:02                2641
function.sodium-crypto-secretstream-xchacha20po..> 03-Dec-2023 00:02                5510
function.sodium-crypto-secretstream-xchacha20po..> 03-Dec-2023 00:02                5609
function.sodium-crypto-secretstream-xchacha20po..> 03-Dec-2023 00:02                2878
function.sodium-crypto-shorthash-keygen.php        03-Dec-2023 00:02                2622
function.sodium-crypto-shorthash.php               03-Dec-2023 00:02                2987
function.sodium-crypto-sign-detached.php           03-Dec-2023 00:02                2980
function.sodium-crypto-sign-ed25519-pk-to-curve..> 03-Dec-2023 00:02                2820
function.sodium-crypto-sign-ed25519-sk-to-curve..> 03-Dec-2023 00:02                2876
function.sodium-crypto-sign-keypair-from-secret..> 03-Dec-2023 00:02                3059
function.sodium-crypto-sign-keypair.php            03-Dec-2023 00:02                2363
function.sodium-crypto-sign-open.php               03-Dec-2023 00:02                3084
function.sodium-crypto-sign-publickey-from-secr..> 03-Dec-2023 00:02                2678
function.sodium-crypto-sign-publickey.php          03-Dec-2023 00:02                2688
function.sodium-crypto-sign-secretkey.php          03-Dec-2023 00:02                2664
function.sodium-crypto-sign-seed-keypair.php       03-Dec-2023 00:02                2897
function.sodium-crypto-sign-verify-detached.php    03-Dec-2023 00:02                3307
function.sodium-crypto-sign.php                    03-Dec-2023 00:02                3058
function.sodium-crypto-stream-keygen.php           03-Dec-2023 00:02                2546
function.sodium-crypto-stream-xchacha20-keygen.php 03-Dec-2023 00:02                2704
function.sodium-crypto-stream-xchacha20-xor-ic.php 03-Dec-2023 00:02                9257
function.sodium-crypto-stream-xchacha20-xor.php    03-Dec-2023 00:02                4463
function.sodium-crypto-stream-xchacha20.php        03-Dec-2023 00:02                3460
function.sodium-crypto-stream-xor.php              03-Dec-2023 00:02                3244
function.sodium-crypto-stream.php                  03-Dec-2023 00:02                3179
function.sodium-hex2bin.php                        03-Dec-2023 00:02                3106
function.sodium-increment.php                      03-Dec-2023 00:02                2418
function.sodium-memcmp.php                         03-Dec-2023 00:02                3214
function.sodium-memzero.php                        03-Dec-2023 00:02                2413
function.sodium-pad.php                            03-Dec-2023 00:02                2557
function.sodium-unpad.php                          03-Dec-2023 00:02                2512
function.solr-get-version.php                      03-Dec-2023 00:02                3785
function.sort.php                                  03-Dec-2023 00:02               11657
function.soundex.php                               03-Dec-2023 00:02                7102
function.spl-autoload-call.php                     03-Dec-2023 00:02                2584
function.spl-autoload-extensions.php               03-Dec-2023 00:02                4718
function.spl-autoload-functions.php                03-Dec-2023 00:02                3008
function.spl-autoload-register.php                 03-Dec-2023 00:02               12694
function.spl-autoload-unregister.php               03-Dec-2023 00:02                2924
function.spl-autoload.php                          03-Dec-2023 00:02                4286
function.spl-classes.php                           03-Dec-2023 00:02                3647
function.spl-object-hash.php                       03-Dec-2023 00:02                4914
function.spl-object-id.php                         03-Dec-2023 00:02                4024
function.sprintf.php                               03-Dec-2023 00:02               28319
function.sqlsrv-begin-transaction.php              03-Dec-2023 00:02               11060
function.sqlsrv-cancel.php                         03-Dec-2023 00:02               10128
function.sqlsrv-client-info.php                    03-Dec-2023 00:02                6584
function.sqlsrv-close.php                          03-Dec-2023 00:02                5383
function.sqlsrv-commit.php                         03-Dec-2023 00:02               10913
function.sqlsrv-configure.php                      03-Dec-2023 00:02                4477
function.sqlsrv-connect.php                        03-Dec-2023 00:02               11954
function.sqlsrv-errors.php                         03-Dec-2023 00:02                9926
function.sqlsrv-execute.php                        03-Dec-2023 00:02                9951
function.sqlsrv-fetch-array.php                    03-Dec-2023 00:02               14572
function.sqlsrv-fetch-object.php                   03-Dec-2023 00:02               12018
function.sqlsrv-fetch.php                          03-Dec-2023 00:02               10532
function.sqlsrv-field-metadata.php                 03-Dec-2023 00:02                8641
function.sqlsrv-free-stmt.php                      03-Dec-2023 00:02                7463
function.sqlsrv-get-config.php                     03-Dec-2023 00:02                3273
function.sqlsrv-get-field.php                      03-Dec-2023 00:02               10050
function.sqlsrv-has-rows.php                       03-Dec-2023 00:02                6151
function.sqlsrv-next-result.php                    03-Dec-2023 00:02                9129
function.sqlsrv-num-fields.php                     03-Dec-2023 00:02                8151
function.sqlsrv-num-rows.php                       03-Dec-2023 00:02                7811
function.sqlsrv-prepare.php                        03-Dec-2023 00:02               14053
function.sqlsrv-query.php                          03-Dec-2023 00:02               11406
function.sqlsrv-rollback.php                       03-Dec-2023 00:02               10383
function.sqlsrv-rows-affected.php                  03-Dec-2023 00:02                7773
function.sqlsrv-send-stream-data.php               03-Dec-2023 00:02                8331
function.sqlsrv-server-info.php                    03-Dec-2023 00:02                6052
function.sqrt.php                                  03-Dec-2023 00:02                4252
function.srand.php                                 03-Dec-2023 00:02                6474
function.sscanf.php                                03-Dec-2023 00:02               11597
function.ssdeep-fuzzy-compare.php                  03-Dec-2023 00:02                3054
function.ssdeep-fuzzy-hash-filename.php            03-Dec-2023 00:02                2818
function.ssdeep-fuzzy-hash.php                     03-Dec-2023 00:02                2660
function.ssh2-auth-agent.php                       03-Dec-2023 00:02                4484
function.ssh2-auth-hostbased-file.php              03-Dec-2023 00:02                7168
function.ssh2-auth-none.php                        03-Dec-2023 00:02                4726
function.ssh2-auth-password.php                    03-Dec-2023 00:02                4678
function.ssh2-auth-pubkey-file.php                 03-Dec-2023 00:02                6781
function.ssh2-connect.php                          03-Dec-2023 00:02               15410
function.ssh2-disconnect.php                       03-Dec-2023 00:02                2887
function.ssh2-exec.php                             03-Dec-2023 00:02                7004
function.ssh2-fetch-stream.php                     03-Dec-2023 00:02                5336
function.ssh2-fingerprint.php                      03-Dec-2023 00:02                5096
function.ssh2-forward-accept.php                   03-Dec-2023 00:02                2857
function.ssh2-forward-listen.php                   03-Dec-2023 00:02                4153
function.ssh2-methods-negotiated.php               03-Dec-2023 00:02                7885
function.ssh2-poll.php                             03-Dec-2023 00:02                3378
function.ssh2-publickey-add.php                    03-Dec-2023 00:02                7978
function.ssh2-publickey-init.php                   03-Dec-2023 00:02                4462
function.ssh2-publickey-list.php                   03-Dec-2023 00:02                8723
function.ssh2-publickey-remove.php                 03-Dec-2023 00:02                4426
function.ssh2-scp-recv.php                         03-Dec-2023 00:02                5157
function.ssh2-scp-send.php                         03-Dec-2023 00:02                5714
function.ssh2-send-eof.php                         03-Dec-2023 00:02                3240
function.ssh2-sftp-chmod.php                       03-Dec-2023 00:02                5705
function.ssh2-sftp-lstat.php                       03-Dec-2023 00:02                7227
function.ssh2-sftp-mkdir.php                       03-Dec-2023 00:02                6395
function.ssh2-sftp-readlink.php                    03-Dec-2023 00:02                5211
function.ssh2-sftp-realpath.php                    03-Dec-2023 00:02                5421
function.ssh2-sftp-rename.php                      03-Dec-2023 00:02                5252
function.ssh2-sftp-rmdir.php                       03-Dec-2023 00:02                5312
function.ssh2-sftp-stat.php                        03-Dec-2023 00:02                7142
function.ssh2-sftp-symlink.php                     03-Dec-2023 00:02                5477
function.ssh2-sftp-unlink.php                      03-Dec-2023 00:02                4767
function.ssh2-sftp.php                             03-Dec-2023 00:02                5290
function.ssh2-shell.php                            03-Dec-2023 00:02                7440
function.ssh2-tunnel.php                           03-Dec-2023 00:02                5140
function.stat.php                                  03-Dec-2023 00:02               16442
function.stats-absolute-deviation.php              03-Dec-2023 00:02                2670
function.stats-cdf-beta.php                        03-Dec-2023 00:02                4912
function.stats-cdf-binomial.php                    03-Dec-2023 00:02                4897
function.stats-cdf-cauchy.php                      03-Dec-2023 00:02                4932
function.stats-cdf-chisquare.php                   03-Dec-2023 00:02                4305
function.stats-cdf-exponential.php                 03-Dec-2023 00:02                4336
function.stats-cdf-f.php                           03-Dec-2023 00:02                4837
function.stats-cdf-gamma.php                       03-Dec-2023 00:02                4896
function.stats-cdf-laplace.php                     03-Dec-2023 00:02                4917
function.stats-cdf-logistic.php                    03-Dec-2023 00:02                4952
function.stats-cdf-negative-binomial.php           03-Dec-2023 00:02                5040
function.stats-cdf-noncentral-chisquare.php        03-Dec-2023 00:02                5142
function.stats-cdf-noncentral-f.php                03-Dec-2023 00:02                5662
function.stats-cdf-noncentral-t.php                03-Dec-2023 00:02                5002
function.stats-cdf-normal.php                      03-Dec-2023 00:02                4934
function.stats-cdf-poisson.php                     03-Dec-2023 00:02                4270
function.stats-cdf-t.php                           03-Dec-2023 00:02                4198
function.stats-cdf-uniform.php                     03-Dec-2023 00:02                4897
function.stats-cdf-weibull.php                     03-Dec-2023 00:02                4934
function.stats-covariance.php                      03-Dec-2023 00:02                2801
function.stats-dens-beta.php                       03-Dec-2023 00:02                3233
function.stats-dens-cauchy.php                     03-Dec-2023 00:02                3291
function.stats-dens-chisquare.php                  03-Dec-2023 00:02                3015
function.stats-dens-exponential.php                03-Dec-2023 00:02                3005
function.stats-dens-f.php                          03-Dec-2023 00:02                3231
function.stats-dens-gamma.php                      03-Dec-2023 00:02                3284
function.stats-dens-laplace.php                    03-Dec-2023 00:02                3318
function.stats-dens-logistic.php                   03-Dec-2023 00:02                3330
function.stats-dens-normal.php                     03-Dec-2023 00:02                3301
function.stats-dens-pmf-binomial.php               03-Dec-2023 00:02                3355
function.stats-dens-pmf-hypergeometric.php         03-Dec-2023 00:02                3953
function.stats-dens-pmf-negative-binomial.php      03-Dec-2023 00:02                3484
function.stats-dens-pmf-poisson.php                03-Dec-2023 00:02                3006
function.stats-dens-t.php                          03-Dec-2023 00:02                2919
function.stats-dens-uniform.php                    03-Dec-2023 00:02                3266
function.stats-dens-weibull.php                    03-Dec-2023 00:02                3298
function.stats-harmonic-mean.php                   03-Dec-2023 00:02                2645
function.stats-kurtosis.php                        03-Dec-2023 00:02                2562
function.stats-rand-gen-beta.php                   03-Dec-2023 00:02                2866
function.stats-rand-gen-chisquare.php              03-Dec-2023 00:02                2593
function.stats-rand-gen-exponential.php            03-Dec-2023 00:02                2591
function.stats-rand-gen-f.php                      03-Dec-2023 00:02                2920
function.stats-rand-gen-funiform.php               03-Dec-2023 00:02                2847
function.stats-rand-gen-gamma.php                  03-Dec-2023 00:02                2933
function.stats-rand-gen-ibinomial-negative.php     03-Dec-2023 00:02                3013
function.stats-rand-gen-ibinomial.php              03-Dec-2023 00:02                2937
function.stats-rand-gen-int.php                    03-Dec-2023 00:02                2218
function.stats-rand-gen-ipoisson.php               03-Dec-2023 00:02                2566
function.stats-rand-gen-iuniform.php               03-Dec-2023 00:02                2914
function.stats-rand-gen-noncentral-chisquare.php   03-Dec-2023 00:02                3055
function.stats-rand-gen-noncentral-f.php           03-Dec-2023 00:02                3354
function.stats-rand-gen-noncentral-t.php           03-Dec-2023 00:02                2968
function.stats-rand-gen-normal.php                 03-Dec-2023 00:02                2881
function.stats-rand-gen-t.php                      03-Dec-2023 00:02                2485
function.stats-rand-get-seeds.php                  03-Dec-2023 00:02                2261
function.stats-rand-phrase-to-seeds.php            03-Dec-2023 00:02                2572
function.stats-rand-ranf.php                       03-Dec-2023 00:02                2262
function.stats-rand-setall.php                     03-Dec-2023 00:02                2822
function.stats-skew.php                            03-Dec-2023 00:02                2528
function.stats-standard-deviation.php              03-Dec-2023 00:02                3412
function.stats-stat-binomial-coef.php              03-Dec-2023 00:02                2826
function.stats-stat-correlation.php                03-Dec-2023 00:02                2981
function.stats-stat-factorial.php                  03-Dec-2023 00:02                2453
function.stats-stat-independent-t.php              03-Dec-2023 00:02                3096
function.stats-stat-innerproduct.php               03-Dec-2023 00:02                2923
function.stats-stat-paired-t.php                   03-Dec-2023 00:02                2860
function.stats-stat-percentile.php                 03-Dec-2023 00:02                2778
function.stats-stat-powersum.php                   03-Dec-2023 00:02                2770
function.stats-variance.php                        03-Dec-2023 00:02                2982
function.stomp-connect-error.php                   03-Dec-2023 00:02                3560
function.stomp-version.php                         03-Dec-2023 00:02                3027
function.str-contains.php                          03-Dec-2023 00:02                8140
function.str-decrement.php                         03-Dec-2023 00:02                6332
function.str-ends-with.php                         03-Dec-2023 00:02                8077
function.str-getcsv.php                            03-Dec-2023 00:02                9011
function.str-increment.php                         03-Dec-2023 00:02                6019
function.str-ireplace.php                          03-Dec-2023 00:02                9138
function.str-pad.php                               03-Dec-2023 00:02                7824
function.str-repeat.php                            03-Dec-2023 00:02                4577
function.str-replace.php                           03-Dec-2023 00:02               16929
function.str-rot13.php                             03-Dec-2023 00:02                3525
function.str-shuffle.php                           03-Dec-2023 00:02                6052
function.str-split.php                             03-Dec-2023 00:02                8374
function.str-starts-with.php                       03-Dec-2023 00:02                8084
function.str-word-count.php                        03-Dec-2023 00:02                8921
function.strcasecmp.php                            03-Dec-2023 00:02                6226
function.strchr.php                                03-Dec-2023 00:02                1651
function.strcmp.php                                03-Dec-2023 00:02                5976
function.strcoll.php                               03-Dec-2023 00:02                5072
function.strcspn.php                               03-Dec-2023 00:02               11277
function.stream-bucket-append.php                  03-Dec-2023 00:02                2143
function.stream-bucket-make-writeable.php          03-Dec-2023 00:02                4120
function.stream-bucket-new.php                     03-Dec-2023 00:02                2118
function.stream-bucket-prepend.php                 03-Dec-2023 00:02                6218
function.stream-context-create.php                 03-Dec-2023 00:02                7421
function.stream-context-get-default.php            03-Dec-2023 00:02                8703
function.stream-context-get-options.php            03-Dec-2023 00:02                4441
function.stream-context-get-params.php             03-Dec-2023 00:02                5345
function.stream-context-set-default.php            03-Dec-2023 00:02                6225
function.stream-context-set-option.php             03-Dec-2023 00:02                5134
function.stream-context-set-options.php            03-Dec-2023 00:02                6135
function.stream-context-set-params.php             03-Dec-2023 00:02                4556
function.stream-copy-to-stream.php                 03-Dec-2023 00:02                7357
function.stream-filter-append.php                  03-Dec-2023 00:02               10672
function.stream-filter-prepend.php                 03-Dec-2023 00:02                7920
function.stream-filter-register.php                03-Dec-2023 00:02               18289
function.stream-filter-remove.php                  03-Dec-2023 00:02                6486
function.stream-get-contents.php                   03-Dec-2023 00:02                8519
function.stream-get-filters.php                    03-Dec-2023 00:02                4016
function.stream-get-line.php                       03-Dec-2023 00:02                4899
function.stream-get-meta-data.php                  03-Dec-2023 00:02               14488
function.stream-get-transports.php                 03-Dec-2023 00:02                4006
function.stream-get-wrappers.php                   03-Dec-2023 00:02                4769
function.stream-is-local.php                       03-Dec-2023 00:02                3894
function.stream-isatty.php                         03-Dec-2023 00:02                3804
function.stream-notification-callback.php          03-Dec-2023 00:02               22211
function.stream-register-wrapper.php               03-Dec-2023 00:02                1915
function.stream-resolve-include-path.php           03-Dec-2023 00:02                4119
function.stream-select.php                         03-Dec-2023 00:02               15869
function.stream-set-blocking.php                   03-Dec-2023 00:02                4572
function.stream-set-chunk-size.php                 03-Dec-2023 00:02                3925
function.stream-set-read-buffer.php                03-Dec-2023 00:02                3636
function.stream-set-timeout.php                    03-Dec-2023 00:02                7787
function.stream-set-write-buffer.php               03-Dec-2023 00:02                5791
function.stream-socket-accept.php                  03-Dec-2023 00:02                7395
function.stream-socket-client.php                  03-Dec-2023 00:02               17118
function.stream-socket-enable-crypto.php           03-Dec-2023 00:02               11370
function.stream-socket-get-name.php                03-Dec-2023 00:02                3572
function.stream-socket-pair.php                    03-Dec-2023 00:02                8744
function.stream-socket-recvfrom.php                03-Dec-2023 00:02               10431
function.stream-socket-sendto.php                  03-Dec-2023 00:02                7305
function.stream-socket-server.php                  03-Dec-2023 00:02               15049
function.stream-socket-shutdown.php                03-Dec-2023 00:02                6172
function.stream-supports-lock.php                  03-Dec-2023 00:02                3048
function.stream-wrapper-register.php               03-Dec-2023 00:02                9130
function.stream-wrapper-restore.php                03-Dec-2023 00:02                2726
function.stream-wrapper-unregister.php             03-Dec-2023 00:02                2955
function.strftime.php                              03-Dec-2023 00:02               55654
function.strip-tags.php                            03-Dec-2023 00:02                8963
function.stripcslashes.php                         03-Dec-2023 00:02                3929
function.stripos.php                               03-Dec-2023 00:02               11746
function.stripslashes.php                          03-Dec-2023 00:02                7480
function.stristr.php                               03-Dec-2023 00:02               10193
function.strlen.php                                03-Dec-2023 00:02                4879
function.strnatcasecmp.php                         03-Dec-2023 00:02                7617
function.strnatcmp.php                             03-Dec-2023 00:02                8891
function.strncasecmp.php                           03-Dec-2023 00:02                6773
function.strncmp.php                               03-Dec-2023 00:02                6773
function.strpbrk.php                               03-Dec-2023 00:02                5176
function.strpos.php                                03-Dec-2023 00:02               13583
function.strptime.php                              03-Dec-2023 00:02               11645
function.strrchr.php                               03-Dec-2023 00:02                8056
function.strrev.php                                03-Dec-2023 00:02                3056
function.strripos.php                              03-Dec-2023 00:02               10527
function.strrpos.php                               03-Dec-2023 00:02               13027
function.strspn.php                                03-Dec-2023 00:02               10585
function.strstr.php                                03-Dec-2023 00:02                8400
function.strtok.php                                03-Dec-2023 00:02               12226
function.strtolower.php                            03-Dec-2023 00:02                5900
function.strtotime.php                             03-Dec-2023 00:02               12764
function.strtoupper.php                            03-Dec-2023 00:02                5851
function.strtr.php                                 03-Dec-2023 00:02               10901
function.strval.php                                03-Dec-2023 00:02                6390
function.substr-compare.php                        03-Dec-2023 00:02               10471
function.substr-count.php                          03-Dec-2023 00:02                9299
function.substr-replace.php                        03-Dec-2023 00:02               15648
function.substr.php                                03-Dec-2023 00:02               22224
function.svn-add.php                               03-Dec-2023 00:02                5900
function.svn-auth-get-parameter.php                03-Dec-2023 00:02                3802
function.svn-auth-set-parameter.php                03-Dec-2023 00:02                5276
function.svn-blame.php                             03-Dec-2023 00:02                4770
function.svn-cat.php                               03-Dec-2023 00:02                4611
function.svn-checkout.php                          03-Dec-2023 00:02                7101
function.svn-cleanup.php                           03-Dec-2023 00:02                4990
function.svn-client-version.php                    03-Dec-2023 00:02                3366
function.svn-commit.php                            03-Dec-2023 00:02                7664
function.svn-delete.php                            03-Dec-2023 00:02                4325
function.svn-diff.php                              03-Dec-2023 00:02               12933
function.svn-export.php                            03-Dec-2023 00:02                4888
function.svn-fs-abort-txn.php                      03-Dec-2023 00:02                2957
function.svn-fs-apply-text.php                     03-Dec-2023 00:02                2568
function.svn-fs-begin-txn2.php                     03-Dec-2023 00:02                2513
function.svn-fs-change-node-prop.php               03-Dec-2023 00:02                2924
function.svn-fs-check-path.php                     03-Dec-2023 00:02                2619
function.svn-fs-contents-changed.php               03-Dec-2023 00:02                2925
function.svn-fs-copy.php                           03-Dec-2023 00:02                3778
function.svn-fs-delete.php                         03-Dec-2023 00:02                3179
function.svn-fs-dir-entries.php                    03-Dec-2023 00:02                2632
function.svn-fs-file-contents.php                  03-Dec-2023 00:02                2649
function.svn-fs-file-length.php                    03-Dec-2023 00:02                2578
function.svn-fs-is-dir.php                         03-Dec-2023 00:02                3225
function.svn-fs-is-file.php                        03-Dec-2023 00:02                3213
function.svn-fs-make-dir.php                       03-Dec-2023 00:02                3203
function.svn-fs-make-file.php                      03-Dec-2023 00:02                3220
function.svn-fs-node-created-rev.php               03-Dec-2023 00:02                2621
function.svn-fs-node-prop.php                      03-Dec-2023 00:02                2657
function.svn-fs-props-changed.php                  03-Dec-2023 00:02                2912
function.svn-fs-revision-prop.php                  03-Dec-2023 00:02                2672
function.svn-fs-revision-root.php                  03-Dec-2023 00:02                2596
function.svn-fs-txn-root.php                       03-Dec-2023 00:02                2419
function.svn-fs-youngest-rev.php                   03-Dec-2023 00:02                2467
function.svn-import.php                            03-Dec-2023 00:02                5717
function.svn-log.php                               03-Dec-2023 00:02                8658
function.svn-ls.php                                03-Dec-2023 00:02                6915
function.svn-mkdir.php                             03-Dec-2023 00:02                3028
function.svn-repos-create.php                      03-Dec-2023 00:02                2727
function.svn-repos-fs-begin-txn-for-commit.php     03-Dec-2023 00:02                2981
function.svn-repos-fs-commit-txn.php               03-Dec-2023 00:02                2522
function.svn-repos-fs.php                          03-Dec-2023 00:02                2416
function.svn-repos-hotcopy.php                     03-Dec-2023 00:02                2675
function.svn-repos-open.php                        03-Dec-2023 00:02                2392
function.svn-repos-recover.php                     03-Dec-2023 00:02                2441
function.svn-revert.php                            03-Dec-2023 00:02                3318
function.svn-status.php                            03-Dec-2023 00:02               14349
function.svn-update.php                            03-Dec-2023 00:02                5838
function.swoole-async-dns-lookup.php               03-Dec-2023 00:02                3585
function.swoole-async-read.php                     03-Dec-2023 00:02                4175
function.swoole-async-readfile.php                 03-Dec-2023 00:02                3595
function.swoole-async-set.php                      03-Dec-2023 00:02                2337
function.swoole-async-write.php                    03-Dec-2023 00:02                3435
function.swoole-async-writefile.php                03-Dec-2023 00:02                3463
function.swoole-clear-error.php                    03-Dec-2023 00:02                2254
function.swoole-client-select.php                  03-Dec-2023 00:02                3222
function.swoole-cpu-num.php                        03-Dec-2023 00:02                2070
function.swoole-errno.php                          03-Dec-2023 00:02                2047
function.swoole-error-log.php                      03-Dec-2023 00:02                3004
function.swoole-event-add.php                      03-Dec-2023 00:02                3345
function.swoole-event-defer.php                    03-Dec-2023 00:02                2484
function.swoole-event-del.php                      03-Dec-2023 00:02                2392
function.swoole-event-exit.php                     03-Dec-2023 00:02                2146
function.swoole-event-set.php                      03-Dec-2023 00:02                3332
function.swoole-event-wait.php                     03-Dec-2023 00:02                2117
function.swoole-event-write.php                    03-Dec-2023 00:02                2608
function.swoole-get-local-ip.php                   03-Dec-2023 00:02                2141
function.swoole-last-error.php                     03-Dec-2023 00:02                2096
function.swoole-load-module.php                    03-Dec-2023 00:02                2293
function.swoole-select.php                         03-Dec-2023 00:02                3189
function.swoole-set-process-name.php               03-Dec-2023 00:02                2497
function.swoole-strerror.php                       03-Dec-2023 00:02                2418
function.swoole-timer-after.php                    03-Dec-2023 00:02                2951
function.swoole-timer-exists.php                   03-Dec-2023 00:02                2314
function.swoole-timer-tick.php                     03-Dec-2023 00:02                2824
function.swoole-version.php                        03-Dec-2023 00:02                2073
function.symlink.php                               03-Dec-2023 00:02                5338
function.sys-get-temp-dir.php                      03-Dec-2023 00:02                4103
function.sys-getloadavg.php                        03-Dec-2023 00:02                3953
function.syslog.php                                03-Dec-2023 00:02                8684
function.system.php                                03-Dec-2023 00:02                7416
function.taint.php                                 03-Dec-2023 00:02                2500
function.tan.php                                   03-Dec-2023 00:02                4289
function.tanh.php                                  03-Dec-2023 00:02                3155
function.tcpwrap-check.php                         03-Dec-2023 00:02                5348
function.tempnam.php                               03-Dec-2023 00:02                6994
function.textdomain.php                            03-Dec-2023 00:02                3038
function.tidy-access-count.php                     03-Dec-2023 00:02                6367
function.tidy-config-count.php                     03-Dec-2023 00:02                4250
function.tidy-error-count.php                      03-Dec-2023 00:02                5264
function.tidy-get-output.php                       03-Dec-2023 00:02                4179
function.tidy-warning-count.php                    03-Dec-2023 00:02                4855
function.time-nanosleep.php                        03-Dec-2023 00:02                8294
function.time-sleep-until.php                      03-Dec-2023 00:02                5516
function.time.php                                  03-Dec-2023 00:02                4551
function.timezone-abbreviations-list.php           03-Dec-2023 00:02                1915
function.timezone-identifiers-list.php             03-Dec-2023 00:02                1931
function.timezone-location-get.php                 03-Dec-2023 00:02                1887
function.timezone-name-from-abbr.php               03-Dec-2023 00:02                6049
function.timezone-name-get.php                     03-Dec-2023 00:02                1831
function.timezone-offset-get.php                   03-Dec-2023 00:02                1829
function.timezone-open.php                         03-Dec-2023 00:02                1817
function.timezone-transitions-get.php              03-Dec-2023 00:02                1890
function.timezone-version-get.php                  03-Dec-2023 00:02                4319
function.tmpfile.php                               03-Dec-2023 00:02                5379
function.token-get-all.php                         03-Dec-2023 00:02                5903
function.token-name.php                            03-Dec-2023 00:02                4016
function.touch.php                                 03-Dec-2023 00:02                7563
function.trader-acos.php                           03-Dec-2023 00:02                2372
function.trader-ad.php                             03-Dec-2023 00:02                3132
function.trader-add.php                            03-Dec-2023 00:02                2639
function.trader-adosc.php                          03-Dec-2023 00:02                3898
function.trader-adx.php                            03-Dec-2023 00:02                3219
function.trader-adxr.php                           03-Dec-2023 00:02                3230
function.trader-apo.php                            03-Dec-2023 00:02                3407
function.trader-aroon.php                          03-Dec-2023 00:02                2832
function.trader-aroonosc.php                       03-Dec-2023 00:02                2869
function.trader-asin.php                           03-Dec-2023 00:02                2375
function.trader-atan.php                           03-Dec-2023 00:02                2368
function.trader-atr.php                            03-Dec-2023 00:02                3209
function.trader-avgprice.php                       03-Dec-2023 00:02                3191
function.trader-bbands.php                         03-Dec-2023 00:02                4128
function.trader-beta.php                           03-Dec-2023 00:02                2796
function.trader-bop.php                            03-Dec-2023 00:02                3140
function.trader-cci.php                            03-Dec-2023 00:02                3214
function.trader-cdl2crows.php                      03-Dec-2023 00:02                3213
function.trader-cdl3blackcrows.php                 03-Dec-2023 00:02                3275
function.trader-cdl3inside.php                     03-Dec-2023 00:02                3256
function.trader-cdl3linestrike.php                 03-Dec-2023 00:02                3279
function.trader-cdl3outside.php                    03-Dec-2023 00:02                3271
function.trader-cdl3starsinsouth.php               03-Dec-2023 00:02                3320
function.trader-cdl3whitesoldiers.php              03-Dec-2023 00:02                3344
function.trader-cdlabandonedbaby.php               03-Dec-2023 00:02                3674
function.trader-cdladvanceblock.php                03-Dec-2023 00:02                3297
function.trader-cdlbelthold.php                    03-Dec-2023 00:02                3253
function.trader-cdlbreakaway.php                   03-Dec-2023 00:02                3267
function.trader-cdlclosingmarubozu.php             03-Dec-2023 00:02                3338
function.trader-cdlconcealbabyswall.php            03-Dec-2023 00:02                3361
function.trader-cdlcounterattack.php               03-Dec-2023 00:02                3325
function.trader-cdldarkcloudcover.php              03-Dec-2023 00:02                3668
function.trader-cdldoji.php                        03-Dec-2023 00:02                3210
function.trader-cdldojistar.php                    03-Dec-2023 00:02                3245
function.trader-cdldragonflydoji.php               03-Dec-2023 00:02                3300
function.trader-cdlengulfing.php                   03-Dec-2023 00:02                3285
function.trader-cdleveningdojistar.php             03-Dec-2023 00:02                3685
function.trader-cdleveningstar.php                 03-Dec-2023 00:02                3662
function.trader-cdlgapsidesidewhite.php            03-Dec-2023 00:02                3368
function.trader-cdlgravestonedoji.php              03-Dec-2023 00:02                3321
function.trader-cdlhammer.php                      03-Dec-2023 00:02                3236
function.trader-cdlhangingman.php                  03-Dec-2023 00:02                3257
function.trader-cdlharami.php                      03-Dec-2023 00:02                3238
function.trader-cdlharamicross.php                 03-Dec-2023 00:02                3280
function.trader-cdlhighwave.php                    03-Dec-2023 00:02                3254
function.trader-cdlhikkake.php                     03-Dec-2023 00:02                3243
function.trader-cdlhikkakemod.php                  03-Dec-2023 00:02                3284
function.trader-cdlhomingpigeon.php                03-Dec-2023 00:02                3305
function.trader-cdlidentical3crows.php             03-Dec-2023 00:02                3329
function.trader-cdlinneck.php                      03-Dec-2023 00:02                3255
function.trader-cdlinvertedhammer.php              03-Dec-2023 00:02                3303
function.trader-cdlkicking.php                     03-Dec-2023 00:02                3257
function.trader-cdlkickingbylength.php             03-Dec-2023 00:02                3363
function.trader-cdlladderbottom.php                03-Dec-2023 00:02                3313
function.trader-cdllongleggeddoji.php              03-Dec-2023 00:02                3318
function.trader-cdllongline.php                    03-Dec-2023 00:02                3262
function.trader-cdlmarubozu.php                    03-Dec-2023 00:02                3248
function.trader-cdlmatchinglow.php                 03-Dec-2023 00:02                3274
function.trader-cdlmathold.php                     03-Dec-2023 00:02                3608
function.trader-cdlmorningdojistar.php             03-Dec-2023 00:02                3681
function.trader-cdlmorningstar.php                 03-Dec-2023 00:02                3642
function.trader-cdlonneck.php                      03-Dec-2023 00:02                3235
function.trader-cdlpiercing.php                    03-Dec-2023 00:02                3252
function.trader-cdlrickshawman.php                 03-Dec-2023 00:02                3292
function.trader-cdlrisefall3methods.php            03-Dec-2023 00:02                3362
function.trader-cdlseparatinglines.php             03-Dec-2023 00:02                3344
function.trader-cdlshootingstar.php                03-Dec-2023 00:02                3303
function.trader-cdlshortline.php                   03-Dec-2023 00:02                3275
function.trader-cdlspinningtop.php                 03-Dec-2023 00:02                3290
function.trader-cdlstalledpattern.php              03-Dec-2023 00:02                3325
function.trader-cdlsticksandwich.php               03-Dec-2023 00:02                3306
function.trader-cdltakuri.php                      03-Dec-2023 00:02                3277
function.trader-cdltasukigap.php                   03-Dec-2023 00:02                3252
function.trader-cdlthrusting.php                   03-Dec-2023 00:02                3261
function.trader-cdltristar.php                     03-Dec-2023 00:02                3249
function.trader-cdlunique3river.php                03-Dec-2023 00:02                3300
function.trader-cdlupsidegap2crows.php             03-Dec-2023 00:02                3348
function.trader-cdlxsidegap3methods.php            03-Dec-2023 00:02                3347
function.trader-ceil.php                           03-Dec-2023 00:02                2392
function.trader-cmo.php                            03-Dec-2023 00:02                2561
function.trader-correl.php                         03-Dec-2023 00:02                2848
function.trader-cos.php                            03-Dec-2023 00:02                2358
function.trader-cosh.php                           03-Dec-2023 00:02                2374
function.trader-dema.php                           03-Dec-2023 00:02                2572
function.trader-div.php                            03-Dec-2023 00:02                2655
function.trader-dx.php                             03-Dec-2023 00:02                3195
function.trader-ema.php                            03-Dec-2023 00:02                2555
function.trader-errno.php                          03-Dec-2023 00:02                2140
function.trader-exp.php                            03-Dec-2023 00:02                2402
function.trader-floor.php                          03-Dec-2023 00:02                2384
function.trader-get-compat.php                     03-Dec-2023 00:02                2330
function.trader-get-unstable-period.php            03-Dec-2023 00:02                2604
function.trader-ht-dcperiod.php                    03-Dec-2023 00:02                2372
function.trader-ht-dcphase.php                     03-Dec-2023 00:02                2343
function.trader-ht-phasor.php                      03-Dec-2023 00:02                2324
function.trader-ht-sine.php                        03-Dec-2023 00:02                2303
function.trader-ht-trendline.php                   03-Dec-2023 00:02                2364
function.trader-ht-trendmode.php                   03-Dec-2023 00:02                2354
function.trader-kama.php                           03-Dec-2023 00:02                2610
function.trader-linearreg-angle.php                03-Dec-2023 00:02                2704
function.trader-linearreg-intercept.php            03-Dec-2023 00:02                2762
function.trader-linearreg-slope.php                03-Dec-2023 00:02                2714
function.trader-linearreg.php                      03-Dec-2023 00:02                2626
function.trader-ln.php                             03-Dec-2023 00:02                2360
function.trader-log10.php                          03-Dec-2023 00:02                2364
function.trader-ma.php                             03-Dec-2023 00:02                2917
function.trader-macd.php                           03-Dec-2023 00:02                3408
function.trader-macdext.php                        03-Dec-2023 00:02                4740
function.trader-macdfix.php                        03-Dec-2023 00:02                2661
function.trader-mama.php                           03-Dec-2023 00:02                2951
function.trader-mavp.php                           03-Dec-2023 00:02                3761
function.trader-max.php                            03-Dec-2023 00:02                2576
function.trader-maxindex.php                       03-Dec-2023 00:02                2633
function.trader-medprice.php                       03-Dec-2023 00:02                2547
function.trader-mfi.php                            03-Dec-2023 00:02                3509
function.trader-midpoint.php                       03-Dec-2023 00:02                2607
function.trader-midprice.php                       03-Dec-2023 00:02                2883
function.trader-min.php                            03-Dec-2023 00:02                2583
function.trader-minindex.php                       03-Dec-2023 00:02                2628
function.trader-minmax.php                         03-Dec-2023 00:02                2632
function.trader-minmaxindex.php                    03-Dec-2023 00:02                2683
function.trader-minus-di.php                       03-Dec-2023 00:02                3282
function.trader-minus-dm.php                       03-Dec-2023 00:02                2883
function.trader-mom.php                            03-Dec-2023 00:02                2547
function.trader-mult.php                           03-Dec-2023 00:02                2655
function.trader-natr.php                           03-Dec-2023 00:02                3220
function.trader-obv.php                            03-Dec-2023 00:02                2499
function.trader-plus-di.php                        03-Dec-2023 00:02                3253
function.trader-plus-dm.php                        03-Dec-2023 00:02                2870
function.trader-ppo.php                            03-Dec-2023 00:02                3411
function.trader-roc.php                            03-Dec-2023 00:02                2571
function.trader-rocp.php                           03-Dec-2023 00:02                2599
function.trader-rocr.php                           03-Dec-2023 00:02                2584
function.trader-rocr100.php                        03-Dec-2023 00:02                2624
function.trader-rsi.php                            03-Dec-2023 00:02                2552
function.trader-sar.php                            03-Dec-2023 00:02                3454
function.trader-sarext.php                         03-Dec-2023 00:02                6542
function.trader-set-compat.php                     03-Dec-2023 00:02                2546
function.trader-set-unstable-period.php            03-Dec-2023 00:02                3080
function.trader-sin.php                            03-Dec-2023 00:02                2382
function.trader-sinh.php                           03-Dec-2023 00:02                2370
function.trader-sma.php                            03-Dec-2023 00:02                2552
function.trader-sqrt.php                           03-Dec-2023 00:02                2363
function.trader-stddev.php                         03-Dec-2023 00:02                2842
function.trader-stoch.php                          03-Dec-2023 00:02                4895
function.trader-stochf.php                         03-Dec-2023 00:02                4101
function.trader-stochrsi.php                       03-Dec-2023 00:02                3888
function.trader-sub.php                            03-Dec-2023 00:02                2660
function.trader-sum.php                            03-Dec-2023 00:02                2534
function.trader-t3.php                             03-Dec-2023 00:02                2864
function.trader-tan.php                            03-Dec-2023 00:02                2351
function.trader-tanh.php                           03-Dec-2023 00:02                2375
function.trader-tema.php                           03-Dec-2023 00:02                2578
function.trader-trange.php                         03-Dec-2023 00:02                2790
function.trader-trima.php                          03-Dec-2023 00:02                2580
function.trader-trix.php                           03-Dec-2023 00:02                2590
function.trader-tsf.php                            03-Dec-2023 00:02                2559
function.trader-typprice.php                       03-Dec-2023 00:02                2813
function.trader-ultosc.php                         03-Dec-2023 00:02                3963
function.trader-var.php                            03-Dec-2023 00:02                2812
function.trader-wclprice.php                       03-Dec-2023 00:02                2818
function.trader-willr.php                          03-Dec-2023 00:02                3226
function.trader-wma.php                            03-Dec-2023 00:02                2583
function.trait-exists.php                          03-Dec-2023 00:02                2788
function.trigger-error.php                         03-Dec-2023 00:02                6327
function.trim.php                                  03-Dec-2023 00:02               13452
function.uasort.php                                03-Dec-2023 00:02               10210
function.ucfirst.php                               03-Dec-2023 00:02                6055
function.ucwords.php                               03-Dec-2023 00:02                9597
function.ui-draw-text-font-fontfamilies.php        03-Dec-2023 00:02                2297
function.ui-quit.php                               03-Dec-2023 00:02                2013
function.ui-run.php                                03-Dec-2023 00:02                2337
function.uksort.php                                03-Dec-2023 00:02                9615
function.umask.php                                 03-Dec-2023 00:02                5485
function.uniqid.php                                03-Dec-2023 00:02                8080
function.unixtojd.php                              03-Dec-2023 00:02                3636
function.unlink.php                                03-Dec-2023 00:02                5694
function.unpack.php                                03-Dec-2023 00:02               10067
function.unregister-tick-function.php              03-Dec-2023 00:02                3187
function.unserialize.php                           03-Dec-2023 00:02               16567
function.unset.php                                 03-Dec-2023 00:02               15287
function.untaint.php                               03-Dec-2023 00:02                2356
function.uopz-add-function.php                     03-Dec-2023 00:02                6529
function.uopz-allow-exit.php                       03-Dec-2023 00:02                4521
function.uopz-backup.php                           03-Dec-2023 00:02                4314
function.uopz-compose.php                          03-Dec-2023 00:02                6511
function.uopz-copy.php                             03-Dec-2023 00:02                4951
function.uopz-del-function.php                     03-Dec-2023 00:02                6062
function.uopz-delete.php                           03-Dec-2023 00:02                5690
function.uopz-extend.php                           03-Dec-2023 00:02                4708
function.uopz-flags.php                            03-Dec-2023 00:02               10412
function.uopz-function.php                         03-Dec-2023 00:02                6914
function.uopz-get-exit-status.php                  03-Dec-2023 00:02                4145
function.uopz-get-hook.php                         03-Dec-2023 00:02                5106
function.uopz-get-mock.php                         03-Dec-2023 00:02                4881
function.uopz-get-property.php                     03-Dec-2023 00:02                5980
function.uopz-get-return.php                       03-Dec-2023 00:02                4314
function.uopz-get-static.php                       03-Dec-2023 00:02                4735
function.uopz-implement.php                        03-Dec-2023 00:02                4733
function.uopz-overload.php                         03-Dec-2023 00:02                3814
function.uopz-redefine.php                         03-Dec-2023 00:02                4796
function.uopz-rename.php                           03-Dec-2023 00:02                6359
function.uopz-restore.php                          03-Dec-2023 00:02                4681
function.uopz-set-hook.php                         03-Dec-2023 00:02                5266
function.uopz-set-mock.php                         03-Dec-2023 00:02               10667
function.uopz-set-property.php                     03-Dec-2023 00:02                7289
function.uopz-set-return.php                       03-Dec-2023 00:02                9112
function.uopz-set-static.php                       03-Dec-2023 00:02                5341
function.uopz-undefine.php                         03-Dec-2023 00:02                4268
function.uopz-unset-hook.php                       03-Dec-2023 00:02                5153
function.uopz-unset-mock.php                       03-Dec-2023 00:02                5215
function.uopz-unset-return.php                     03-Dec-2023 00:02                4590
function.urldecode.php                             03-Dec-2023 00:02                6242
function.urlencode.php                             03-Dec-2023 00:02                9484
function.use-soap-error-handler.php                03-Dec-2023 00:02                3619
function.user-error.php                            03-Dec-2023 00:02                1745
function.usleep.php                                03-Dec-2023 00:02                6780
function.usort.php                                 03-Dec-2023 00:02               26908
function.utf8-decode.php                           03-Dec-2023 00:02               18524
function.utf8-encode.php                           03-Dec-2023 00:02               15114
function.var-dump.php                              03-Dec-2023 00:02                7057
function.var-export.php                            03-Dec-2023 00:02               16123
function.var-representation.php                    03-Dec-2023 00:02               12979
function.variant-abs.php                           03-Dec-2023 00:02                4209
function.variant-add.php                           03-Dec-2023 00:02                5582
function.variant-and.php                           03-Dec-2023 00:02                6286
function.variant-cast.php                          03-Dec-2023 00:02                3488
function.variant-cat.php                           03-Dec-2023 00:02                4802
function.variant-cmp.php                           03-Dec-2023 00:02                7239
function.variant-date-from-timestamp.php           03-Dec-2023 00:02                3545
function.variant-date-to-timestamp.php             03-Dec-2023 00:02                3620
function.variant-div.php                           03-Dec-2023 00:02                6378
function.variant-eqv.php                           03-Dec-2023 00:02                4403
function.variant-fix.php                           03-Dec-2023 00:02                5628
function.variant-get-type.php                      03-Dec-2023 00:02                3421
function.variant-idiv.php                          03-Dec-2023 00:02                5801
function.variant-imp.php                           03-Dec-2023 00:02                5823
function.variant-int.php                           03-Dec-2023 00:02                5128
function.variant-mod.php                           03-Dec-2023 00:02                4877
function.variant-mul.php                           03-Dec-2023 00:02                5886
function.variant-neg.php                           03-Dec-2023 00:02                3863
function.variant-not.php                           03-Dec-2023 00:02                4027
function.variant-or.php                            03-Dec-2023 00:02                6461
function.variant-pow.php                           03-Dec-2023 00:02                4699
function.variant-round.php                         03-Dec-2023 00:02                4397
function.variant-set-type.php                      03-Dec-2023 00:02                3612
function.variant-set.php                           03-Dec-2023 00:02                2911
function.variant-sub.php                           03-Dec-2023 00:02                5544
function.variant-xor.php                           03-Dec-2023 00:02                5813
function.version-compare.php                       03-Dec-2023 00:02               10890
function.vfprintf.php                              03-Dec-2023 00:02               19862
function.virtual.php                               03-Dec-2023 00:02                5231
function.vprintf.php                               03-Dec-2023 00:02               19281
function.vsprintf.php                              03-Dec-2023 00:02               19160
function.wddx-add-vars.php                         03-Dec-2023 00:02                3659
function.wddx-deserialize.php                      03-Dec-2023 00:02                1678
function.wddx-packet-end.php                       03-Dec-2023 00:02                2520
function.wddx-packet-start.php                     03-Dec-2023 00:02                2710
function.wddx-serialize-value.php                  03-Dec-2023 00:02                2931
function.wddx-serialize-vars.php                   03-Dec-2023 00:02                5775
function.win32-continue-service.php                03-Dec-2023 00:02                6417
function.win32-create-service.php                  03-Dec-2023 00:02               27630
function.win32-delete-service.php                  03-Dec-2023 00:02                6819
function.win32-get-last-control-message.php        03-Dec-2023 00:02                7112
function.win32-pause-service.php                   03-Dec-2023 00:02                6403
function.win32-query-service-status.php            03-Dec-2023 00:02                8300
function.win32-send-custom-control.php             03-Dec-2023 00:02                6958
function.win32-set-service-exit-code.php           03-Dec-2023 00:02                5655
function.win32-set-service-exit-mode.php           03-Dec-2023 00:02                5698
function.win32-set-service-status.php              03-Dec-2023 00:02                8111
function.win32-start-service-ctrl-dispatcher.php   03-Dec-2023 00:02               10732
function.win32-start-service.php                   03-Dec-2023 00:02                6407
function.win32-stop-service.php                    03-Dec-2023 00:02                6344
function.wincache-fcache-fileinfo.php              03-Dec-2023 00:02                9156
function.wincache-fcache-meminfo.php               03-Dec-2023 00:02                7076
function.wincache-lock.php                         03-Dec-2023 00:02                8341
function.wincache-ocache-fileinfo.php              03-Dec-2023 00:02                9814
function.wincache-ocache-meminfo.php               03-Dec-2023 00:02                7271
function.wincache-refresh-if-changed.php           03-Dec-2023 00:02                7739
function.wincache-rplist-fileinfo.php              03-Dec-2023 00:02                7511
function.wincache-rplist-meminfo.php               03-Dec-2023 00:02                7191
function.wincache-scache-info.php                  03-Dec-2023 00:02                9414
function.wincache-scache-meminfo.php               03-Dec-2023 00:02                6649
function.wincache-ucache-add.php                   03-Dec-2023 00:02               13126
function.wincache-ucache-cas.php                   03-Dec-2023 00:02                6063
function.wincache-ucache-clear.php                 03-Dec-2023 00:02                7506
function.wincache-ucache-dec.php                   03-Dec-2023 00:02                6100
function.wincache-ucache-delete.php                03-Dec-2023 00:02               11247
function.wincache-ucache-exists.php                03-Dec-2023 00:02                6042
function.wincache-ucache-get.php                   03-Dec-2023 00:02               10438
function.wincache-ucache-inc.php                   03-Dec-2023 00:02                6092
function.wincache-ucache-info.php                  03-Dec-2023 00:02               11127
function.wincache-ucache-meminfo.php               03-Dec-2023 00:02                6853
function.wincache-ucache-set.php                   03-Dec-2023 00:02               13344
function.wincache-unlock.php                       03-Dec-2023 00:02                7710
function.wordwrap.php                              03-Dec-2023 00:02                8792
function.xattr-get.php                             03-Dec-2023 00:02                5771
function.xattr-list.php                            03-Dec-2023 00:02                6287
function.xattr-remove.php                          03-Dec-2023 00:02                5953
function.xattr-set.php                             03-Dec-2023 00:02                7514
function.xattr-supported.php                       03-Dec-2023 00:02                4983
function.xdiff-file-bdiff-size.php                 03-Dec-2023 00:02                4787
function.xdiff-file-bdiff.php                      03-Dec-2023 00:02                5640
function.xdiff-file-bpatch.php                     03-Dec-2023 00:02                6212
function.xdiff-file-diff-binary.php                03-Dec-2023 00:02                6081
function.xdiff-file-diff.php                       03-Dec-2023 00:02                6865
function.xdiff-file-merge3.php                     03-Dec-2023 00:02                6535
function.xdiff-file-patch-binary.php               03-Dec-2023 00:02                6363
function.xdiff-file-patch.php                      03-Dec-2023 00:02                8520
function.xdiff-file-rabdiff.php                    03-Dec-2023 00:02                6196
function.xdiff-string-bdiff-size.php               03-Dec-2023 00:02                5090
function.xdiff-string-bdiff.php                    03-Dec-2023 00:02                3651
function.xdiff-string-bpatch.php                   03-Dec-2023 00:02                3764
function.xdiff-string-diff-binary.php              03-Dec-2023 00:02                4160
function.xdiff-string-diff.php                     03-Dec-2023 00:02                7209
function.xdiff-string-merge3.php                   03-Dec-2023 00:02                4536
function.xdiff-string-patch-binary.php             03-Dec-2023 00:02                4317
function.xdiff-string-patch.php                    03-Dec-2023 00:02                7836
function.xdiff-string-rabdiff.php                  03-Dec-2023 00:02                4276
function.xhprof-disable.php                        03-Dec-2023 00:02                3845
function.xhprof-enable.php                         03-Dec-2023 00:02                6864
function.xhprof-sample-disable.php                 03-Dec-2023 00:02                4515
function.xhprof-sample-enable.php                  03-Dec-2023 00:02                3460
function.xml-error-string.php                      03-Dec-2023 00:02                3159
function.xml-get-current-byte-index.php            03-Dec-2023 00:02                4312
function.xml-get-current-column-number.php         03-Dec-2023 00:02                4160
function.xml-get-current-line-number.php           03-Dec-2023 00:02                3962
function.xml-get-error-code.php                    03-Dec-2023 00:02                3140
function.xml-parse-into-struct.php                 03-Dec-2023 00:02               18274
function.xml-parse.php                             03-Dec-2023 00:02                7817
function.xml-parser-create-ns.php                  03-Dec-2023 00:02                4528
function.xml-parser-create.php                     03-Dec-2023 00:02                3884
function.xml-parser-free.php                       03-Dec-2023 00:02                2654
function.xml-parser-get-option.php                 03-Dec-2023 00:02                3470
function.xml-parser-set-option.php                 03-Dec-2023 00:02                5357
function.xml-set-character-data-handler.php        03-Dec-2023 00:02                5360
function.xml-set-default-handler.php               03-Dec-2023 00:02                5267
function.xml-set-element-handler.php               03-Dec-2023 00:02                8490
function.xml-set-end-namespace-decl-handler.php    03-Dec-2023 00:02                6158
function.xml-set-external-entity-ref-handler.php   03-Dec-2023 00:02                7742
function.xml-set-notation-decl-handler.php         03-Dec-2023 00:02                7237
function.xml-set-object.php                        03-Dec-2023 00:02                8982
function.xml-set-processing-instruction-handler..> 03-Dec-2023 00:02                6326
function.xml-set-start-namespace-decl-handler.php  03-Dec-2023 00:02                6413
function.xml-set-unparsed-entity-decl-handler.php  03-Dec-2023 00:02                7992
function.xmlrpc-decode-request.php                 03-Dec-2023 00:02                2642
function.xmlrpc-decode.php                         03-Dec-2023 00:02                4064
function.xmlrpc-encode-request.php                 03-Dec-2023 00:02                8378
function.xmlrpc-encode.php                         03-Dec-2023 00:02                2318
function.xmlrpc-get-type.php                       03-Dec-2023 00:02                2426
function.xmlrpc-is-fault.php                       03-Dec-2023 00:02                3698
function.xmlrpc-parse-method-descriptions.php      03-Dec-2023 00:02                2428
function.xmlrpc-server-add-introspection-data.php  03-Dec-2023 00:02                2561
function.xmlrpc-server-call-method.php             03-Dec-2023 00:02                2952
function.xmlrpc-server-create.php                  03-Dec-2023 00:02                2189
function.xmlrpc-server-destroy.php                 03-Dec-2023 00:02                2339
function.xmlrpc-server-register-introspection-c..> 03-Dec-2023 00:02                2638
function.xmlrpc-server-register-method.php         03-Dec-2023 00:02                2651
function.xmlrpc-set-type.php                       03-Dec-2023 00:02                5128
function.yaml-emit-file.php                        03-Dec-2023 00:02                5838
function.yaml-emit.php                             03-Dec-2023 00:02               11427
function.yaml-parse-file.php                       03-Dec-2023 00:02                5702
function.yaml-parse-url.php                        03-Dec-2023 00:02                6030
function.yaml-parse.php                            03-Dec-2023 00:02                9467
function.yaz-addinfo.php                           03-Dec-2023 00:02                3314
function.yaz-ccl-conf.php                          03-Dec-2023 00:02                5564
function.yaz-ccl-parse.php                         03-Dec-2023 00:02                6413
function.yaz-close.php                             03-Dec-2023 00:02                3289
function.yaz-connect.php                           03-Dec-2023 00:02                8928
function.yaz-database.php                          03-Dec-2023 00:02                3154
function.yaz-element.php                           03-Dec-2023 00:02                3586
function.yaz-errno.php                             03-Dec-2023 00:02                3539
function.yaz-error.php                             03-Dec-2023 00:02                3292
function.yaz-es-result.php                         03-Dec-2023 00:02                3197
function.yaz-es.php                                03-Dec-2023 00:02                6966
function.yaz-get-option.php                        03-Dec-2023 00:02                3216
function.yaz-hits.php                              03-Dec-2023 00:02                4689
function.yaz-itemorder.php                         03-Dec-2023 00:02                6913
function.yaz-present.php                           03-Dec-2023 00:02                2786
function.yaz-range.php                             03-Dec-2023 00:02                3420
function.yaz-record.php                            03-Dec-2023 00:02               13989
function.yaz-scan-result.php                       03-Dec-2023 00:02                3840
function.yaz-scan.php                              03-Dec-2023 00:02                9097
function.yaz-schema.php                            03-Dec-2023 00:02                3308
function.yaz-search.php                            03-Dec-2023 00:02                8331
function.yaz-set-option.php                        03-Dec-2023 00:02                6668
function.yaz-sort.php                              03-Dec-2023 00:02                5448
function.yaz-syntax.php                            03-Dec-2023 00:02                3266
function.yaz-wait.php                              03-Dec-2023 00:02                3989
function.zend-thread-id.php                        03-Dec-2023 00:02                3658
function.zend-version.php                          03-Dec-2023 00:02                3861
function.zip-close.php                             03-Dec-2023 00:02                3871
function.zip-entry-close.php                       03-Dec-2023 00:02                3980
function.zip-entry-compressedsize.php              03-Dec-2023 00:02                4290
function.zip-entry-compressionmethod.php           03-Dec-2023 00:02                4414
function.zip-entry-filesize.php                    03-Dec-2023 00:02                4221
function.zip-entry-name.php                        03-Dec-2023 00:02                4095
function.zip-entry-open.php                        03-Dec-2023 00:02                5576
function.zip-entry-read.php                        03-Dec-2023 00:02                4844
function.zip-open.php                              03-Dec-2023 00:02                4254
function.zip-read.php                              03-Dec-2023 00:02                4504
function.zlib-decode.php                           03-Dec-2023 00:02                3206
function.zlib-encode.php                           03-Dec-2023 00:02                4914
function.zlib-get-coding-type.php                  03-Dec-2023 00:02                2783
function.zookeeper-dispatch.php                    03-Dec-2023 00:02                8388
functional.parallel.php                            03-Dec-2023 00:02                2544
functions.anonymous.php                            03-Dec-2023 00:02               23974
functions.arguments.php                            03-Dec-2023 00:02               42280
functions.arrow.php                                03-Dec-2023 00:02               10156
functions.first_class_callable_syntax.php          03-Dec-2023 00:02               11300
functions.internal.php                             03-Dec-2023 00:02                7553
functions.returning-values.php                     03-Dec-2023 00:02                6237
functions.user-defined.php                         03-Dec-2023 00:02                9486
functions.variable-functions.php                   03-Dec-2023 00:02               11605
gearman.configuration.php                          03-Dec-2023 00:02                1316
gearman.constants.php                              03-Dec-2023 00:02               17938
gearman.examples-reverse-bg.php                    03-Dec-2023 00:02               10655
gearman.examples-reverse-task.php                  03-Dec-2023 00:02               17304
gearman.examples-reverse.php                       03-Dec-2023 00:02               12730
gearman.examples.php                               03-Dec-2023 00:02                1559
gearman.installation.php                           03-Dec-2023 00:02                1649
gearman.requirements.php                           03-Dec-2023 00:02                1551
gearman.resources.php                              03-Dec-2023 00:02                1284
gearman.setup.php                                  03-Dec-2023 00:02                1659
gearmanclient.addoptions.php                       03-Dec-2023 00:02                2854
gearmanclient.addserver.php                        03-Dec-2023 00:02                5037
gearmanclient.addservers.php                       03-Dec-2023 00:02                4525
gearmanclient.addtask.php                          03-Dec-2023 00:02               14711
gearmanclient.addtaskbackground.php                03-Dec-2023 00:02               20487
gearmanclient.addtaskhigh.php                      03-Dec-2023 00:02               11253
gearmanclient.addtaskhighbackground.php            03-Dec-2023 00:02                6201
gearmanclient.addtasklow.php                       03-Dec-2023 00:02               11235
gearmanclient.addtasklowbackground.php             03-Dec-2023 00:02                6194
gearmanclient.addtaskstatus.php                    03-Dec-2023 00:02                9633
gearmanclient.clearcallbacks.php                   03-Dec-2023 00:02                4341
gearmanclient.clone.php                            03-Dec-2023 00:02                2576
gearmanclient.construct.php                        03-Dec-2023 00:02                2820
gearmanclient.context.php                          03-Dec-2023 00:02                2828
gearmanclient.data.php                             03-Dec-2023 00:02                3093
gearmanclient.do.php                               03-Dec-2023 00:02               21910
gearmanclient.dobackground.php                     03-Dec-2023 00:02                9380
gearmanclient.dohigh.php                           03-Dec-2023 00:02                4871
gearmanclient.dohighbackground.php                 03-Dec-2023 00:02                4698
gearmanclient.dojobhandle.php                      03-Dec-2023 00:02                2885
gearmanclient.dolow.php                            03-Dec-2023 00:02                4857
gearmanclient.dolowbackground.php                  03-Dec-2023 00:02                4680
gearmanclient.donormal.php                         03-Dec-2023 00:02               22397
gearmanclient.dostatus.php                         03-Dec-2023 00:02                8046
gearmanclient.echo.php                             03-Dec-2023 00:02                2746
gearmanclient.error.php                            03-Dec-2023 00:02                2742
gearmanclient.geterrno.php                         03-Dec-2023 00:02                2597
gearmanclient.jobstatus.php                        03-Dec-2023 00:02                8176
gearmanclient.ping.php                             03-Dec-2023 00:02                2719
gearmanclient.removeoptions.php                    03-Dec-2023 00:02                2500
gearmanclient.returncode.php                       03-Dec-2023 00:02                2226
gearmanclient.runtasks.php                         03-Dec-2023 00:02                3545
gearmanclient.setclientcallback.php                03-Dec-2023 00:02                5335
gearmanclient.setcompletecallback.php              03-Dec-2023 00:02                5172
gearmanclient.setcontext.php                       03-Dec-2023 00:02                3057
gearmanclient.setcreatedcallback.php               03-Dec-2023 00:02                4711
gearmanclient.setdata.php                          03-Dec-2023 00:02                3255
gearmanclient.setdatacallback.php                  03-Dec-2023 00:02                4696
gearmanclient.setexceptioncallback.php             03-Dec-2023 00:02                4616
gearmanclient.setfailcallback.php                  03-Dec-2023 00:02                4702
gearmanclient.setoptions.php                       03-Dec-2023 00:02                2486
gearmanclient.setstatuscallback.php                03-Dec-2023 00:02                4702
gearmanclient.settimeout.php                       03-Dec-2023 00:02                2530
gearmanclient.setwarningcallback.php               03-Dec-2023 00:02                4705
gearmanclient.setworkloadcallback.php              03-Dec-2023 00:02                4859
gearmanclient.timeout.php                          03-Dec-2023 00:02                2692
gearmanclient.wait.php                             03-Dec-2023 00:02                2635
gearmanjob.complete.php                            03-Dec-2023 00:02                3374
gearmanjob.construct.php                           03-Dec-2023 00:02                2318
gearmanjob.data.php                                03-Dec-2023 00:02                3334
gearmanjob.exception.php                           03-Dec-2023 00:02                3556
gearmanjob.fail.php                                03-Dec-2023 00:02                3551
gearmanjob.functionname.php                        03-Dec-2023 00:02                2788
gearmanjob.handle.php                              03-Dec-2023 00:02                2675
gearmanjob.returncode.php                          03-Dec-2023 00:02                2552
gearmanjob.sendcomplete.php                        03-Dec-2023 00:02                3095
gearmanjob.senddata.php                            03-Dec-2023 00:02                3062
gearmanjob.sendexception.php                       03-Dec-2023 00:02                3290
gearmanjob.sendfail.php                            03-Dec-2023 00:02                3270
gearmanjob.sendstatus.php                          03-Dec-2023 00:02                3753
gearmanjob.sendwarning.php                         03-Dec-2023 00:02                3286
gearmanjob.setreturn.php                           03-Dec-2023 00:02                2423
gearmanjob.status.php                              03-Dec-2023 00:02                4034
gearmanjob.unique.php                              03-Dec-2023 00:02                2927
gearmanjob.warning.php                             03-Dec-2023 00:02                3567
gearmanjob.workload.php                            03-Dec-2023 00:02                2763
gearmanjob.workloadsize.php                        03-Dec-2023 00:02                2568
gearmantask.construct.php                          03-Dec-2023 00:02                2343
gearmantask.create.php                             03-Dec-2023 00:02                2695
gearmantask.data.php                               03-Dec-2023 00:02                2649
gearmantask.datasize.php                           03-Dec-2023 00:02                2674
gearmantask.function.php                           03-Dec-2023 00:02                2568
gearmantask.functionname.php                       03-Dec-2023 00:02                2427
gearmantask.isknown.php                            03-Dec-2023 00:02                2279
gearmantask.isrunning.php                          03-Dec-2023 00:02                2279
gearmantask.jobhandle.php                          03-Dec-2023 00:02                2821
gearmantask.recvdata.php                           03-Dec-2023 00:02                3267
gearmantask.returncode.php                         03-Dec-2023 00:02                2579
gearmantask.senddata.php                           03-Dec-2023 00:02                3104
gearmantask.sendworkload.php                       03-Dec-2023 00:02                3227
gearmantask.taskdenominator.php                    03-Dec-2023 00:02                2867
gearmantask.tasknumerator.php                      03-Dec-2023 00:02                2839
gearmantask.unique.php                             03-Dec-2023 00:02                3097
gearmantask.uuid.php                               03-Dec-2023 00:02                3296
gearmanworker.addfunction.php                      03-Dec-2023 00:02                7589
gearmanworker.addoptions.php                       03-Dec-2023 00:02                3280
gearmanworker.addserver.php                        03-Dec-2023 00:02                4764
gearmanworker.addservers.php                       03-Dec-2023 00:02                4247
gearmanworker.clone.php                            03-Dec-2023 00:02                2274
gearmanworker.construct.php                        03-Dec-2023 00:02                2793
gearmanworker.echo.php                             03-Dec-2023 00:02                2902
gearmanworker.error.php                            03-Dec-2023 00:02                2709
gearmanworker.geterrno.php                         03-Dec-2023 00:02                2564
gearmanworker.options.php                          03-Dec-2023 00:02                2571
gearmanworker.register.php                         03-Dec-2023 00:02                3620
gearmanworker.removeoptions.php                    03-Dec-2023 00:02                3302
gearmanworker.returncode.php                       03-Dec-2023 00:02                2774
gearmanworker.setid.php                            03-Dec-2023 00:02                3812
gearmanworker.setoptions.php                       03-Dec-2023 00:02                3450
gearmanworker.settimeout.php                       03-Dec-2023 00:02                7625
gearmanworker.timeout.php                          03-Dec-2023 00:02                2671
gearmanworker.unregister.php                       03-Dec-2023 00:02                3238
gearmanworker.unregisterall.php                    03-Dec-2023 00:02                2949
gearmanworker.wait.php                             03-Dec-2023 00:02                7647
gearmanworker.work.php                             03-Dec-2023 00:02                5164
gender-gender.connect.php                          03-Dec-2023 00:02                2419
gender-gender.construct.php                        03-Dec-2023 00:02                2331
gender-gender.country.php                          03-Dec-2023 00:02                3558
gender-gender.get.php                              03-Dec-2023 00:02                2682
gender-gender.isnick.php                           03-Dec-2023 00:02                3128
gender-gender.similarnames.php                     03-Dec-2023 00:02                2795
gender.example.admin.php                           03-Dec-2023 00:02                8044
gender.examples.php                                03-Dec-2023 00:02                1337
gender.installation.php                            03-Dec-2023 00:02                2027
gender.setup.php                                   03-Dec-2023 00:02                1409
generator.current.php                              03-Dec-2023 00:02                2125
generator.getreturn.php                            03-Dec-2023 00:02                3839
generator.key.php                                  03-Dec-2023 00:02                3894
generator.next.php                                 03-Dec-2023 00:02                2340
generator.rewind.php                               03-Dec-2023 00:02                2157
generator.send.php                                 03-Dec-2023 00:02                5552
generator.throw.php                                03-Dec-2023 00:02                5060
generator.valid.php                                03-Dec-2023 00:02                2129
generator.wakeup.php                               03-Dec-2023 00:02                2165
geoip.configuration.php                            03-Dec-2023 00:02                2452
geoip.constants.php                                03-Dec-2023 00:02                4513
geoip.installation.php                             03-Dec-2023 00:02                1784
geoip.requirements.php                             03-Dec-2023 00:02                1754
geoip.resources.php                                03-Dec-2023 00:02                1240
geoip.setup.php                                    03-Dec-2023 00:02                1620
gettext.configuration.php                          03-Dec-2023 00:02                1319
gettext.constants.php                              03-Dec-2023 00:02                1172
gettext.installation.php                           03-Dec-2023 00:02                1483
gettext.requirements.php                           03-Dec-2023 00:02                1439
gettext.resources.php                              03-Dec-2023 00:02                1257
gettext.setup.php                                  03-Dec-2023 00:02                1667
getting-started.php                                03-Dec-2023 00:02                1957
globiterator.construct.php                         03-Dec-2023 00:02                7559
globiterator.count.php                             03-Dec-2023 00:02                4320
gmagick.addimage.php                               03-Dec-2023 00:02                2838
gmagick.addnoiseimage.php                          03-Dec-2023 00:02                2835
gmagick.annotateimage.php                          03-Dec-2023 00:02                4210
gmagick.blurimage.php                              03-Dec-2023 00:02                3119
gmagick.borderimage.php                            03-Dec-2023 00:02                3630
gmagick.charcoalimage.php                          03-Dec-2023 00:02                3127
gmagick.chopimage.php                              03-Dec-2023 00:02                3671
gmagick.clear.php                                  03-Dec-2023 00:02                2581
gmagick.commentimage.php                           03-Dec-2023 00:02                2780
gmagick.compositeimage.php                         03-Dec-2023 00:02                3892
gmagick.configuration.php                          03-Dec-2023 00:02                1331
gmagick.constants.php                              03-Dec-2023 00:02               68554
gmagick.construct.php                              03-Dec-2023 00:02                2536
gmagick.cropimage.php                              03-Dec-2023 00:02                3806
gmagick.cropthumbnailimage.php                     03-Dec-2023 00:02                3164
gmagick.current.php                                03-Dec-2023 00:02                2482
gmagick.cyclecolormapimage.php                     03-Dec-2023 00:02                2908
gmagick.deconstructimages.php                      03-Dec-2023 00:02                2730
gmagick.despeckleimage.php                         03-Dec-2023 00:02                3389
gmagick.destroy.php                                03-Dec-2023 00:02                2552
gmagick.drawimage.php                              03-Dec-2023 00:02                2962
gmagick.edgeimage.php                              03-Dec-2023 00:02                2851
gmagick.embossimage.php                            03-Dec-2023 00:02                3305
gmagick.enhanceimage.php                           03-Dec-2023 00:02                2592
gmagick.equalizeimage.php                          03-Dec-2023 00:02                2551
gmagick.examples.php                               03-Dec-2023 00:02                3379
gmagick.flipimage.php                              03-Dec-2023 00:02                2904
gmagick.flopimage.php                              03-Dec-2023 00:02                2901
gmagick.frameimage.php                             03-Dec-2023 00:02                4347
gmagick.gammaimage.php                             03-Dec-2023 00:02                3062
gmagick.getcopyright.php                           03-Dec-2023 00:02                2513
gmagick.getfilename.php                            03-Dec-2023 00:02                2463
gmagick.getimagebackgroundcolor.php                03-Dec-2023 00:02                2660
gmagick.getimageblueprimary.php                    03-Dec-2023 00:02                2914
gmagick.getimagebordercolor.php                    03-Dec-2023 00:02                2704
gmagick.getimagechanneldepth.php                   03-Dec-2023 00:02                2649
gmagick.getimagecolors.php                         03-Dec-2023 00:02                2501
gmagick.getimagecolorspace.php                     03-Dec-2023 00:02                2459
gmagick.getimagecompose.php                        03-Dec-2023 00:02                2539
gmagick.getimagedelay.php                          03-Dec-2023 00:02                2436
gmagick.getimagedepth.php                          03-Dec-2023 00:02                2406
gmagick.getimagedispose.php                        03-Dec-2023 00:02                2460
gmagick.getimageextrema.php                        03-Dec-2023 00:02                2684
gmagick.getimagefilename.php                       03-Dec-2023 00:02                2542
gmagick.getimageformat.php                         03-Dec-2023 00:02                2525
gmagick.getimagegamma.php                          03-Dec-2023 00:02                2427
gmagick.getimagegreenprimary.php                   03-Dec-2023 00:02                2646
gmagick.getimageheight.php                         03-Dec-2023 00:02                2458
gmagick.getimagehistogram.php                      03-Dec-2023 00:02                2819
gmagick.getimageindex.php                          03-Dec-2023 00:02                2589
gmagick.getimageinterlacescheme.php                03-Dec-2023 00:02                2577
gmagick.getimageiterations.php                     03-Dec-2023 00:02                2504
gmagick.getimagematte.php                          03-Dec-2023 00:02                2638
gmagick.getimagemattecolor.php                     03-Dec-2023 00:02                2610
gmagick.getimageprofile.php                        03-Dec-2023 00:02                2597
gmagick.getimageredprimary.php                     03-Dec-2023 00:02                2667
gmagick.getimagerenderingintent.php                03-Dec-2023 00:02                2588
gmagick.getimageresolution.php                     03-Dec-2023 00:02                2520
gmagick.getimagescene.php                          03-Dec-2023 00:02                2423
gmagick.getimagesignature.php                      03-Dec-2023 00:02                2536
gmagick.getimagetype.php                           03-Dec-2023 00:02                2430
gmagick.getimageunits.php                          03-Dec-2023 00:02                2191
gmagick.getimagewhitepoint.php                     03-Dec-2023 00:02                2643
gmagick.getimagewidth.php                          03-Dec-2023 00:02                2437
gmagick.getpackagename.php                         03-Dec-2023 00:02                2489
gmagick.getquantumdepth.php                        03-Dec-2023 00:02                2668
gmagick.getreleasedate.php                         03-Dec-2023 00:02                2523
gmagick.getsamplingfactors.php                     03-Dec-2023 00:02                2578
gmagick.getsize.php                                03-Dec-2023 00:02                2727
gmagick.getversion.php                             03-Dec-2023 00:02                2468
gmagick.hasnextimage.php                           03-Dec-2023 00:02                2770
gmagick.haspreviousimage.php                       03-Dec-2023 00:02                2814
gmagick.implodeimage.php                           03-Dec-2023 00:02                2932
gmagick.installation.php                           03-Dec-2023 00:02                2004
gmagick.labelimage.php                             03-Dec-2023 00:02                2699
gmagick.levelimage.php                             03-Dec-2023 00:02                4490
gmagick.magnifyimage.php                           03-Dec-2023 00:02                2618
gmagick.mapimage.php                               03-Dec-2023 00:02                3199
gmagick.medianfilterimage.php                      03-Dec-2023 00:02                2955
gmagick.minifyimage.php                            03-Dec-2023 00:02                2611
gmagick.modulateimage.php                          03-Dec-2023 00:02                3701
gmagick.motionblurimage.php                        03-Dec-2023 00:02                3726
gmagick.newimage.php                               03-Dec-2023 00:02                3690
gmagick.nextimage.php                              03-Dec-2023 00:02                2573
gmagick.normalizeimage.php                         03-Dec-2023 00:02                2936
gmagick.oilpaintimage.php                          03-Dec-2023 00:02                2952
gmagick.previousimage.php                          03-Dec-2023 00:02                2568
gmagick.profileimage.php                           03-Dec-2023 00:02                3350
gmagick.quantizeimage.php                          03-Dec-2023 00:02                5061
gmagick.quantizeimages.php                         03-Dec-2023 00:02                5064
gmagick.queryfontmetrics.php                       03-Dec-2023 00:02                2786
gmagick.queryfonts.php                             03-Dec-2023 00:02                2562
gmagick.queryformats.php                           03-Dec-2023 00:02                2910
gmagick.radialblurimage.php                        03-Dec-2023 00:02                3102
gmagick.raiseimage.php                             03-Dec-2023 00:02                4130
gmagick.read.php                                   03-Dec-2023 00:02                2673
gmagick.readimage.php                              03-Dec-2023 00:02                2723
gmagick.readimageblob.php                          03-Dec-2023 00:02                3090
gmagick.readimagefile.php                          03-Dec-2023 00:02                2959
gmagick.reducenoiseimage.php                       03-Dec-2023 00:02                3130
gmagick.removeimage.php                            03-Dec-2023 00:02                2559
gmagick.removeimageprofile.php                     03-Dec-2023 00:02                2775
gmagick.requirements.php                           03-Dec-2023 00:02                1714
gmagick.resampleimage.php                          03-Dec-2023 00:02                3697
gmagick.resizeimage.php                            03-Dec-2023 00:02                3923
gmagick.rollimage.php                              03-Dec-2023 00:02                2881
gmagick.rotateimage.php                            03-Dec-2023 00:02                3155
gmagick.scaleimage.php                             03-Dec-2023 00:02                3313
gmagick.separateimagechannel.php                   03-Dec-2023 00:02                3122
gmagick.setcompressionquality.php                  03-Dec-2023 00:02                4129
gmagick.setfilename.php                            03-Dec-2023 00:02                2853
gmagick.setimagebackgroundcolor.php                03-Dec-2023 00:02                2982
gmagick.setimageblueprimary.php                    03-Dec-2023 00:02                3164
gmagick.setimagebordercolor.php                    03-Dec-2023 00:02                2944
gmagick.setimagechanneldepth.php                   03-Dec-2023 00:02                3311
gmagick.setimagecolorspace.php                     03-Dec-2023 00:02                3007
gmagick.setimagecompose.php                        03-Dec-2023 00:02                2773
gmagick.setimagedelay.php                          03-Dec-2023 00:02                2787
gmagick.setimagedepth.php                          03-Dec-2023 00:02                2785
gmagick.setimagedispose.php                        03-Dec-2023 00:02                2829
gmagick.setimagefilename.php                       03-Dec-2023 00:02                2877
gmagick.setimageformat.php                         03-Dec-2023 00:02                2840
gmagick.setimagegamma.php                          03-Dec-2023 00:02                2779
gmagick.setimagegreenprimary.php                   03-Dec-2023 00:02                3172
gmagick.setimageindex.php                          03-Dec-2023 00:02                2926
gmagick.setimageinterlacescheme.php                03-Dec-2023 00:02                3073
gmagick.setimageiterations.php                     03-Dec-2023 00:02                2882
gmagick.setimageprofile.php                        03-Dec-2023 00:02                3257
gmagick.setimageredprimary.php                     03-Dec-2023 00:02                3075
gmagick.setimagerenderingintent.php                03-Dec-2023 00:02                3104
gmagick.setimageresolution.php                     03-Dec-2023 00:02                3069
gmagick.setimagescene.php                          03-Dec-2023 00:02                2775
gmagick.setimagetype.php                           03-Dec-2023 00:02                2900
gmagick.setimageunits.php                          03-Dec-2023 00:02                2959
gmagick.setimagewhitepoint.php                     03-Dec-2023 00:02                3101
gmagick.setsamplingfactors.php                     03-Dec-2023 00:02                2943
gmagick.setsize.php                                03-Dec-2023 00:02                3208
gmagick.setup.php                                  03-Dec-2023 00:02                1585
gmagick.shearimage.php                             03-Dec-2023 00:02                3844
gmagick.solarizeimage.php                          03-Dec-2023 00:02                3033
gmagick.spreadimage.php                            03-Dec-2023 00:02                2877
gmagick.stripimage.php                             03-Dec-2023 00:02                2539
gmagick.swirlimage.php                             03-Dec-2023 00:02                2958
gmagick.thumbnailimage.php                         03-Dec-2023 00:02                3573
gmagick.trimimage.php                              03-Dec-2023 00:02                3022
gmagick.write.php                                  03-Dec-2023 00:02                1702
gmagick.writeimage.php                             03-Dec-2023 00:02                3270
gmagickdraw.annotate.php                           03-Dec-2023 00:02                3000
gmagickdraw.arc.php                                03-Dec-2023 00:02                4000
gmagickdraw.bezier.php                             03-Dec-2023 00:02                2549
gmagickdraw.ellipse.php                            03-Dec-2023 00:02                3921
gmagickdraw.getfillcolor.php                       03-Dec-2023 00:02                2419
gmagickdraw.getfillopacity.php                     03-Dec-2023 00:02                2312
gmagickdraw.getfont.php                            03-Dec-2023 00:02                2350
gmagickdraw.getfontsize.php                        03-Dec-2023 00:02                2354
gmagickdraw.getfontstyle.php                       03-Dec-2023 00:02                2430
gmagickdraw.getfontweight.php                      03-Dec-2023 00:02                2275
gmagickdraw.getstrokecolor.php                     03-Dec-2023 00:02                2474
gmagickdraw.getstrokeopacity.php                   03-Dec-2023 00:02                2331
gmagickdraw.getstrokewidth.php                     03-Dec-2023 00:02                2350
gmagickdraw.gettextdecoration.php                  03-Dec-2023 00:02                2342
gmagickdraw.gettextencoding.php                    03-Dec-2023 00:02                2478
gmagickdraw.line.php                               03-Dec-2023 00:02                3392
gmagickdraw.point.php                              03-Dec-2023 00:02                2787
gmagickdraw.polygon.php                            03-Dec-2023 00:02                2616
gmagickdraw.polyline.php                           03-Dec-2023 00:02                2651
gmagickdraw.rectangle.php                          03-Dec-2023 00:02                3496
gmagickdraw.rotate.php                             03-Dec-2023 00:02                2607
gmagickdraw.roundrectangle.php                     03-Dec-2023 00:02                4165
gmagickdraw.scale.php                              03-Dec-2023 00:02                2851
gmagickdraw.setfillcolor.php                       03-Dec-2023 00:02                2906
gmagickdraw.setfillopacity.php                     03-Dec-2023 00:02                2705
gmagickdraw.setfont.php                            03-Dec-2023 00:02                2603
gmagickdraw.setfontsize.php                        03-Dec-2023 00:02                2635
gmagickdraw.setfontstyle.php                       03-Dec-2023 00:02                2766
gmagickdraw.setfontweight.php                      03-Dec-2023 00:02                2637
gmagickdraw.setstrokecolor.php                     03-Dec-2023 00:02                2930
gmagickdraw.setstrokeopacity.php                   03-Dec-2023 00:02                2723
gmagickdraw.setstrokewidth.php                     03-Dec-2023 00:02                2683
gmagickdraw.settextdecoration.php                  03-Dec-2023 00:02                2769
gmagickdraw.settextencoding.php                    03-Dec-2023 00:02                2975
gmagickpixel.construct.php                         03-Dec-2023 00:02                2477
gmagickpixel.getcolor.php                          03-Dec-2023 00:02                3643
gmagickpixel.getcolorcount.php                     03-Dec-2023 00:02                2403
gmagickpixel.getcolorvalue.php                     03-Dec-2023 00:02                2755
gmagickpixel.setcolor.php                          03-Dec-2023 00:02                2942
gmagickpixel.setcolorvalue.php                     03-Dec-2023 00:02                3169
gmp.configuration.php                              03-Dec-2023 00:02                1303
gmp.constants.php                                  03-Dec-2023 00:02                2068
gmp.examples.php                                   03-Dec-2023 00:02                3039
gmp.installation.php                               03-Dec-2023 00:02                1397
gmp.requirements.php                               03-Dec-2023 00:02                1759
gmp.setup.php                                      03-Dec-2023 00:02                1547
gnupg.configuration.php                            03-Dec-2023 00:02                1300
gnupg.constants.php                                03-Dec-2023 00:02                6367
gnupg.examples-clearsign.php                       03-Dec-2023 00:02                6311
gnupg.examples.php                                 03-Dec-2023 00:02                1341
gnupg.installation.php                             03-Dec-2023 00:02                1630
gnupg.requirements.php                             03-Dec-2023 00:02                1318
gnupg.resources.php                                03-Dec-2023 00:02                1240
gnupg.setup.php                                    03-Dec-2023 00:02                1638
hash.configuration.php                             03-Dec-2023 00:02                1295
hash.constants.php                                 03-Dec-2023 00:02                1708
hash.installation.php                              03-Dec-2023 00:02                1675
hash.requirements.php                              03-Dec-2023 00:02                1267
hash.resources.php                                 03-Dec-2023 00:02                1346
hash.setup.php                                     03-Dec-2023 00:02                1619
hashcontext.construct.php                          03-Dec-2023 00:02                1888
hashcontext.serialize.php                          03-Dec-2023 00:02                2306
hashcontext.unserialize.php                        03-Dec-2023 00:02                2604
history.php                                        03-Dec-2023 00:02                2238
history.php.books.php                              03-Dec-2023 00:02                2621
history.php.php                                    03-Dec-2023 00:02               11460
history.php.publications.php                       03-Dec-2023 00:02                1836
history.php.related.php                            03-Dec-2023 00:02                6184
hrtime-performancecounter.getfrequency.php         03-Dec-2023 00:02                2601
hrtime-performancecounter.getticks.php             03-Dec-2023 00:02                2474
hrtime-performancecounter.gettickssince.php        03-Dec-2023 00:02                2726
hrtime-stopwatch.getelapsedticks.php               03-Dec-2023 00:02                2376
hrtime-stopwatch.getelapsedtime.php                03-Dec-2023 00:02                2721
hrtime-stopwatch.getlastelapsedticks.php           03-Dec-2023 00:02                2444
hrtime-stopwatch.getlastelapsedtime.php            03-Dec-2023 00:02                2745
hrtime-stopwatch.isrunning.php                     03-Dec-2023 00:02                2335
hrtime-stopwatch.start.php                         03-Dec-2023 00:02                2329
hrtime-stopwatch.stop.php                          03-Dec-2023 00:02                2208
hrtime.example.basic.php                           03-Dec-2023 00:02                5422
hrtime.examples.php                                03-Dec-2023 00:02                1331
hrtime.installation.php                            03-Dec-2023 00:02                2027
hrtime.setup.php                                   03-Dec-2023 00:02                1406
ibase.configuration.php                            03-Dec-2023 00:02                7205
ibase.constants.php                                03-Dec-2023 00:02               15101
ibase.installation.php                             03-Dec-2023 00:02                2699
ibase.requirements.php                             03-Dec-2023 00:02                1250
ibase.resources.php                                03-Dec-2023 00:02                1243
ibase.setup.php                                    03-Dec-2023 00:02                1659
ibm-db2.configuration.php                          03-Dec-2023 00:02                9368
ibm-db2.constants.php                              03-Dec-2023 00:02                6855
ibm-db2.installation.php                           03-Dec-2023 00:02                3625
ibm-db2.requirements.php                           03-Dec-2023 00:02                3257
ibm-db2.resources.php                              03-Dec-2023 00:02                1307
ibm-db2.setup.php                                  03-Dec-2023 00:02                1668
iconv.configuration.php                            03-Dec-2023 00:02                4561
iconv.constants.php                                03-Dec-2023 00:02                3233
iconv.installation.php                             03-Dec-2023 00:02                1622
iconv.requirements.php                             03-Dec-2023 00:02                1559
iconv.resources.php                                03-Dec-2023 00:02                1243
iconv.setup.php                                    03-Dec-2023 00:02                1646
igbinary.configuration.php                         03-Dec-2023 00:02                3357
igbinary.installation.php                          03-Dec-2023 00:02                2042
igbinary.requirements.php                          03-Dec-2023 00:02                1268
igbinary.setup.php                                 03-Dec-2023 00:02                1592
image.configuration.php                            03-Dec-2023 00:02                3384
image.constants.php                                03-Dec-2023 00:02               41172
image.examples-png.php                             03-Dec-2023 00:02                4692
image.examples-watermark.php                       03-Dec-2023 00:02                5765
image.examples.merged-watermark.php                03-Dec-2023 00:02                8537
image.examples.php                                 03-Dec-2023 00:02                1557
image.installation.php                             03-Dec-2023 00:02                5976
image.requirements.php                             03-Dec-2023 00:02                4154
image.resources.php                                03-Dec-2023 00:02                2077
image.setup.php                                    03-Dec-2023 00:02                1641
imagick.adaptiveblurimage.php                      03-Dec-2023 00:02                6661
imagick.adaptiveresizeimage.php                    03-Dec-2023 00:02                8792
imagick.adaptivesharpenimage.php                   03-Dec-2023 00:02                6150
imagick.adaptivethresholdimage.php                 03-Dec-2023 00:02                5939
imagick.addimage.php                               03-Dec-2023 00:02                2790
imagick.addnoiseimage.php                          03-Dec-2023 00:02                5291
imagick.affinetransformimage.php                   03-Dec-2023 00:02                6501
imagick.animateimages.php                          03-Dec-2023 00:02                3021
imagick.annotateimage.php                          03-Dec-2023 00:02                8354
imagick.appendimages.php                           03-Dec-2023 00:02                6504
imagick.autolevelimage.php                         03-Dec-2023 00:02                4274
imagick.averageimages.php                          03-Dec-2023 00:02                2698
imagick.blackthresholdimage.php                    03-Dec-2023 00:02                5203
imagick.blueshiftimage.php                         03-Dec-2023 00:02                4319
imagick.blurimage.php                              03-Dec-2023 00:02                5509
imagick.borderimage.php                            03-Dec-2023 00:02                5845
imagick.brightnesscontrastimage.php                03-Dec-2023 00:02                5371
imagick.charcoalimage.php                          03-Dec-2023 00:02                4758
imagick.chopimage.php                              03-Dec-2023 00:02                6680
imagick.clampimage.php                             03-Dec-2023 00:02                2484
imagick.clear.php                                  03-Dec-2023 00:02                2140
imagick.clipimage.php                              03-Dec-2023 00:02                2384
imagick.clipimagepath.php                          03-Dec-2023 00:02                2981
imagick.clippathimage.php                          03-Dec-2023 00:02                3226
imagick.clone.php                                  03-Dec-2023 00:02                4102
imagick.clutimage.php                              03-Dec-2023 00:02                5917
imagick.coalesceimages.php                         03-Dec-2023 00:02                2786
imagick.colorfloodfillimage.php                    03-Dec-2023 00:02                5235
imagick.colorizeimage.php                          03-Dec-2023 00:02                6714
imagick.colormatriximage.php                       03-Dec-2023 00:02                7442
imagick.combineimages.php                          03-Dec-2023 00:02                3235
imagick.commentimage.php                           03-Dec-2023 00:02                4786
imagick.compareimagechannels.php                   03-Dec-2023 00:02                3765
imagick.compareimagelayers.php                     03-Dec-2023 00:02                5415
imagick.compareimages.php                          03-Dec-2023 00:02                5514
imagick.compositeimage.php                         03-Dec-2023 00:02                7679
imagick.configuration.php                          03-Dec-2023 00:02                4094
imagick.constants.php                              03-Dec-2023 00:02              113196
imagick.construct.php                              03-Dec-2023 00:02                2608
imagick.contrastimage.php                          03-Dec-2023 00:02                4848
imagick.contraststretchimage.php                   03-Dec-2023 00:02                3622
imagick.convolveimage.php                          03-Dec-2023 00:02                5711
imagick.count.php                                  03-Dec-2023 00:02                2576
imagick.cropimage.php                              03-Dec-2023 00:02                5804
imagick.cropthumbnailimage.php                     03-Dec-2023 00:02                3181
imagick.current.php                                03-Dec-2023 00:02                2447
imagick.cyclecolormapimage.php                     03-Dec-2023 00:02                2815
imagick.decipherimage.php                          03-Dec-2023 00:02                3113
imagick.deconstructimages.php                      03-Dec-2023 00:02                2602
imagick.deleteimageartifact.php                    03-Dec-2023 00:02                3533
imagick.deleteimageproperty.php                    03-Dec-2023 00:02                2464
imagick.deskewimage.php                            03-Dec-2023 00:02               10907
imagick.despeckleimage.php                         03-Dec-2023 00:02                4127
imagick.destroy.php                                03-Dec-2023 00:02                2278
imagick.displayimage.php                           03-Dec-2023 00:02                2614
imagick.displayimages.php                          03-Dec-2023 00:02                2658
imagick.distortimage.php                           03-Dec-2023 00:02               11569
imagick.drawimage.php                              03-Dec-2023 00:02                2512
imagick.edgeimage.php                              03-Dec-2023 00:02                4487
imagick.embossimage.php                            03-Dec-2023 00:02                5130
imagick.encipherimage.php                          03-Dec-2023 00:02                3109
imagick.enhanceimage.php                           03-Dec-2023 00:02                4094
imagick.equalizeimage.php                          03-Dec-2023 00:02                4061
imagick.evaluateimage.php                          03-Dec-2023 00:02                5633
imagick.examples-1.php                             03-Dec-2023 00:02               29846
imagick.examples.php                               03-Dec-2023 00:02                1343
imagick.exportimagepixels.php                      03-Dec-2023 00:02                7518
imagick.extentimage.php                            03-Dec-2023 00:02                4979
imagick.filter.php                                 03-Dec-2023 00:02                7369
imagick.flattenimages.php                          03-Dec-2023 00:02                2760
imagick.flipimage.php                              03-Dec-2023 00:02                4409
imagick.floodfillpaintimage.php                    03-Dec-2023 00:02               11203
imagick.flopimage.php                              03-Dec-2023 00:02                4441
imagick.forwardfouriertransformimage.php           03-Dec-2023 00:02               11905
imagick.frameimage.php                             03-Dec-2023 00:02                8016
imagick.functionimage.php                          03-Dec-2023 00:02               13437
imagick.fximage.php                                03-Dec-2023 00:02                5868
imagick.gammaimage.php                             03-Dec-2023 00:02                5472
imagick.gaussianblurimage.php                      03-Dec-2023 00:02                5954
imagick.getcolorspace.php                          03-Dec-2023 00:02                2392
imagick.getcompression.php                         03-Dec-2023 00:02                2197
imagick.getcompressionquality.php                  03-Dec-2023 00:02                2271
imagick.getcopyright.php                           03-Dec-2023 00:02                2298
imagick.getfilename.php                            03-Dec-2023 00:02                2364
imagick.getfont.php                                03-Dec-2023 00:02                3015
imagick.getformat.php                              03-Dec-2023 00:02                2326
imagick.getgravity.php                             03-Dec-2023 00:02                2371
imagick.gethomeurl.php                             03-Dec-2023 00:02                2175
imagick.getimage.php                               03-Dec-2023 00:02                2428
imagick.getimagealphachannel.php                   03-Dec-2023 00:02                3235
imagick.getimageartifact.php                       03-Dec-2023 00:02                3474
imagick.getimageattribute.php                      03-Dec-2023 00:02                2674
imagick.getimagebackgroundcolor.php                03-Dec-2023 00:02                2594
imagick.getimageblob.php                           03-Dec-2023 00:02                2620
imagick.getimageblueprimary.php                    03-Dec-2023 00:02                2823
imagick.getimagebordercolor.php                    03-Dec-2023 00:02                2559
imagick.getimagechanneldepth.php                   03-Dec-2023 00:02                2983
imagick.getimagechanneldistortion.php              03-Dec-2023 00:02                3857
imagick.getimagechanneldistortions.php             03-Dec-2023 00:02                4214
imagick.getimagechannelextrema.php                 03-Dec-2023 00:02                3459
imagick.getimagechannelkurtosis.php                03-Dec-2023 00:02                3457
imagick.getimagechannelmean.php                    03-Dec-2023 00:02                3127
imagick.getimagechannelrange.php                   03-Dec-2023 00:02                3310
imagick.getimagechannelstatistics.php              03-Dec-2023 00:02                2484
imagick.getimageclipmask.php                       03-Dec-2023 00:02                2971
imagick.getimagecolormapcolor.php                  03-Dec-2023 00:02                2842
imagick.getimagecolors.php                         03-Dec-2023 00:02                2283
imagick.getimagecolorspace.php                     03-Dec-2023 00:02                2324
imagick.getimagecompose.php                        03-Dec-2023 00:02                2290
imagick.getimagecompression.php                    03-Dec-2023 00:02                2285
imagick.getimagecompressionquality.php             03-Dec-2023 00:02                2379
imagick.getimagedelay.php                          03-Dec-2023 00:02                2359
imagick.getimagedepth.php                          03-Dec-2023 00:02                2130
imagick.getimagedispose.php                        03-Dec-2023 00:02                2399
imagick.getimagedistortion.php                     03-Dec-2023 00:02                3173
imagick.getimageextrema.php                        03-Dec-2023 00:02                2803
imagick.getimagefilename.php                       03-Dec-2023 00:02                2471
imagick.getimageformat.php                         03-Dec-2023 00:02                2453
imagick.getimagegamma.php                          03-Dec-2023 00:02                2354
imagick.getimagegeometry.php                       03-Dec-2023 00:02                4040
imagick.getimagegravity.php                        03-Dec-2023 00:02                2664
imagick.getimagegreenprimary.php                   03-Dec-2023 00:02                2624
imagick.getimageheight.php                         03-Dec-2023 00:02                2385
imagick.getimagehistogram.php                      03-Dec-2023 00:02               17116
imagick.getimageindex.php                          03-Dec-2023 00:02                2910
imagick.getimageinterlacescheme.php                03-Dec-2023 00:02                2441
imagick.getimageinterpolatemethod.php              03-Dec-2023 00:02                2658
imagick.getimageiterations.php                     03-Dec-2023 00:02                2447
imagick.getimagelength.php                         03-Dec-2023 00:02                3301
imagick.getimagematte.php                          03-Dec-2023 00:02                2673
imagick.getimagemattecolor.php                     03-Dec-2023 00:02                2776
imagick.getimagemimetype.php                       03-Dec-2023 00:02                2193
imagick.getimageorientation.php                    03-Dec-2023 00:02                2551
imagick.getimagepage.php                           03-Dec-2023 00:02                2616
imagick.getimagepixelcolor.php                     03-Dec-2023 00:02                3031
imagick.getimageprofile.php                        03-Dec-2023 00:02                2667
imagick.getimageprofiles.php                       03-Dec-2023 00:02                3228
imagick.getimageproperties.php                     03-Dec-2023 00:02                5472
imagick.getimageproperty.php                       03-Dec-2023 00:02                4843
imagick.getimageredprimary.php                     03-Dec-2023 00:02                2711
imagick.getimageregion.php                         03-Dec-2023 00:02                3723
imagick.getimagerenderingintent.php                03-Dec-2023 00:02                2575
imagick.getimageresolution.php                     03-Dec-2023 00:02                2451
imagick.getimagesblob.php                          03-Dec-2023 00:02                2453
imagick.getimagescene.php                          03-Dec-2023 00:02                2341
imagick.getimagesignature.php                      03-Dec-2023 00:02                2468
imagick.getimagesize.php                           03-Dec-2023 00:02                2579
imagick.getimagetickspersecond.php                 03-Dec-2023 00:02                2487
imagick.getimagetotalinkdensity.php                03-Dec-2023 00:02                2427
imagick.getimagetype.php                           03-Dec-2023 00:02                3977
imagick.getimageunits.php                          03-Dec-2023 00:02                2403
imagick.getimagevirtualpixelmethod.php             03-Dec-2023 00:02                2554
imagick.getimagewhitepoint.php                     03-Dec-2023 00:02                2604
imagick.getimagewidth.php                          03-Dec-2023 00:02                2359
imagick.getinterlacescheme.php                     03-Dec-2023 00:02                2505
imagick.getiteratorindex.php                       03-Dec-2023 00:02                6075
imagick.getnumberimages.php                        03-Dec-2023 00:02                2454
imagick.getoption.php                              03-Dec-2023 00:02                2641
imagick.getpackagename.php                         03-Dec-2023 00:02                2425
imagick.getpage.php                                03-Dec-2023 00:02                2431
imagick.getpixeliterator.php                       03-Dec-2023 00:02                5960
imagick.getpixelregioniterator.php                 03-Dec-2023 00:02                6493
imagick.getpointsize.php                           03-Dec-2023 00:02                2697
imagick.getquantum.php                             03-Dec-2023 00:02                2223
imagick.getquantumdepth.php                        03-Dec-2023 00:02                2538
imagick.getquantumrange.php                        03-Dec-2023 00:02                2682
imagick.getregistry.php                            03-Dec-2023 00:02                2381
imagick.getreleasedate.php                         03-Dec-2023 00:02                2449
imagick.getresource.php                            03-Dec-2023 00:02                2802
imagick.getresourcelimit.php                       03-Dec-2023 00:02                3234
imagick.getsamplingfactors.php                     03-Dec-2023 00:02                2515
imagick.getsize.php                                03-Dec-2023 00:02                5725
imagick.getsizeoffset.php                          03-Dec-2023 00:02                2521
imagick.getversion.php                             03-Dec-2023 00:02                2437
imagick.haldclutimage.php                          03-Dec-2023 00:02                5873
imagick.hasnextimage.php                           03-Dec-2023 00:02                2418
imagick.haspreviousimage.php                       03-Dec-2023 00:02                2456
imagick.identifyformat.php                         03-Dec-2023 00:02                4250
imagick.identifyimage.php                          03-Dec-2023 00:02                3829
imagick.implodeimage.php                           03-Dec-2023 00:02                4477
imagick.importimagepixels.php                      03-Dec-2023 00:02               10905
imagick.installation.php                           03-Dec-2023 00:02                3039
imagick.inversefouriertransformimage.php           03-Dec-2023 00:02                3315
imagick.labelimage.php                             03-Dec-2023 00:02                2408
imagick.levelimage.php                             03-Dec-2023 00:02                7430
imagick.linearstretchimage.php                     03-Dec-2023 00:02                5441
imagick.liquidrescaleimage.php                     03-Dec-2023 00:02                4212
imagick.listregistry.php                           03-Dec-2023 00:02                2282
imagick.magnifyimage.php                           03-Dec-2023 00:02                4093
imagick.mapimage.php                               03-Dec-2023 00:02                3068
imagick.mattefloodfillimage.php                    03-Dec-2023 00:02                5473
imagick.medianfilterimage.php                      03-Dec-2023 00:02                4955
imagick.mergeimagelayers.php                       03-Dec-2023 00:02                6411
imagick.minifyimage.php                            03-Dec-2023 00:02                2258
imagick.modulateimage.php                          03-Dec-2023 00:02                5335
imagick.montageimage.php                           03-Dec-2023 00:02                4325
imagick.morphimages.php                            03-Dec-2023 00:02                2740
imagick.morphology.php                             03-Dec-2023 00:02               66270
imagick.mosaicimages.php                           03-Dec-2023 00:02                2656
imagick.motionblurimage.php                        03-Dec-2023 00:02                6452
imagick.negateimage.php                            03-Dec-2023 00:02                5321
imagick.newimage.php                               03-Dec-2023 00:02                6036
imagick.newpseudoimage.php                         03-Dec-2023 00:02                5524
imagick.nextimage.php                              03-Dec-2023 00:02                2190
imagick.normalizeimage.php                         03-Dec-2023 00:02                6216
imagick.oilpaintimage.php                          03-Dec-2023 00:02                4421
imagick.opaquepaintimage.php                       03-Dec-2023 00:02                4753
imagick.optimizeimagelayers.php                    03-Dec-2023 00:02                5255
imagick.orderedposterizeimage.php                  03-Dec-2023 00:02                6593
imagick.paintfloodfillimage.php                    03-Dec-2023 00:02                5461
imagick.paintopaqueimage.php                       03-Dec-2023 00:02                5237
imagick.painttransparentimage.php                  03-Dec-2023 00:02                4457
imagick.pingimage.php                              03-Dec-2023 00:02                2530
imagick.pingimageblob.php                          03-Dec-2023 00:02                5873
imagick.pingimagefile.php                          03-Dec-2023 00:02                5645
imagick.polaroidimage.php                          03-Dec-2023 00:02                4593
imagick.posterizeimage.php                         03-Dec-2023 00:02                5399
imagick.previewimages.php                          03-Dec-2023 00:02                2938
imagick.previousimage.php                          03-Dec-2023 00:02                2245
imagick.profileimage.php                           03-Dec-2023 00:02                3062
imagick.quantizeimage.php                          03-Dec-2023 00:02                6298
imagick.quantizeimages.php                         03-Dec-2023 00:02                3637
imagick.queryfontmetrics.php                       03-Dec-2023 00:02                5395
imagick.queryfonts.php                             03-Dec-2023 00:02                4592
imagick.queryformats.php                           03-Dec-2023 00:02                6967
imagick.radialblurimage.php                        03-Dec-2023 00:02                5299
imagick.raiseimage.php                             03-Dec-2023 00:02                6121
imagick.randomthresholdimage.php                   03-Dec-2023 00:02                6163
imagick.readimage.php                              03-Dec-2023 00:02                2372
imagick.readimageblob.php                          03-Dec-2023 00:02                5193
imagick.readimagefile.php                          03-Dec-2023 00:02                2911
imagick.readimages.php                             03-Dec-2023 00:02                2421
imagick.recolorimage.php                           03-Dec-2023 00:02                6191
imagick.reducenoiseimage.php                       03-Dec-2023 00:02                5005
imagick.remapimage.php                             03-Dec-2023 00:02                3295
imagick.removeimage.php                            03-Dec-2023 00:02                2390
imagick.removeimageprofile.php                     03-Dec-2023 00:02                2662
imagick.render.php                                 03-Dec-2023 00:02                2153
imagick.requirements.php                           03-Dec-2023 00:02                1597
imagick.resampleimage.php                          03-Dec-2023 00:02                5285
imagick.resetimagepage.php                         03-Dec-2023 00:02                2648
imagick.resizeimage.php                            03-Dec-2023 00:02               10743
imagick.resources.php                              03-Dec-2023 00:02                1254
imagick.rollimage.php                              03-Dec-2023 00:02                4565
imagick.rotateimage.php                            03-Dec-2023 00:02                5539
imagick.rotationalblurimage.php                    03-Dec-2023 00:02                5461
imagick.roundcorners.php                           03-Dec-2023 00:02                6360
imagick.sampleimage.php                            03-Dec-2023 00:02                2743
imagick.scaleimage.php                             03-Dec-2023 00:02                6528
imagick.segmentimage.php                           03-Dec-2023 00:02                6438
imagick.selectiveblurimage.php                     03-Dec-2023 00:02                6216
imagick.separateimagechannel.php                   03-Dec-2023 00:02                5212
imagick.sepiatoneimage.php                         03-Dec-2023 00:02                4708
imagick.setbackgroundcolor.php                     03-Dec-2023 00:02                3175
imagick.setcolorspace.php                          03-Dec-2023 00:02                2848
imagick.setcompression.php                         03-Dec-2023 00:02                2591
imagick.setcompressionquality.php                  03-Dec-2023 00:02                6682
imagick.setfilename.php                            03-Dec-2023 00:02                2459
imagick.setfirstiterator.php                       03-Dec-2023 00:02                2239
imagick.setfont.php                                03-Dec-2023 00:02                5404
imagick.setformat.php                              03-Dec-2023 00:02                2361
imagick.setgravity.php                             03-Dec-2023 00:02                2621
imagick.setimage.php                               03-Dec-2023 00:02                4577
imagick.setimagealphachannel.php                   03-Dec-2023 00:02                3542
imagick.setimageartifact.php                       03-Dec-2023 00:02                7135
imagick.setimageattribute.php                      03-Dec-2023 00:02                2922
imagick.setimagebackgroundcolor.php                03-Dec-2023 00:02                3413
imagick.setimagebias.php                           03-Dec-2023 00:02                6568
imagick.setimagebiasquantum.php                    03-Dec-2023 00:02                2786
imagick.setimageblueprimary.php                    03-Dec-2023 00:02                2931
imagick.setimagebordercolor.php                    03-Dec-2023 00:02                3391
imagick.setimagechanneldepth.php                   03-Dec-2023 00:02                2948
imagick.setimageclipmask.php                       03-Dec-2023 00:02                8606
imagick.setimagecolormapcolor.php                  03-Dec-2023 00:02                3029
imagick.setimagecolorspace.php                     03-Dec-2023 00:02                3046
imagick.setimagecompose.php                        03-Dec-2023 00:02                2765
imagick.setimagecompression.php                    03-Dec-2023 00:02                2737
imagick.setimagecompressionquality.php             03-Dec-2023 00:02                4700
imagick.setimagedelay.php                          03-Dec-2023 00:02                5981
imagick.setimagedepth.php                          03-Dec-2023 00:02                2583
imagick.setimagedispose.php                        03-Dec-2023 00:02                2627
imagick.setimageextent.php                         03-Dec-2023 00:02                2848
imagick.setimagefilename.php                       03-Dec-2023 00:02                2677
imagick.setimageformat.php                         03-Dec-2023 00:02                2560
imagick.setimagegamma.php                          03-Dec-2023 00:02                2587
imagick.setimagegravity.php                        03-Dec-2023 00:02                2786
imagick.setimagegreenprimary.php                   03-Dec-2023 00:02                2924
imagick.setimageindex.php                          03-Dec-2023 00:02                3185
imagick.setimageinterlacescheme.php                03-Dec-2023 00:02                2747
imagick.setimageinterpolatemethod.php              03-Dec-2023 00:02                2665
imagick.setimageiterations.php                     03-Dec-2023 00:02                4827
imagick.setimagematte.php                          03-Dec-2023 00:02                2607
imagick.setimagemattecolor.php                     03-Dec-2023 00:02                3604
imagick.setimageopacity.php                        03-Dec-2023 00:02                4867
imagick.setimageorientation.php                    03-Dec-2023 00:02                4530
imagick.setimagepage.php                           03-Dec-2023 00:02                3379
imagick.setimageprofile.php                        03-Dec-2023 00:02                3063
imagick.setimageproperty.php                       03-Dec-2023 00:02                4963
imagick.setimageredprimary.php                     03-Dec-2023 00:02                2920
imagick.setimagerenderingintent.php                03-Dec-2023 00:02                2753
imagick.setimageresolution.php                     03-Dec-2023 00:02                4767
imagick.setimagescene.php                          03-Dec-2023 00:02                2607
imagick.setimagetickspersecond.php                 03-Dec-2023 00:02                7553
imagick.setimagetype.php                           03-Dec-2023 00:02                2396
imagick.setimageunits.php                          03-Dec-2023 00:02                2432
imagick.setimagevirtualpixelmethod.php             03-Dec-2023 00:02                2552
imagick.setimagewhitepoint.php                     03-Dec-2023 00:02                2918
imagick.setinterlacescheme.php                     03-Dec-2023 00:02                2480
imagick.setiteratorindex.php                       03-Dec-2023 00:02                6128
imagick.setlastiterator.php                        03-Dec-2023 00:02                2253
imagick.setoption.php                              03-Dec-2023 00:02               11286
imagick.setpage.php                                03-Dec-2023 00:02                3123
imagick.setpointsize.php                           03-Dec-2023 00:02                5079
imagick.setprogressmonitor.php                     03-Dec-2023 00:02               10133
imagick.setregistry.php                            03-Dec-2023 00:02                2820
imagick.setresolution.php                          03-Dec-2023 00:02                3553
imagick.setresourcelimit.php                       03-Dec-2023 00:02                3458
imagick.setsamplingfactors.php                     03-Dec-2023 00:02                6584
imagick.setsize.php                                03-Dec-2023 00:02                2657
imagick.setsizeoffset.php                          03-Dec-2023 00:02                3136
imagick.settype.php                                03-Dec-2023 00:02                2342
imagick.setup.php                                  03-Dec-2023 00:02                1663
imagick.shadeimage.php                             03-Dec-2023 00:02                5363
imagick.shadowimage.php                            03-Dec-2023 00:02                5096
imagick.sharpenimage.php                           03-Dec-2023 00:02                5320
imagick.shaveimage.php                             03-Dec-2023 00:02                4507
imagick.shearimage.php                             03-Dec-2023 00:02                6265
imagick.sigmoidalcontrastimage.php                 03-Dec-2023 00:02                7584
imagick.sketchimage.php                            03-Dec-2023 00:02                5578
imagick.smushimages.php                            03-Dec-2023 00:02                5658
imagick.solarizeimage.php                          03-Dec-2023 00:02                4664
imagick.sparsecolorimage.php                       03-Dec-2023 00:02               26348
imagick.spliceimage.php                            03-Dec-2023 00:02                5464
imagick.spreadimage.php                            03-Dec-2023 00:02                4483
imagick.statisticimage.php                         03-Dec-2023 00:02                6386
imagick.steganoimage.php                           03-Dec-2023 00:02                2926
imagick.stereoimage.php                            03-Dec-2023 00:02                2716
imagick.stripimage.php                             03-Dec-2023 00:02                2387
imagick.subimagematch.php                          03-Dec-2023 00:02                7377
imagick.swirlimage.php                             03-Dec-2023 00:02                4535
imagick.textureimage.php                           03-Dec-2023 00:02                6109
imagick.thresholdimage.php                         03-Dec-2023 00:02                5026
imagick.thumbnailimage.php                         03-Dec-2023 00:02                6934
imagick.tintimage.php                              03-Dec-2023 00:02                7653
imagick.tostring.php                               03-Dec-2023 00:02                2883
imagick.transformimage.php                         03-Dec-2023 00:02                5950
imagick.transformimagecolorspace.php               03-Dec-2023 00:02                5553
imagick.transparentpaintimage.php                  03-Dec-2023 00:02                6982
imagick.transposeimage.php                         03-Dec-2023 00:02                4499
imagick.transverseimage.php                        03-Dec-2023 00:02                4487
imagick.trimimage.php                              03-Dec-2023 00:02                5604
imagick.uniqueimagecolors.php                      03-Dec-2023 00:02                5416
imagick.unsharpmaskimage.php                       03-Dec-2023 00:02                6309
imagick.valid.php                                  03-Dec-2023 00:02                2133
imagick.vignetteimage.php                          03-Dec-2023 00:02                6305
imagick.waveimage.php                              03-Dec-2023 00:02                6188
imagick.whitethresholdimage.php                    03-Dec-2023 00:02                5115
imagick.writeimage.php                             03-Dec-2023 00:02                2839
imagick.writeimagefile.php                         03-Dec-2023 00:02                3562
imagick.writeimages.php                            03-Dec-2023 00:02                2638
imagick.writeimagesfile.php                        03-Dec-2023 00:02                3612
imagickdraw.affine.php                             03-Dec-2023 00:02               16788
imagickdraw.annotation.php                         03-Dec-2023 00:02                3076
imagickdraw.arc.php                                03-Dec-2023 00:02                9235
imagickdraw.bezier.php                             03-Dec-2023 00:02               16678
imagickdraw.circle.php                             03-Dec-2023 00:02                8738
imagickdraw.clear.php                              03-Dec-2023 00:02                2263
imagickdraw.clone.php                              03-Dec-2023 00:02                2415
imagickdraw.color.php                              03-Dec-2023 00:02                3238
imagickdraw.comment.php                            03-Dec-2023 00:02                2570
imagickdraw.composite.php                          03-Dec-2023 00:02               11518
imagickdraw.construct.php                          03-Dec-2023 00:02                2198
imagickdraw.destroy.php                            03-Dec-2023 00:02                2240
imagickdraw.ellipse.php                            03-Dec-2023 00:02               11816
imagickdraw.getclippath.php                        03-Dec-2023 00:02                2230
imagickdraw.getcliprule.php                        03-Dec-2023 00:02                2353
imagickdraw.getclipunits.php                       03-Dec-2023 00:02                2239
imagickdraw.getfillcolor.php                       03-Dec-2023 00:02                2364
imagickdraw.getfillopacity.php                     03-Dec-2023 00:02                2266
imagickdraw.getfillrule.php                        03-Dec-2023 00:02                2315
imagickdraw.getfont.php                            03-Dec-2023 00:02                2197
imagickdraw.getfontfamily.php                      03-Dec-2023 00:02                2257
imagickdraw.getfontsize.php                        03-Dec-2023 00:02                2335
imagickdraw.getfontstretch.php                     03-Dec-2023 00:02                2290
imagickdraw.getfontstyle.php                       03-Dec-2023 00:02                2478
imagickdraw.getfontweight.php                      03-Dec-2023 00:02                2259
imagickdraw.getgravity.php                         03-Dec-2023 00:02                2383
imagickdraw.getstrokeantialias.php                 03-Dec-2023 00:02                2551
imagickdraw.getstrokecolor.php                     03-Dec-2023 00:02                2763
imagickdraw.getstrokedasharray.php                 03-Dec-2023 00:02                2393
imagickdraw.getstrokedashoffset.php                03-Dec-2023 00:02                2367
imagickdraw.getstrokelinecap.php                   03-Dec-2023 00:02                2508
imagickdraw.getstrokelinejoin.php                  03-Dec-2023 00:02                2537
imagickdraw.getstrokemiterlimit.php                03-Dec-2023 00:02                2629
imagickdraw.getstrokeopacity.php                   03-Dec-2023 00:02                2312
imagickdraw.getstrokewidth.php                     03-Dec-2023 00:02                2321
imagickdraw.gettextalignment.php                   03-Dec-2023 00:02                2399
imagickdraw.gettextantialias.php                   03-Dec-2023 00:02                2432
imagickdraw.gettextdecoration.php                  03-Dec-2023 00:02                2436
imagickdraw.gettextencoding.php                    03-Dec-2023 00:02                2359
imagickdraw.gettextinterlinespacing.php            03-Dec-2023 00:02                2327
imagickdraw.gettextinterwordspacing.php            03-Dec-2023 00:02                2351
imagickdraw.gettextkerning.php                     03-Dec-2023 00:02                2246
imagickdraw.gettextundercolor.php                  03-Dec-2023 00:02                2467
imagickdraw.getvectorgraphics.php                  03-Dec-2023 00:02                2457
imagickdraw.line.php                               03-Dec-2023 00:02                8037
imagickdraw.matte.php                              03-Dec-2023 00:02                8009
imagickdraw.pathclose.php                          03-Dec-2023 00:02                2363
imagickdraw.pathcurvetoabsolute.php                03-Dec-2023 00:02                4500
imagickdraw.pathcurvetoquadraticbezierabsolute.php 03-Dec-2023 00:02               10857
imagickdraw.pathcurvetoquadraticbezierrelative.php 03-Dec-2023 00:02                3989
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 03-Dec-2023 00:02               10120
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 03-Dec-2023 00:02               10256
imagickdraw.pathcurvetorelative.php                03-Dec-2023 00:02                4516
imagickdraw.pathcurvetosmoothabsolute.php          03-Dec-2023 00:02                4361
imagickdraw.pathcurvetosmoothrelative.php          03-Dec-2023 00:02                4368
imagickdraw.pathellipticarcabsolute.php            03-Dec-2023 00:02                5166
imagickdraw.pathellipticarcrelative.php            03-Dec-2023 00:02                5136
imagickdraw.pathfinish.php                         03-Dec-2023 00:02                2196
imagickdraw.pathlinetoabsolute.php                 03-Dec-2023 00:02                3022
imagickdraw.pathlinetohorizontalabsolute.php       03-Dec-2023 00:02                2926
imagickdraw.pathlinetohorizontalrelative.php       03-Dec-2023 00:02                2921
imagickdraw.pathlinetorelative.php                 03-Dec-2023 00:02                3072
imagickdraw.pathlinetoverticalabsolute.php         03-Dec-2023 00:02                2890
imagickdraw.pathlinetoverticalrelative.php         03-Dec-2023 00:02                2895
imagickdraw.pathmovetoabsolute.php                 03-Dec-2023 00:02                3069
imagickdraw.pathmovetorelative.php                 03-Dec-2023 00:02                3005
imagickdraw.pathstart.php                          03-Dec-2023 00:02               11696
imagickdraw.point.php                              03-Dec-2023 00:02                6679
imagickdraw.polygon.php                            03-Dec-2023 00:02                8766
imagickdraw.polyline.php                           03-Dec-2023 00:02                8770
imagickdraw.pop.php                                03-Dec-2023 00:02                2503
imagickdraw.popclippath.php                        03-Dec-2023 00:02                2155
imagickdraw.popdefs.php                            03-Dec-2023 00:02                7636
imagickdraw.poppattern.php                         03-Dec-2023 00:02                2236
imagickdraw.push.php                               03-Dec-2023 00:02                8252
imagickdraw.pushclippath.php                       03-Dec-2023 00:02                2797
imagickdraw.pushdefs.php                           03-Dec-2023 00:02                2454
imagickdraw.pushpattern.php                        03-Dec-2023 00:02               14152
imagickdraw.rectangle.php                          03-Dec-2023 00:02                8243
imagickdraw.render.php                             03-Dec-2023 00:02                2278
imagickdraw.resetvectorgraphics.php                03-Dec-2023 00:02                2291
imagickdraw.rotate.php                             03-Dec-2023 00:02                7600
imagickdraw.roundrectangle.php                     03-Dec-2023 00:02                8985
imagickdraw.scale.php                              03-Dec-2023 00:02                7892
imagickdraw.setclippath.php                        03-Dec-2023 00:02                8275
imagickdraw.setcliprule.php                        03-Dec-2023 00:02                9288
imagickdraw.setclipunits.php                       03-Dec-2023 00:02                8665
imagickdraw.setfillalpha.php                       03-Dec-2023 00:02                7621
imagickdraw.setfillcolor.php                       03-Dec-2023 00:02                7681
imagickdraw.setfillopacity.php                     03-Dec-2023 00:02                7679
imagickdraw.setfillpatternurl.php                  03-Dec-2023 00:02                3015
imagickdraw.setfillrule.php                        03-Dec-2023 00:02               12825
imagickdraw.setfont.php                            03-Dec-2023 00:02                9079
imagickdraw.setfontfamily.php                      03-Dec-2023 00:02                9691
imagickdraw.setfontsize.php                        03-Dec-2023 00:02                8127
imagickdraw.setfontstretch.php                     03-Dec-2023 00:02                9554
imagickdraw.setfontstyle.php                       03-Dec-2023 00:02                8844
imagickdraw.setfontweight.php                      03-Dec-2023 00:02                8987
imagickdraw.setgravity.php                         03-Dec-2023 00:02               10411
imagickdraw.setresolution.php                      03-Dec-2023 00:02                2666
imagickdraw.setstrokealpha.php                     03-Dec-2023 00:02                8281
imagickdraw.setstrokeantialias.php                 03-Dec-2023 00:02                8819
imagickdraw.setstrokecolor.php                     03-Dec-2023 00:02                8398
imagickdraw.setstrokedasharray.php                 03-Dec-2023 00:02               13211
imagickdraw.setstrokedashoffset.php                03-Dec-2023 00:02                9712
imagickdraw.setstrokelinecap.php                   03-Dec-2023 00:02                8428
imagickdraw.setstrokelinejoin.php                  03-Dec-2023 00:02               11314
imagickdraw.setstrokemiterlimit.php                03-Dec-2023 00:02               11131
imagickdraw.setstrokeopacity.php                   03-Dec-2023 00:02               10077
imagickdraw.setstrokepatternurl.php                03-Dec-2023 00:02                2771
imagickdraw.setstrokewidth.php                     03-Dec-2023 00:02                8312
imagickdraw.settextalignment.php                   03-Dec-2023 00:02                9293
imagickdraw.settextantialias.php                   03-Dec-2023 00:02                8706
imagickdraw.settextdecoration.php                  03-Dec-2023 00:02                7329
imagickdraw.settextencoding.php                    03-Dec-2023 00:02                3004
imagickdraw.settextinterlinespacing.php            03-Dec-2023 00:02                2748
imagickdraw.settextinterwordspacing.php            03-Dec-2023 00:02                2584
imagickdraw.settextkerning.php                     03-Dec-2023 00:02                2657
imagickdraw.settextundercolor.php                  03-Dec-2023 00:02                7703
imagickdraw.setvectorgraphics.php                  03-Dec-2023 00:02                8702
imagickdraw.setviewbox.php                         03-Dec-2023 00:02               10028
imagickdraw.skewx.php                              03-Dec-2023 00:02                8011
imagickdraw.skewy.php                              03-Dec-2023 00:02                8000
imagickdraw.translate.php                          03-Dec-2023 00:02                8284
imagickkernel.addkernel.php                        03-Dec-2023 00:02                6976
imagickkernel.addunitykernel.php                   03-Dec-2023 00:02               13564
imagickkernel.frombuiltin.php                      03-Dec-2023 00:02               26092
imagickkernel.frommatrix.php                       03-Dec-2023 00:02               23026
imagickkernel.getmatrix.php                        03-Dec-2023 00:02                6997
imagickkernel.scale.php                            03-Dec-2023 00:02               13091
imagickkernel.separate.php                         03-Dec-2023 00:02                9630
imagickpixel.clear.php                             03-Dec-2023 00:02                2251
imagickpixel.construct.php                         03-Dec-2023 00:02               11728
imagickpixel.destroy.php                           03-Dec-2023 00:02                2340
imagickpixel.getcolor.php                          03-Dec-2023 00:02                7473
imagickpixel.getcolorasstring.php                  03-Dec-2023 00:02                4729
imagickpixel.getcolorcount.php                     03-Dec-2023 00:02                4799
imagickpixel.getcolorquantum.php                   03-Dec-2023 00:02                2804
imagickpixel.getcolorvalue.php                     03-Dec-2023 00:02                8469
imagickpixel.getcolorvaluequantum.php              03-Dec-2023 00:02                5897
imagickpixel.gethsl.php                            03-Dec-2023 00:02                4234
imagickpixel.getindex.php                          03-Dec-2023 00:02                2193
imagickpixel.ispixelsimilar.php                    03-Dec-2023 00:02                3445
imagickpixel.ispixelsimilarquantum.php             03-Dec-2023 00:02                3031
imagickpixel.issimilar.php                         03-Dec-2023 00:02               16342
imagickpixel.setcolor.php                          03-Dec-2023 00:02                7244
imagickpixel.setcolorcount.php                     03-Dec-2023 00:02                2493
imagickpixel.setcolorvalue.php                     03-Dec-2023 00:02                4890
imagickpixel.setcolorvaluequantum.php              03-Dec-2023 00:02                8154
imagickpixel.sethsl.php                            03-Dec-2023 00:02                7189
imagickpixel.setindex.php                          03-Dec-2023 00:02                2422
imagickpixeliterator.clear.php                     03-Dec-2023 00:02                6165
imagickpixeliterator.construct.php                 03-Dec-2023 00:02                5897
imagickpixeliterator.destroy.php                   03-Dec-2023 00:02                2381
imagickpixeliterator.getcurrentiteratorrow.php     03-Dec-2023 00:02                2532
imagickpixeliterator.getiteratorrow.php            03-Dec-2023 00:02                2457
imagickpixeliterator.getnextiteratorrow.php        03-Dec-2023 00:02                6640
imagickpixeliterator.getpreviousiteratorrow.php    03-Dec-2023 00:02                2601
imagickpixeliterator.newpixeliterator.php          03-Dec-2023 00:02                2634
imagickpixeliterator.newpixelregioniterator.php    03-Dec-2023 00:02                3983
imagickpixeliterator.resetiterator.php             03-Dec-2023 00:02                8573
imagickpixeliterator.setiteratorfirstrow.php       03-Dec-2023 00:02                2475
imagickpixeliterator.setiteratorlastrow.php        03-Dec-2023 00:02                2468
imagickpixeliterator.setiteratorrow.php            03-Dec-2023 00:02                6928
imagickpixeliterator.synciterator.php              03-Dec-2023 00:02                2323
imap.configuration.php                             03-Dec-2023 00:02                3215
imap.constants.php                                 03-Dec-2023 00:02               17470
imap.installation.php                              03-Dec-2023 00:02                2686
imap.requirements.php                              03-Dec-2023 00:02                3070
imap.resources.php                                 03-Dec-2023 00:02                1430
imap.setup.php                                     03-Dec-2023 00:02                1632
index.php                                          03-Dec-2023 00:02               15909
indexes.examples.php                               03-Dec-2023 00:02              724005
indexes.functions.php                              03-Dec-2023 00:02             1165041
indexes.php                                        03-Dec-2023 00:02                1454
infiniteiterator.construct.php                     03-Dec-2023 00:02                5000
infiniteiterator.next.php                          03-Dec-2023 00:02                3257
info.configuration.php                             03-Dec-2023 00:02               12472
info.constants.php                                 03-Dec-2023 00:02               17407
info.installation.php                              03-Dec-2023 00:02                1279
info.requirements.php                              03-Dec-2023 00:02                1243
info.resources.php                                 03-Dec-2023 00:02                1236
info.setup.php                                     03-Dec-2023 00:02                1639
ini.core.php                                       03-Dec-2023 00:02               69483
ini.list.php                                       03-Dec-2023 00:02               89041
ini.php                                            03-Dec-2023 00:02                1581
ini.sections.php                                   03-Dec-2023 00:02                4069
inotify.configuration.php                          03-Dec-2023 00:02                1338
inotify.constants.php                              03-Dec-2023 00:02                7830
inotify.install.php                                03-Dec-2023 00:02                1834
inotify.requirements.php                           03-Dec-2023 00:02                1284
inotify.resources.php                              03-Dec-2023 00:02                1364
inotify.setup.php                                  03-Dec-2023 00:02                1680
install.cloud.azure.php                            03-Dec-2023 00:02                4382
install.cloud.ec2.php                              03-Dec-2023 00:02                1444
install.cloud.php                                  03-Dec-2023 00:02                1674
install.fpm.configuration.php                      03-Dec-2023 00:02               34711
install.fpm.install.php                            03-Dec-2023 00:02                3412
install.fpm.php                                    03-Dec-2023 00:02                3750
install.general.php                                03-Dec-2023 00:02                4819
install.macosx.bundled.php                         03-Dec-2023 00:02               10415
install.macosx.compile.php                         03-Dec-2023 00:02                1362
install.macosx.packages.php                        03-Dec-2023 00:02                3097
install.macosx.php                                 03-Dec-2023 00:02                1990
install.pecl.downloads.php                         03-Dec-2023 00:02                3655
install.pecl.intro.php                             03-Dec-2023 00:02                3152
install.pecl.pear.php                              03-Dec-2023 00:02                2989
install.pecl.php                                   03-Dec-2023 00:02                2098
install.pecl.php-config.php                        03-Dec-2023 00:02                4309
install.pecl.phpize.php                            03-Dec-2023 00:02                3191
install.pecl.static.php                            03-Dec-2023 00:02                3548
install.pecl.windows.php                           03-Dec-2023 00:02                9639
install.php                                        03-Dec-2023 00:02                6006
install.problems.bugs.php                          03-Dec-2023 00:02                1974
install.problems.faq.php                           03-Dec-2023 00:02                1273
install.problems.php                               03-Dec-2023 00:02                1546
install.problems.support.php                       03-Dec-2023 00:02                2368
install.unix.apache2.php                           03-Dec-2023 00:02               12727
install.unix.commandline.php                       03-Dec-2023 00:02                3890
install.unix.debian.php                            03-Dec-2023 00:02                6892
install.unix.lighttpd-14.php                       03-Dec-2023 00:02                6208
install.unix.litespeed.php                         03-Dec-2023 00:02                9309
install.unix.nginx.php                             03-Dec-2023 00:02                8562
install.unix.openbsd.php                           03-Dec-2023 00:02                5891
install.unix.php                                   03-Dec-2023 00:02                7400
install.unix.solaris.php                           03-Dec-2023 00:02                3953
install.windows.apache2.php                        03-Dec-2023 00:02                7087
install.windows.building.php                       03-Dec-2023 00:02                1709
install.windows.commandline.php                    03-Dec-2023 00:02                8369
install.windows.manual.php                         03-Dec-2023 00:02                5560
install.windows.pecl.php                           03-Dec-2023 00:02                1638
install.windows.php                                03-Dec-2023 00:02                3256
install.windows.recommended.php                    03-Dec-2023 00:02                4899
install.windows.requirements.php                   03-Dec-2023 00:02                2295
install.windows.tools.php                          03-Dec-2023 00:02                1843
install.windows.troubleshooting.php                03-Dec-2023 00:02                1852
internaliterator.construct.php                     03-Dec-2023 00:02                1957
internaliterator.current.php                       03-Dec-2023 00:02                2290
internaliterator.key.php                           03-Dec-2023 00:02                2273
internaliterator.next.php                          03-Dec-2023 00:02                2212
internaliterator.rewind.php                        03-Dec-2023 00:02                2248
internaliterator.valid.php                         03-Dec-2023 00:02                2223
intl.configuration.php                             03-Dec-2023 00:02                5009
intl.constants.php                                 03-Dec-2023 00:02                7367
intl.examples.basic.php                            03-Dec-2023 00:02                4293
intl.examples.php                                  03-Dec-2023 00:02                1355
intl.installation.php                              03-Dec-2023 00:02                1791
intl.requirements.php                              03-Dec-2023 00:02                1404
intl.resources.php                                 03-Dec-2023 00:02                1233
intl.setup.php                                     03-Dec-2023 00:02                1631
intlbreakiterator.construct.php                    03-Dec-2023 00:02                4119
intlbreakiterator.createcharacterinstance.php      03-Dec-2023 00:02                3114
intlbreakiterator.createcodepointinstance.php      03-Dec-2023 00:02                2750
intlbreakiterator.createlineinstance.php           03-Dec-2023 00:02                3075
intlbreakiterator.createsentenceinstance.php       03-Dec-2023 00:02                3077
intlbreakiterator.createtitleinstance.php          03-Dec-2023 00:02                3057
intlbreakiterator.createwordinstance.php           03-Dec-2023 00:02                3011
intlbreakiterator.current.php                      03-Dec-2023 00:02                2381
intlbreakiterator.first.php                        03-Dec-2023 00:02                2365
intlbreakiterator.following.php                    03-Dec-2023 00:02                2613
intlbreakiterator.geterrorcode.php                 03-Dec-2023 00:02                2856
intlbreakiterator.geterrormessage.php              03-Dec-2023 00:02                2901
intlbreakiterator.getlocale.php                    03-Dec-2023 00:02                2695
intlbreakiterator.getpartsiterator.php             03-Dec-2023 00:02                3407
intlbreakiterator.gettext.php                      03-Dec-2023 00:02                2440
intlbreakiterator.isboundary.php                   03-Dec-2023 00:02                2582
intlbreakiterator.last.php                         03-Dec-2023 00:02                2364
intlbreakiterator.next.php                         03-Dec-2023 00:02                2666
intlbreakiterator.preceding.php                    03-Dec-2023 00:02                2591
intlbreakiterator.previous.php                     03-Dec-2023 00:02                2420
intlbreakiterator.settext.php                      03-Dec-2023 00:02                2599
intlcalendar.add.php                               03-Dec-2023 00:02                8250
intlcalendar.after.php                             03-Dec-2023 00:02                6564
intlcalendar.before.php                            03-Dec-2023 00:02                3949
intlcalendar.clear.php                             03-Dec-2023 00:02               18553
intlcalendar.construct.php                         03-Dec-2023 00:02                2305
intlcalendar.createinstance.php                    03-Dec-2023 00:02               12596
intlcalendar.equals.php                            03-Dec-2023 00:02               10659
intlcalendar.fielddifference.php                   03-Dec-2023 00:02               10855
intlcalendar.fromdatetime.php                      03-Dec-2023 00:02                7302
intlcalendar.get.php                               03-Dec-2023 00:02                8522
intlcalendar.getactualmaximum.php                  03-Dec-2023 00:02                8359
intlcalendar.getactualminimum.php                  03-Dec-2023 00:02                5576
intlcalendar.getavailablelocales.php               03-Dec-2023 00:02                4155
intlcalendar.getdayofweektype.php                  03-Dec-2023 00:02                9266
intlcalendar.geterrorcode.php                      03-Dec-2023 00:02                8890
intlcalendar.geterrormessage.php                   03-Dec-2023 00:02                5909
intlcalendar.getfirstdayofweek.php                 03-Dec-2023 00:02                8297
intlcalendar.getgreatestminimum.php                03-Dec-2023 00:02                4414
intlcalendar.getkeywordvaluesforlocale.php         03-Dec-2023 00:02                7011
intlcalendar.getleastmaximum.php                   03-Dec-2023 00:02                8006
intlcalendar.getlocale.php                         03-Dec-2023 00:02                5843
intlcalendar.getmaximum.php                        03-Dec-2023 00:02                5109
intlcalendar.getminimaldaysinfirstweek.php         03-Dec-2023 00:02                8732
intlcalendar.getminimum.php                        03-Dec-2023 00:02                4358
intlcalendar.getnow.php                            03-Dec-2023 00:02                5132
intlcalendar.getrepeatedwalltimeoption.php         03-Dec-2023 00:02               10001
intlcalendar.getskippedwalltimeoption.php          03-Dec-2023 00:02               12260
intlcalendar.gettime.php                           03-Dec-2023 00:02                6307
intlcalendar.gettimezone.php                       03-Dec-2023 00:02                7473
intlcalendar.gettype.php                           03-Dec-2023 00:02                5531
intlcalendar.getweekendtransition.php              03-Dec-2023 00:02                4698
intlcalendar.indaylighttime.php                    03-Dec-2023 00:02                8484
intlcalendar.isequivalentto.php                    03-Dec-2023 00:02                8306
intlcalendar.islenient.php                         03-Dec-2023 00:02                8180
intlcalendar.isset.php                             03-Dec-2023 00:02                4602
intlcalendar.isweekend.php                         03-Dec-2023 00:02                8481
intlcalendar.roll.php                              03-Dec-2023 00:02                8856
intlcalendar.set.php                               03-Dec-2023 00:02               14419
intlcalendar.setdate.php                           03-Dec-2023 00:02                4426
intlcalendar.setdatetime.php                       03-Dec-2023 00:02                5803
intlcalendar.setfirstdayofweek.php                 03-Dec-2023 00:02                8171
intlcalendar.setlenient.php                        03-Dec-2023 00:02                4658
intlcalendar.setminimaldaysinfirstweek.php         03-Dec-2023 00:02                5142
intlcalendar.setrepeatedwalltimeoption.php         03-Dec-2023 00:02                5978
intlcalendar.setskippedwalltimeoption.php          03-Dec-2023 00:02                6685
intlcalendar.settime.php                           03-Dec-2023 00:02                8298
intlcalendar.settimezone.php                       03-Dec-2023 00:02               10700
intlcalendar.todatetime.php                        03-Dec-2023 00:02                7100
intlchar.charage.php                               03-Dec-2023 00:02                5459
intlchar.chardigitvalue.php                        03-Dec-2023 00:02                5148
intlchar.chardirection.php                         03-Dec-2023 00:02                8549
intlchar.charfromname.php                          03-Dec-2023 00:02                6589
intlchar.charmirror.php                            03-Dec-2023 00:02                5922
intlchar.charname.php                              03-Dec-2023 00:02                6936
intlchar.chartype.php                              03-Dec-2023 00:02                9075
intlchar.chr.php                                   03-Dec-2023 00:02                5266
intlchar.digit.php                                 03-Dec-2023 00:02                7846
intlchar.enumcharnames.php                         03-Dec-2023 00:02                7584
intlchar.enumchartypes.php                         03-Dec-2023 00:02                5629
intlchar.foldcase.php                              03-Dec-2023 00:02                3430
intlchar.fordigit.php                              03-Dec-2023 00:02                6812
intlchar.getbidipairedbracket.php                  03-Dec-2023 00:02                5554
intlchar.getblockcode.php                          03-Dec-2023 00:02                5192
intlchar.getcombiningclass.php                     03-Dec-2023 00:02                4536
intlchar.getfc-nfkc-closure.php                    03-Dec-2023 00:02                4477
intlchar.getintpropertymaxvalue.php                03-Dec-2023 00:02                6286
intlchar.getintpropertyminvalue.php                03-Dec-2023 00:02                6279
intlchar.getintpropertyvalue.php                   03-Dec-2023 00:02                7578
intlchar.getnumericvalue.php                       03-Dec-2023 00:02                5046
intlchar.getpropertyenum.php                       03-Dec-2023 00:02                6416
intlchar.getpropertyname.php                       03-Dec-2023 00:02                8122
intlchar.getpropertyvalueenum.php                  03-Dec-2023 00:02                7737
intlchar.getpropertyvaluename.php                  03-Dec-2023 00:02                9840
intlchar.getunicodeversion.php                     03-Dec-2023 00:02                3870
intlchar.hasbinaryproperty.php                     03-Dec-2023 00:02                8456
intlchar.isalnum.php                               03-Dec-2023 00:02                5477
intlchar.isalpha.php                               03-Dec-2023 00:02                5363
intlchar.isbase.php                                03-Dec-2023 00:02                5635
intlchar.isblank.php                               03-Dec-2023 00:02                6342
intlchar.iscntrl.php                               03-Dec-2023 00:02                6140
intlchar.isdefined.php                             03-Dec-2023 00:02                6372
intlchar.isdigit.php                               03-Dec-2023 00:02                5699
intlchar.isgraph.php                               03-Dec-2023 00:02                5593
intlchar.isidignorable.php                         03-Dec-2023 00:02                5769
intlchar.isidpart.php                              03-Dec-2023 00:02                6354
intlchar.isidstart.php                             03-Dec-2023 00:02                5861
intlchar.isisocontrol.php                          03-Dec-2023 00:02                5108
intlchar.isjavaidpart.php                          03-Dec-2023 00:02                6453
intlchar.isjavaidstart.php                         03-Dec-2023 00:02                6153
intlchar.isjavaspacechar.php                       03-Dec-2023 00:02                6386
intlchar.islower.php                               03-Dec-2023 00:02                6863
intlchar.ismirrored.php                            03-Dec-2023 00:02                5223
intlchar.isprint.php                               03-Dec-2023 00:02                5667
intlchar.ispunct.php                               03-Dec-2023 00:02                5372
intlchar.isspace.php                               03-Dec-2023 00:02                6226
intlchar.istitle.php                               03-Dec-2023 00:02                6095
intlchar.isualphabetic.php                         03-Dec-2023 00:02                5454
intlchar.isulowercase.php                          03-Dec-2023 00:02                6434
intlchar.isupper.php                               03-Dec-2023 00:02                6859
intlchar.isuuppercase.php                          03-Dec-2023 00:02                6472
intlchar.isuwhitespace.php                         03-Dec-2023 00:02                6973
intlchar.iswhitespace.php                          03-Dec-2023 00:02                7101
intlchar.isxdigit.php                              03-Dec-2023 00:02                6722
intlchar.ord.php                                   03-Dec-2023 00:02                5166
intlchar.tolower.php                               03-Dec-2023 00:02                7142
intlchar.totitle.php                               03-Dec-2023 00:02                7153
intlchar.toupper.php                               03-Dec-2023 00:02                7075
intlcodepointbreakiterator.getlastcodepoint.php    03-Dec-2023 00:02                2626
intldateformatter.create.php                       03-Dec-2023 00:02               25168
intldateformatter.format.php                       03-Dec-2023 00:02               25872
intldateformatter.formatobject.php                 03-Dec-2023 00:02               12894
intldateformatter.getcalendar.php                  03-Dec-2023 00:02                8987
intldateformatter.getcalendarobject.php            03-Dec-2023 00:02                7380
intldateformatter.getdatetype.php                  03-Dec-2023 00:02               11356
intldateformatter.geterrorcode.php                 03-Dec-2023 00:02                8599
intldateformatter.geterrormessage.php              03-Dec-2023 00:02                8512
intldateformatter.getlocale.php                    03-Dec-2023 00:02               11652
intldateformatter.getpattern.php                   03-Dec-2023 00:02               10077
intldateformatter.gettimetype.php                  03-Dec-2023 00:02               11350
intldateformatter.gettimezone.php                  03-Dec-2023 00:02                8546
intldateformatter.gettimezoneid.php                03-Dec-2023 00:02                8634
intldateformatter.islenient.php                    03-Dec-2023 00:02               14447
intldateformatter.localtime.php                    03-Dec-2023 00:02               11018
intldateformatter.parse.php                        03-Dec-2023 00:02               11771
intldateformatter.setcalendar.php                  03-Dec-2023 00:02               13825
intldateformatter.setlenient.php                   03-Dec-2023 00:02               15193
intldateformatter.setpattern.php                   03-Dec-2023 00:02               11196
intldateformatter.settimezone.php                  03-Dec-2023 00:02               11343
intldatepatterngenerator.create.php                03-Dec-2023 00:02                3931
intldatepatterngenerator.getbestpattern.php        03-Dec-2023 00:02                6644
intlgregoriancalendar.construct.php                03-Dec-2023 00:02                5072
intlgregoriancalendar.createfromdate.php           03-Dec-2023 00:02                7194
intlgregoriancalendar.createfromdatetime.php       03-Dec-2023 00:02                8610
intlgregoriancalendar.getgregorianchange.php       03-Dec-2023 00:02                2603
intlgregoriancalendar.isleapyear.php               03-Dec-2023 00:02                2811
intlgregoriancalendar.setgregorianchange.php       03-Dec-2023 00:02                2834
intliterator.current.php                           03-Dec-2023 00:02                2355
intliterator.key.php                               03-Dec-2023 00:02                2337
intliterator.next.php                              03-Dec-2023 00:02                2273
intliterator.rewind.php                            03-Dec-2023 00:02                2305
intliterator.valid.php                             03-Dec-2023 00:02                2261
intlpartsiterator.getbreakiterator.php             03-Dec-2023 00:02                2532
intlrulebasedbreakiterator.construct.php           03-Dec-2023 00:02                2998
intlrulebasedbreakiterator.getbinaryrules.php      03-Dec-2023 00:02                2695
intlrulebasedbreakiterator.getrules.php            03-Dec-2023 00:02                2659
intlrulebasedbreakiterator.getrulestatus.php       03-Dec-2023 00:02                2659
intlrulebasedbreakiterator.getrulestatusvec.php    03-Dec-2023 00:02                2755
intltimezone.construct.php                         03-Dec-2023 00:02                1946
intltimezone.countequivalentids.php                03-Dec-2023 00:02                3369
intltimezone.createdefault.php                     03-Dec-2023 00:02                2979
intltimezone.createenumeration.php                 03-Dec-2023 00:02                4125
intltimezone.createtimezone.php                    03-Dec-2023 00:02                3401
intltimezone.createtimezoneidenumeration.php       03-Dec-2023 00:02                5041
intltimezone.fromdatetimezone.php                  03-Dec-2023 00:02                3642
intltimezone.getcanonicalid.php                    03-Dec-2023 00:02                3872
intltimezone.getdisplayname.php                    03-Dec-2023 00:02                4777
intltimezone.getdstsavings.php                     03-Dec-2023 00:02                2995
intltimezone.getequivalentid.php                   03-Dec-2023 00:02                3659
intltimezone.geterrorcode.php                      03-Dec-2023 00:02                3115
intltimezone.geterrormessage.php                   03-Dec-2023 00:02                3139
intltimezone.getgmt.php                            03-Dec-2023 00:02                2828
intltimezone.getid.php                             03-Dec-2023 00:02                2991
intltimezone.getidforwindowsid.php                 03-Dec-2023 00:02                5206
intltimezone.getoffset.php                         03-Dec-2023 00:02                4509
intltimezone.getrawoffset.php                      03-Dec-2023 00:02                2946
intltimezone.getregion.php                         03-Dec-2023 00:02                3310
intltimezone.gettzdataversion.php                  03-Dec-2023 00:02                3030
intltimezone.getunknown.php                        03-Dec-2023 00:02                3043
intltimezone.getwindowsid.php                      03-Dec-2023 00:02                4066
intltimezone.hassamerules.php                      03-Dec-2023 00:02                3377
intltimezone.todatetimezone.php                    03-Dec-2023 00:02                3360
intltimezone.usedaylighttime.php                   03-Dec-2023 00:02                2970
intro-whatcando.php                                03-Dec-2023 00:02                8249
intro-whatis.php                                   03-Dec-2023 00:02                4138
intro.apache.php                                   03-Dec-2023 00:02                1206
intro.apcu.php                                     03-Dec-2023 00:02                1768
intro.array.php                                    03-Dec-2023 00:02                1942
intro.bc.php                                       03-Dec-2023 00:02                4283
intro.bzip2.php                                    03-Dec-2023 00:02                1226
intro.calendar.php                                 03-Dec-2023 00:02                2260
intro.classobj.php                                 03-Dec-2023 00:02                1738
intro.cmark.php                                    03-Dec-2023 00:02                6384
intro.com.php                                      03-Dec-2023 00:02                3086
intro.componere.php                                03-Dec-2023 00:02                6147
intro.ctype.php                                    03-Dec-2023 00:02                3811
intro.cubrid.php                                   03-Dec-2023 00:02                1474
intro.curl.php                                     03-Dec-2023 00:02                1605
intro.datetime.php                                 03-Dec-2023 00:02                2885
intro.dba.php                                      03-Dec-2023 00:02                1494
intro.dbase.php                                    03-Dec-2023 00:02                6243
intro.dio.php                                      03-Dec-2023 00:02                1693
intro.dom.php                                      03-Dec-2023 00:02                1689
intro.ds.php                                       03-Dec-2023 00:02                1396
intro.eio.php                                      03-Dec-2023 00:02               14377
intro.enchant.php                                  03-Dec-2023 00:02                2607
intro.errorfunc.php                                03-Dec-2023 00:02                1987
intro.ev.php                                       03-Dec-2023 00:02                2275
intro.event.php                                    03-Dec-2023 00:02                1957
intro.exec.php                                     03-Dec-2023 00:02                1267
intro.exif.php                                     03-Dec-2023 00:02                1436
intro.expect.php                                   03-Dec-2023 00:02                1428
intro.fann.php                                     03-Dec-2023 00:02                1417
intro.fdf.php                                      03-Dec-2023 00:02                3823
intro.ffi.php                                      03-Dec-2023 00:02                3014
intro.fileinfo.php                                 03-Dec-2023 00:02                1440
intro.filesystem.php                               03-Dec-2023 00:02                1553
intro.filter.php                                   03-Dec-2023 00:02                2658
intro.fpm.php                                      03-Dec-2023 00:02                1320
intro.ftp.php                                      03-Dec-2023 00:02                1765
intro.funchand.php                                 03-Dec-2023 00:02                1323
intro.gearman.php                                  03-Dec-2023 00:02                1658
intro.gender.php                                   03-Dec-2023 00:02                1326
intro.geoip.php                                    03-Dec-2023 00:02                1564
intro.gettext.php                                  03-Dec-2023 00:02                1553
intro.gmagick.php                                  03-Dec-2023 00:02                1688
intro.gmp.php                                      03-Dec-2023 00:02                2780
intro.gnupg.php                                    03-Dec-2023 00:02                1215
intro.hash.php                                     03-Dec-2023 00:02                1230
intro.hrtime.php                                   03-Dec-2023 00:02                1658
intro.ibase.php                                    03-Dec-2023 00:02                3127
intro.ibm-db2.php                                  03-Dec-2023 00:02                1275
intro.iconv.php                                    03-Dec-2023 00:02                2034
intro.igbinary.php                                 03-Dec-2023 00:02                1670
intro.image.php                                    03-Dec-2023 00:02                6149
intro.imagick.php                                  03-Dec-2023 00:02                1707
intro.imap.php                                     03-Dec-2023 00:02                1682
intro.info.php                                     03-Dec-2023 00:02                1576
intro.inotify.php                                  03-Dec-2023 00:02                2337
intro.intl.php                                     03-Dec-2023 00:02                5013
intro.json.php                                     03-Dec-2023 00:02                1632
intro.ldap.php                                     03-Dec-2023 00:02                4076
intro.libxml.php                                   03-Dec-2023 00:02                1782
intro.lua.php                                      03-Dec-2023 00:02                1291
intro.luasandbox.php                               03-Dec-2023 00:02                2360
intro.lzf.php                                      03-Dec-2023 00:02                1463
intro.mail.php                                     03-Dec-2023 00:02                1213
intro.mailparse.php                                03-Dec-2023 00:02                1932
intro.math.php                                     03-Dec-2023 00:02                1978
intro.mbstring.php                                 03-Dec-2023 00:02                2855
intro.mcrypt.php                                   03-Dec-2023 00:02                2291
intro.memcache.php                                 03-Dec-2023 00:02                1679
intro.memcached.php                                03-Dec-2023 00:02                1950
intro.mhash.php                                    03-Dec-2023 00:02                2000
intro.misc.php                                     03-Dec-2023 00:02                1188
intro.mqseries.php                                 03-Dec-2023 00:02                1739
intro.mysql-xdevapi.php                            03-Dec-2023 00:02                1875
intro.mysql.php                                    03-Dec-2023 00:02                1906
intro.mysqli.php                                   03-Dec-2023 00:02                2238
intro.mysqlnd.php                                  03-Dec-2023 00:02                1912
intro.network.php                                  03-Dec-2023 00:02                1154
intro.oauth.php                                    03-Dec-2023 00:02                1329
intro.oci8.php                                     03-Dec-2023 00:02                1505
intro.opcache.php                                  03-Dec-2023 00:02                1567
intro.openal.php                                   03-Dec-2023 00:02                1248
intro.openssl.php                                  03-Dec-2023 00:02                1575
intro.outcontrol.php                               03-Dec-2023 00:02                2417
intro.parallel.php                                 03-Dec-2023 00:02                6886
intro.parle.php                                    03-Dec-2023 00:02                3434
intro.password.php                                 03-Dec-2023 00:02                1432
intro.pcntl.php                                    03-Dec-2023 00:02                2617
intro.pcre.php                                     03-Dec-2023 00:02                2713
intro.pdo.php                                      03-Dec-2023 00:02                2171
intro.pgsql.php                                    03-Dec-2023 00:02                1649
intro.phar.php                                     03-Dec-2023 00:02               10016
intro.phpdbg.php                                   03-Dec-2023 00:02                6286
intro.posix.php                                    03-Dec-2023 00:02                1722
intro.ps.php                                       03-Dec-2023 00:02                1757
intro.pspell.php                                   03-Dec-2023 00:02                1190
intro.pthreads.php                                 03-Dec-2023 00:02                9121
intro.quickhash.php                                03-Dec-2023 00:02                1262
intro.radius.php                                   03-Dec-2023 00:02                2160
intro.random.php                                   03-Dec-2023 00:02                1104
intro.rar.php                                      03-Dec-2023 00:02                1536
intro.readline.php                                 03-Dec-2023 00:02                1922
intro.recode.php                                   03-Dec-2023 00:02                2265
intro.reflection.php                               03-Dec-2023 00:02                1902
intro.rnp.php                                      03-Dec-2023 00:02                1275
intro.rpminfo.php                                  03-Dec-2023 00:02                1392
intro.rrd.php                                      03-Dec-2023 00:02                1431
intro.runkit7.php                                  03-Dec-2023 00:02                1474
intro.scoutapm.php                                 03-Dec-2023 00:02                1468
intro.seaslog.php                                  03-Dec-2023 00:02                4168
intro.sem.php                                      03-Dec-2023 00:02                3218
intro.session.php                                  03-Dec-2023 00:02                4995
intro.shmop.php                                    03-Dec-2023 00:02                1922
intro.simdjson.php                                 03-Dec-2023 00:02                1224
intro.simplexml.php                                03-Dec-2023 00:02                1342
intro.snmp.php                                     03-Dec-2023 00:02                1846
intro.soap.php                                     03-Dec-2023 00:02                1459
intro.sockets.php                                  03-Dec-2023 00:02                2583
intro.sodium.php                                   03-Dec-2023 00:02                1325
intro.solr.php                                     03-Dec-2023 00:02                1789
intro.spl.php                                      03-Dec-2023 00:02                1609
intro.sqlite3.php                                  03-Dec-2023 00:02                1155
intro.sqlsrv.php                                   03-Dec-2023 00:02                2161
intro.ssdeep.php                                   03-Dec-2023 00:02                1754
intro.ssh2.php                                     03-Dec-2023 00:02                1336
intro.stats.php                                    03-Dec-2023 00:02                1506
intro.stomp.php                                    03-Dec-2023 00:02                1339
intro.stream.php                                   03-Dec-2023 00:02                4062
intro.strings.php                                  03-Dec-2023 00:02                1675
intro.svm.php                                      03-Dec-2023 00:02                1237
intro.svn.php                                      03-Dec-2023 00:02                1769
intro.swoole.php                                   03-Dec-2023 00:02                1647
intro.sync.php                                     03-Dec-2023 00:02                2347
intro.taint.php                                    03-Dec-2023 00:02                4285
intro.tcpwrap.php                                  03-Dec-2023 00:02                1279
intro.tidy.php                                     03-Dec-2023 00:02                1404
intro.tokenizer.php                                03-Dec-2023 00:02                1535
intro.trader.php                                   03-Dec-2023 00:02                2383
intro.ui.php                                       03-Dec-2023 00:02                1206
intro.uodbc.php                                    03-Dec-2023 00:02                2751
intro.uopz.php                                     03-Dec-2023 00:02                2397
intro.url.php                                      03-Dec-2023 00:02                1146
intro.v8js.php                                     03-Dec-2023 00:02                1223
intro.var.php                                      03-Dec-2023 00:02                1392
intro.var_representation.php                       03-Dec-2023 00:02                1424
intro.varnish.php                                  03-Dec-2023 00:02                1313
intro.wddx.php                                     03-Dec-2023 00:02                1218
intro.win32service.php                             03-Dec-2023 00:02                1396
intro.wincache.php                                 03-Dec-2023 00:02                4885
intro.wkhtmltox.php                                03-Dec-2023 00:02                1272
intro.xattr.php                                    03-Dec-2023 00:02                1193
intro.xdiff.php                                    03-Dec-2023 00:02                2607
intro.xhprof.php                                   03-Dec-2023 00:02                2789
intro.xlswriter.php                                03-Dec-2023 00:02                1185
intro.xml.php                                      03-Dec-2023 00:02                2333
intro.xmldiff.php                                  03-Dec-2023 00:02                1406
intro.xmlreader.php                                03-Dec-2023 00:02                1590
intro.xmlrpc.php                                   03-Dec-2023 00:02                1877
intro.xmlwriter.php                                03-Dec-2023 00:02                1544
intro.xsl.php                                      03-Dec-2023 00:02                1334
intro.yac.php                                      03-Dec-2023 00:02                1197
intro.yaconf.php                                   03-Dec-2023 00:02                2544
intro.yaf.php                                      03-Dec-2023 00:02                1545
intro.yaml.php                                     03-Dec-2023 00:02                1401
intro.yar.php                                      03-Dec-2023 00:02                1266
intro.yaz.php                                      03-Dec-2023 00:02                2531
intro.zip.php                                      03-Dec-2023 00:02                1187
intro.zlib.php                                     03-Dec-2023 00:02                1689
intro.zmq.php                                      03-Dec-2023 00:02                1432
intro.zookeeper.php                                03-Dec-2023 00:02                1443
introduction.php                                   03-Dec-2023 00:02                1443
iterator.current.php                               03-Dec-2023 00:02                2159
iterator.key.php                                   03-Dec-2023 00:02                2465
iterator.next.php                                  03-Dec-2023 00:02                2345
iterator.rewind.php                                03-Dec-2023 00:02                2532
iterator.valid.php                                 03-Dec-2023 00:02                2526
iteratoraggregate.getiterator.php                  03-Dec-2023 00:02                2804
iteratoriterator.construct.php                     03-Dec-2023 00:02                3295
iteratoriterator.current.php                       03-Dec-2023 00:02                2742
iteratoriterator.getinneriterator.php              03-Dec-2023 00:02                3056
iteratoriterator.key.php                           03-Dec-2023 00:02                2690
iteratoriterator.next.php                          03-Dec-2023 00:02                2794
iteratoriterator.rewind.php                        03-Dec-2023 00:02                2813
iteratoriterator.valid.php                         03-Dec-2023 00:02                2847
json.configuration.php                             03-Dec-2023 00:02                1298
json.constants.php                                 03-Dec-2023 00:02               12637
json.installation.php                              03-Dec-2023 00:02                1279
json.requirements.php                              03-Dec-2023 00:02                1716
json.resources.php                                 03-Dec-2023 00:02                1236
json.setup.php                                     03-Dec-2023 00:02                1606
jsonserializable.jsonserialize.php                 03-Dec-2023 00:02               12159
langref.php                                        03-Dec-2023 00:02               21326
language.attributes.classes.php                    03-Dec-2023 00:02                6153
language.attributes.overview.php                   03-Dec-2023 00:02               10296
language.attributes.php                            03-Dec-2023 00:02                1707
language.attributes.reflection.php                 03-Dec-2023 00:02                8119
language.attributes.syntax.php                     03-Dec-2023 00:02                6149
language.basic-syntax.comments.php                 03-Dec-2023 00:02                3879
language.basic-syntax.instruction-separation.php   03-Dec-2023 00:02                4282
language.basic-syntax.php                          03-Dec-2023 00:02                1674
language.basic-syntax.phpmode.php                  03-Dec-2023 00:02                4559
language.basic-syntax.phptags.php                  03-Dec-2023 00:02                4870
language.constants.magic.php                       03-Dec-2023 00:02                5106
language.constants.php                             03-Dec-2023 00:02                6249
language.constants.predefined.php                  03-Dec-2023 00:02                1540
language.constants.syntax.php                      03-Dec-2023 00:02                9953
language.control-structures.php                    03-Dec-2023 00:02                2746
language.enumerations.backed.php                   03-Dec-2023 00:02               10334
language.enumerations.basics.php                   03-Dec-2023 00:02                8138
language.enumerations.constants.php                03-Dec-2023 00:02                2430
language.enumerations.examples.php                 03-Dec-2023 00:02                7287
language.enumerations.expressions.php              03-Dec-2023 00:02                5440
language.enumerations.listing.php                  03-Dec-2023 00:02                2226
language.enumerations.methods.php                  03-Dec-2023 00:02               13560
language.enumerations.object-differences.inheri..> 03-Dec-2023 00:02                6079
language.enumerations.object-differences.php       03-Dec-2023 00:02                4948
language.enumerations.overview.php                 03-Dec-2023 00:02                2359
language.enumerations.php                          03-Dec-2023 00:02                2685
language.enumerations.serialization.php            03-Dec-2023 00:02                4896
language.enumerations.static-methods.php           03-Dec-2023 00:02                3327
language.enumerations.traits.php                   03-Dec-2023 00:02                4346
language.errors.basics.php                         03-Dec-2023 00:02                4861
language.errors.php                                03-Dec-2023 00:02                1880
language.errors.php7.php                           03-Dec-2023 00:02                5804
language.exceptions.extending.php                  03-Dec-2023 00:02               19532
language.exceptions.php                            03-Dec-2023 00:02               26189
language.expressions.php                           03-Dec-2023 00:02               15239
language.fibers.php                                03-Dec-2023 00:02                6253
language.functions.php                             03-Dec-2023 00:02                2044
language.generators.comparison.php                 03-Dec-2023 00:02                8888
language.generators.overview.php                   03-Dec-2023 00:02                9163
language.generators.php                            03-Dec-2023 00:02                1572
language.generators.syntax.php                     03-Dec-2023 00:02               23618
language.namespaces.basics.php                     03-Dec-2023 00:02               11069
language.namespaces.definition.php                 03-Dec-2023 00:02                4336
language.namespaces.definitionmultiple.php         03-Dec-2023 00:02                9004
language.namespaces.dynamic.php                    03-Dec-2023 00:02                8307
language.namespaces.fallback.php                   03-Dec-2023 00:02                6011
language.namespaces.faq.php                        03-Dec-2023 00:02               31772
language.namespaces.global.php                     03-Dec-2023 00:02                2759
language.namespaces.importing.php                  03-Dec-2023 00:02               15377
language.namespaces.nested.php                     03-Dec-2023 00:02                2757
language.namespaces.nsconstants.php                03-Dec-2023 00:02                8586
language.namespaces.php                            03-Dec-2023 00:02                2553
language.namespaces.rationale.php                  03-Dec-2023 00:02                6455
language.namespaces.rules.php                      03-Dec-2023 00:02               12590
language.oop5.abstract.php                         03-Dec-2023 00:02               10836
language.oop5.anonymous.php                        03-Dec-2023 00:02               10364
language.oop5.autoload.php                         03-Dec-2023 00:02                6683
language.oop5.basic.php                            03-Dec-2023 00:02               48381
language.oop5.changelog.php                        03-Dec-2023 00:02               13283
language.oop5.cloning.php                          03-Dec-2023 00:02                8688
language.oop5.constants.php                        03-Dec-2023 00:02                8766
language.oop5.decon.php                            03-Dec-2023 00:02               28188
language.oop5.final.php                            03-Dec-2023 00:02                5997
language.oop5.inheritance.php                      03-Dec-2023 00:02               13272
language.oop5.interfaces.php                       03-Dec-2023 00:02               22930
language.oop5.iterations.php                       03-Dec-2023 00:02                5889
language.oop5.late-static-bindings.php             03-Dec-2023 00:02               14303
language.oop5.magic.php                            03-Dec-2023 00:02               42501
language.oop5.object-comparison.php                03-Dec-2023 00:02                8793
language.oop5.overloading.php                      03-Dec-2023 00:02               23501
language.oop5.paamayim-nekudotayim.php             03-Dec-2023 00:02                8235
language.oop5.php                                  03-Dec-2023 00:02                3390
language.oop5.properties.php                       03-Dec-2023 00:02               27416
language.oop5.references.php                       03-Dec-2023 00:02                5738
language.oop5.serialization.php                    03-Dec-2023 00:02                7132
language.oop5.static.php                           03-Dec-2023 00:02                9254
language.oop5.traits.php                           03-Dec-2023 00:02               34943
language.oop5.variance.php                         03-Dec-2023 00:02               15733
language.oop5.visibility.php                       03-Dec-2023 00:02               24540
language.operators.arithmetic.php                  03-Dec-2023 00:02                5633
language.operators.array.php                       03-Dec-2023 00:02                8631
language.operators.assignment.php                  03-Dec-2023 00:02               11116
language.operators.bitwise.php                     03-Dec-2023 00:02               43859
language.operators.comparison.php                  03-Dec-2023 00:02               39292
language.operators.errorcontrol.php                03-Dec-2023 00:02                5948
language.operators.execution.php                   03-Dec-2023 00:02                3385
language.operators.increment.php                   03-Dec-2023 00:02               13381
language.operators.logical.php                     03-Dec-2023 00:02                6967
language.operators.php                             03-Dec-2023 00:02                3945
language.operators.precedence.php                  03-Dec-2023 00:02               19391
language.operators.string.php                      03-Dec-2023 00:02                3105
language.operators.type.php                        03-Dec-2023 00:02               18017
language.references.arent.php                      03-Dec-2023 00:02                3245
language.references.pass.php                       03-Dec-2023 00:02                6674
language.references.php                            03-Dec-2023 00:02                1982
language.references.return.php                     03-Dec-2023 00:02                7082
language.references.spot.php                       03-Dec-2023 00:02                2542
language.references.unset.php                      03-Dec-2023 00:02                2276
language.references.whatare.php                    03-Dec-2023 00:02                2089
language.references.whatdo.php                     03-Dec-2023 00:02               18472
language.types.array.php                           03-Dec-2023 00:02               96110
language.types.boolean.php                         03-Dec-2023 00:02                8822
language.types.callable.php                        03-Dec-2023 00:02               11864
language.types.declarations.php                    03-Dec-2023 00:02               41935
language.types.enumerations.php                    03-Dec-2023 00:02                3628
language.types.float.php                           03-Dec-2023 00:02                9176
language.types.integer.php                         03-Dec-2023 00:02               18965
language.types.intro.php                           03-Dec-2023 00:02                7935
language.types.iterable.php                        03-Dec-2023 00:02                3005
language.types.mixed.php                           03-Dec-2023 00:02                1785
language.types.never.php                           03-Dec-2023 00:02                1889
language.types.null.php                            03-Dec-2023 00:02                3116
language.types.numeric-strings.php                 03-Dec-2023 00:02                9664
language.types.object.php                          03-Dec-2023 00:02                5241
language.types.php                                 03-Dec-2023 00:02                2810
language.types.relative-class-types.php            03-Dec-2023 00:02                2447
language.types.resource.php                        03-Dec-2023 00:02                2841
language.types.string.php                          03-Dec-2023 00:02               78412
language.types.type-juggling.php                   03-Dec-2023 00:02               24360
language.types.type-system.php                     03-Dec-2023 00:02                8086
language.types.value.php                           03-Dec-2023 00:02                2092
language.types.void.php                            03-Dec-2023 00:02                1789
language.variables.basics.php                      03-Dec-2023 00:02               13590
language.variables.external.php                    03-Dec-2023 00:02               17430
language.variables.php                             03-Dec-2023 00:02                1767
language.variables.predefined.php                  03-Dec-2023 00:02                2987
language.variables.scope.php                       03-Dec-2023 00:02               27948
language.variables.superglobals.php                03-Dec-2023 00:02                4481
language.variables.variable.php                    03-Dec-2023 00:02               10194
ldap.configuration.php                             03-Dec-2023 00:02                2382
ldap.constants.php                                 03-Dec-2023 00:02               24543
ldap.controls.php                                  03-Dec-2023 00:02                8526
ldap.examples-basic.php                            03-Dec-2023 00:02                8064
ldap.examples-controls.php                         03-Dec-2023 00:02               15950
ldap.examples.php                                  03-Dec-2023 00:02                1363
ldap.installation.php                              03-Dec-2023 00:02                2861
ldap.requirements.php                              03-Dec-2023 00:02                1556
ldap.resources.php                                 03-Dec-2023 00:02                1443
ldap.setup.php                                     03-Dec-2023 00:02                1630
ldap.using.php                                     03-Dec-2023 00:02                2189
libxml.configuration.php                           03-Dec-2023 00:02                1312
libxml.constants.php                               03-Dec-2023 00:02                6356
libxml.installation.php                            03-Dec-2023 00:02                1293
libxml.requirements.php                            03-Dec-2023 00:02                1310
libxml.resources.php                               03-Dec-2023 00:02                1250
libxml.setup.php                                   03-Dec-2023 00:02                1648
limititerator.construct.php                        03-Dec-2023 00:02                7133
limititerator.current.php                          03-Dec-2023 00:02                3642
limititerator.getposition.php                      03-Dec-2023 00:02                2266
limititerator.key.php                              03-Dec-2023 00:02                3768
limititerator.next.php                             03-Dec-2023 00:02                2289
limititerator.rewind.php                           03-Dec-2023 00:02                2391
limititerator.seek.php                             03-Dec-2023 00:02                2493
limititerator.valid.php                            03-Dec-2023 00:02                2417
locale.acceptfromhttp.php                          03-Dec-2023 00:02                5763
locale.canonicalize.php                            03-Dec-2023 00:02                2855
locale.composelocale.php                           03-Dec-2023 00:02               12898
locale.filtermatches.php                           03-Dec-2023 00:02                8331
locale.getallvariants.php                          03-Dec-2023 00:02                6089
locale.getdefault.php                              03-Dec-2023 00:02                5677
locale.getdisplaylanguage.php                      03-Dec-2023 00:02                9195
locale.getdisplayname.php                          03-Dec-2023 00:02                9179
locale.getdisplayregion.php                        03-Dec-2023 00:02                9143
locale.getdisplayscript.php                        03-Dec-2023 00:02                9150
locale.getdisplayvariant.php                       03-Dec-2023 00:02                9191
locale.getkeywords.php                             03-Dec-2023 00:02                6670
locale.getprimarylanguage.php                      03-Dec-2023 00:02                5595
locale.getregion.php                               03-Dec-2023 00:02                5485
locale.getscript.php                               03-Dec-2023 00:02                5272
locale.lookup.php                                  03-Dec-2023 00:02                8986
locale.parselocale.php                             03-Dec-2023 00:02                6887
locale.setdefault.php                              03-Dec-2023 00:02                5023
lua.assign.php                                     03-Dec-2023 00:02                4477
lua.call.php                                       03-Dec-2023 00:02                7259
lua.configuration.php                              03-Dec-2023 00:02                1291
lua.construct.php                                  03-Dec-2023 00:02                2313
lua.eval.php                                       03-Dec-2023 00:02                3619
lua.getversion.php                                 03-Dec-2023 00:02                2202
lua.include.php                                    03-Dec-2023 00:02                2598
lua.installation.php                               03-Dec-2023 00:02                2073
lua.registercallback.php                           03-Dec-2023 00:02                4452
lua.requirements.php                               03-Dec-2023 00:02                1363
lua.resources.php                                  03-Dec-2023 00:02                1223
lua.setup.php                                      03-Dec-2023 00:02                1593
luaclosure.invoke.php                              03-Dec-2023 00:02                4491
luasandbox.callfunction.php                        03-Dec-2023 00:02                4784
luasandbox.configuration.php                       03-Dec-2023 00:02                1337
luasandbox.disableprofiler.php                     03-Dec-2023 00:02                2845
luasandbox.enableprofiler.php                      03-Dec-2023 00:02                3392
luasandbox.examples-basic.php                      03-Dec-2023 00:02                6593
luasandbox.examples.php                            03-Dec-2023 00:02                1423
luasandbox.getcpuusage.php                         03-Dec-2023 00:02                3575
luasandbox.getmemoryusage.php                      03-Dec-2023 00:02                3155
luasandbox.getpeakmemoryusage.php                  03-Dec-2023 00:02                3205
luasandbox.getprofilerfunctionreport.php           03-Dec-2023 00:02                5505
luasandbox.getversioninfo.php                      03-Dec-2023 00:02                2901
luasandbox.installation.php                        03-Dec-2023 00:02                2170
luasandbox.loadbinary.php                          03-Dec-2023 00:02                3507
luasandbox.loadstring.php                          03-Dec-2023 00:02                5479
luasandbox.pauseusagetimer.php                     03-Dec-2023 00:02                9269
luasandbox.registerlibrary.php                     03-Dec-2023 00:02                6442
luasandbox.requirements.php                        03-Dec-2023 00:02                1805
luasandbox.resources.php                           03-Dec-2023 00:02                1285
luasandbox.setcpulimit.php                         03-Dec-2023 00:02                5862
luasandbox.setmemorylimit.php                      03-Dec-2023 00:02                5451
luasandbox.setup.php                               03-Dec-2023 00:02                1681
luasandbox.unpauseusagetimer.php                   03-Dec-2023 00:02                3141
luasandbox.wrapphpfunction.php                     03-Dec-2023 00:02                4325
luasandboxfunction.call.php                        03-Dec-2023 00:02                6861
luasandboxfunction.construct.php                   03-Dec-2023 00:02                2658
luasandboxfunction.dump.php                        03-Dec-2023 00:02                2360
lzf.configuration.php                              03-Dec-2023 00:02                1291
lzf.constants.php                                  03-Dec-2023 00:02                1136
lzf.installation.php                               03-Dec-2023 00:02                2540
lzf.requirements.php                               03-Dec-2023 00:02                1236
lzf.resources.php                                  03-Dec-2023 00:02                1229
lzf.setup.php                                      03-Dec-2023 00:02                1614
mail.configuration.php                             03-Dec-2023 00:02                7601
mail.constants.php                                 03-Dec-2023 00:02                1145
mail.installation.php                              03-Dec-2023 00:02                1276
mail.requirements.php                              03-Dec-2023 00:02                1916
mail.resources.php                                 03-Dec-2023 00:02                1233
mail.setup.php                                     03-Dec-2023 00:02                1624
mailparse.configuration.php                        03-Dec-2023 00:02                2508
mailparse.constants.php                            03-Dec-2023 00:02                1996
mailparse.installation.php                         03-Dec-2023 00:02                2542
mailparse.requirements.php                         03-Dec-2023 00:02                1275
mailparse.resources.php                            03-Dec-2023 00:02                1586
mailparse.setup.php                                03-Dec-2023 00:02                1689
manual.php                                         03-Dec-2023 00:02                1250
math.configuration.php                             03-Dec-2023 00:02                1298
math.constants.php                                 03-Dec-2023 00:02                6013
math.installation.php                              03-Dec-2023 00:02                1279
math.requirements.php                              03-Dec-2023 00:02                1243
math.resources.php                                 03-Dec-2023 00:02                1236
math.setup.php                                     03-Dec-2023 00:02                1622
mbstring.configuration.php                         03-Dec-2023 00:02               15282
mbstring.constants.php                             03-Dec-2023 00:02                5385
mbstring.encodings.php                             03-Dec-2023 00:02               15435
mbstring.http.php                                  03-Dec-2023 00:02                5081
mbstring.installation.php                          03-Dec-2023 00:02                3368
mbstring.ja-basic.php                              03-Dec-2023 00:02                3930
mbstring.overload.php                              03-Dec-2023 00:02                7167
mbstring.php4.req.php                              03-Dec-2023 00:02                3973
mbstring.requirements.php                          03-Dec-2023 00:02                1268
mbstring.resources.php                             03-Dec-2023 00:02                1261
mbstring.setup.php                                 03-Dec-2023 00:02                1689
mbstring.supported-encodings.php                   03-Dec-2023 00:02                8150
mcrypt.ciphers.php                                 03-Dec-2023 00:02                6216
mcrypt.configuration.php                           03-Dec-2023 00:02                3460
mcrypt.constants.php                               03-Dec-2023 00:02                5867
mcrypt.installation.php                            03-Dec-2023 00:02                1847
mcrypt.requirements.php                            03-Dec-2023 00:02                2166
mcrypt.resources.php                               03-Dec-2023 00:02                1346
mcrypt.setup.php                                   03-Dec-2023 00:02                1656
memcache.add.php                                   03-Dec-2023 00:02                6837
memcache.addserver.php                             03-Dec-2023 00:02               13073
memcache.close.php                                 03-Dec-2023 00:02                5012
memcache.connect.php                               03-Dec-2023 00:02                7110
memcache.constants.php                             03-Dec-2023 00:02                4234
memcache.decrement.php                             03-Dec-2023 00:02                7008
memcache.delete.php                                03-Dec-2023 00:02                6261
memcache.examples-overview.php                     03-Dec-2023 00:02                6399
memcache.examples.php                              03-Dec-2023 00:02                1363
memcache.flush.php                                 03-Dec-2023 00:02                4398
memcache.get.php                                   03-Dec-2023 00:02                8303
memcache.getextendedstats.php                      03-Dec-2023 00:02                7847
memcache.getserverstatus.php                       03-Dec-2023 00:02                6014
memcache.getstats.php                              03-Dec-2023 00:02                4528
memcache.getversion.php                            03-Dec-2023 00:02                4905
memcache.increment.php                             03-Dec-2023 00:02                6806
memcache.ini.php                                   03-Dec-2023 00:02                9685
memcache.installation.php                          03-Dec-2023 00:02                2180
memcache.pconnect.php                              03-Dec-2023 00:02                6092
memcache.replace.php                               03-Dec-2023 00:02                6940
memcache.requirements.php                          03-Dec-2023 00:02                1395
memcache.resources.php                             03-Dec-2023 00:02                1324
memcache.set.php                                   03-Dec-2023 00:02                9284
memcache.setcompressthreshold.php                  03-Dec-2023 00:02                5726
memcache.setserverparams.php                       03-Dec-2023 00:02               10624
memcache.setup.php                                 03-Dec-2023 00:02                1671
memcached.add.php                                  03-Dec-2023 00:02                4405
memcached.addbykey.php                             03-Dec-2023 00:02                5339
memcached.addserver.php                            03-Dec-2023 00:02                7338
memcached.addservers.php                           03-Dec-2023 00:02                5299
memcached.append.php                               03-Dec-2023 00:02                6906
memcached.appendbykey.php                          03-Dec-2023 00:02                4672
memcached.callbacks.php                            03-Dec-2023 00:02                1501
memcached.callbacks.read-through.php               03-Dec-2023 00:02                4371
memcached.callbacks.result.php                     03-Dec-2023 00:02                4882
memcached.cas.php                                  03-Dec-2023 00:02                9073
memcached.casbykey.php                             03-Dec-2023 00:02                5470
memcached.configuration.php                        03-Dec-2023 00:02               24092
memcached.constants.php                            03-Dec-2023 00:02               23083
memcached.construct.php                            03-Dec-2023 00:02                5373
memcached.decrement.php                            03-Dec-2023 00:02                8834
memcached.decrementbykey.php                       03-Dec-2023 00:02                5654
memcached.delete.php                               03-Dec-2023 00:02                5359
memcached.deletebykey.php                          03-Dec-2023 00:02                5294
memcached.deletemulti.php                          03-Dec-2023 00:02                4708
memcached.deletemultibykey.php                     03-Dec-2023 00:02                5639
memcached.expiration.php                           03-Dec-2023 00:02                1970
memcached.fetch.php                                03-Dec-2023 00:02                6565
memcached.fetchall.php                             03-Dec-2023 00:02                6407
memcached.flush.php                                03-Dec-2023 00:02                4528
memcached.get.php                                  03-Dec-2023 00:02                9913
memcached.getallkeys.php                           03-Dec-2023 00:02                2947
memcached.getbykey.php                             03-Dec-2023 00:02                6192
memcached.getdelayed.php                           03-Dec-2023 00:02                8464
memcached.getdelayedbykey.php                      03-Dec-2023 00:02                5398
memcached.getmulti.php                             03-Dec-2023 00:02               20083
memcached.getmultibykey.php                        03-Dec-2023 00:02                5357
memcached.getoption.php                            03-Dec-2023 00:02                5139
memcached.getresultcode.php                        03-Dec-2023 00:02                4193
memcached.getresultmessage.php                     03-Dec-2023 00:02                4596
memcached.getserverbykey.php                       03-Dec-2023 00:02                7177
memcached.getserverlist.php                        03-Dec-2023 00:02                4517
memcached.getstats.php                             03-Dec-2023 00:02                5482
memcached.getversion.php                           03-Dec-2023 00:02                3907
memcached.increment.php                            03-Dec-2023 00:02                8166
memcached.incrementbykey.php                       03-Dec-2023 00:02                5589
memcached.installation.php                         03-Dec-2023 00:02                2751
memcached.ispersistent.php                         03-Dec-2023 00:02                2878
memcached.ispristine.php                           03-Dec-2023 00:02                2817
memcached.prepend.php                              03-Dec-2023 00:02                6906
memcached.prependbykey.php                         03-Dec-2023 00:02                4689
memcached.quit.php                                 03-Dec-2023 00:02                2282
memcached.replace.php                              03-Dec-2023 00:02                4472
memcached.replacebykey.php                         03-Dec-2023 00:02                5418
memcached.requirements.php                         03-Dec-2023 00:02                1587
memcached.resetserverlist.php                      03-Dec-2023 00:02                3064
memcached.resources.php                            03-Dec-2023 00:02                1271
memcached.sessions.php                             03-Dec-2023 00:02                2417
memcached.set.php                                  03-Dec-2023 00:02                8931
memcached.setbykey.php                             03-Dec-2023 00:02                6803
memcached.setmulti.php                             03-Dec-2023 00:02                6045
memcached.setmultibykey.php                        03-Dec-2023 00:02                4709
memcached.setoption.php                            03-Dec-2023 00:02                7268
memcached.setoptions.php                           03-Dec-2023 00:02                6796
memcached.setsaslauthdata.php                      03-Dec-2023 00:02                3275
memcached.setup.php                                03-Dec-2023 00:02                1692
memcached.touch.php                                03-Dec-2023 00:02                3543
memcached.touchbykey.php                           03-Dec-2023 00:02                4404
messageformatter.create.php                        03-Dec-2023 00:02               10438
messageformatter.format.php                        03-Dec-2023 00:02                9380
messageformatter.formatmessage.php                 03-Dec-2023 00:02               13662
messageformatter.geterrorcode.php                  03-Dec-2023 00:02                3887
messageformatter.geterrormessage.php               03-Dec-2023 00:02                7485
messageformatter.getlocale.php                     03-Dec-2023 00:02                5312
messageformatter.getpattern.php                    03-Dec-2023 00:02                9756
messageformatter.parse.php                         03-Dec-2023 00:02                9227
messageformatter.parsemessage.php                  03-Dec-2023 00:02                9306
messageformatter.setpattern.php                    03-Dec-2023 00:02               10183
mhash.configuration.php                            03-Dec-2023 00:02                1305
mhash.constants.php                                03-Dec-2023 00:02                3516
mhash.examples.php                                 03-Dec-2023 00:02                3267
mhash.installation.php                             03-Dec-2023 00:02                1649
mhash.requirements.php                             03-Dec-2023 00:02                1387
mhash.resources.php                                03-Dec-2023 00:02                1243
mhash.setup.php                                    03-Dec-2023 00:02                1640
migration56.changed-functions.php                  03-Dec-2023 00:02                6587
migration56.constants.php                          03-Dec-2023 00:02                5215
migration56.deprecated.php                         03-Dec-2023 00:02                5983
migration56.extensions.php                         03-Dec-2023 00:02                4321
migration56.incompatible.php                       03-Dec-2023 00:02                8435
migration56.new-features.php                       03-Dec-2023 00:02               28707
migration56.new-functions.php                      03-Dec-2023 00:02                7499
migration56.openssl.php                            03-Dec-2023 00:02               25654
migration56.php                                    03-Dec-2023 00:02                2471
migration70.changed-functions.php                  03-Dec-2023 00:02                5451
migration70.classes.php                            03-Dec-2023 00:02                3912
migration70.constants.php                          03-Dec-2023 00:02                7107
migration70.deprecated.php                         03-Dec-2023 00:02                5690
migration70.incompatible.php                       03-Dec-2023 00:02               61815
migration70.new-features.php                       03-Dec-2023 00:02               41459
migration70.new-functions.php                      03-Dec-2023 00:02                7386
migration70.other-changes.php                      03-Dec-2023 00:02                3517
migration70.php                                    03-Dec-2023 00:02                3015
migration70.removed-exts-sapis.php                 03-Dec-2023 00:02                3182
migration70.sapi-changes.php                       03-Dec-2023 00:02                2058
migration71.changed-functions.php                  03-Dec-2023 00:02                7198
migration71.constants.php                          03-Dec-2023 00:02                7192
migration71.deprecated.php                         03-Dec-2023 00:02                2250
migration71.incompatible.php                       03-Dec-2023 00:02               31409
migration71.new-features.php                       03-Dec-2023 00:02               26724
migration71.new-functions.php                      03-Dec-2023 00:02                5034
migration71.other-changes.php                      03-Dec-2023 00:02                8134
migration71.php                                    03-Dec-2023 00:02                2475
migration71.windows-support.php                    03-Dec-2023 00:02                7130
migration72.constants.php                          03-Dec-2023 00:02               24724
migration72.deprecated.php                         03-Dec-2023 00:02               10146
migration72.incompatible.php                       03-Dec-2023 00:02               18897
migration72.new-features.php                       03-Dec-2023 00:02               18035
migration72.new-functions.php                      03-Dec-2023 00:02               24382
migration72.other-changes.php                      03-Dec-2023 00:02                5675
migration72.php                                    03-Dec-2023 00:02                2386
migration73.constants.php                          03-Dec-2023 00:02               17746
migration73.deprecated.php                         03-Dec-2023 00:02                8665
migration73.incompatible.php                       03-Dec-2023 00:02               18451
migration73.new-features.php                       03-Dec-2023 00:02               16457
migration73.new-functions.php                      03-Dec-2023 00:02                7442
migration73.other-changes.php                      03-Dec-2023 00:02               15795
migration73.php                                    03-Dec-2023 00:02                2589
migration73.windows-support.php                    03-Dec-2023 00:02                1914
migration74.constants.php                          03-Dec-2023 00:02                5935
migration74.deprecated.php                         03-Dec-2023 00:02               15518
migration74.incompatible.php                       03-Dec-2023 00:02               17614
migration74.new-classes.php                        03-Dec-2023 00:02                1504
migration74.new-features.php                       03-Dec-2023 00:02               21977
migration74.new-functions.php                      03-Dec-2023 00:02                3726
migration74.other-changes.php                      03-Dec-2023 00:02               21538
migration74.php                                    03-Dec-2023 00:02                2808
migration74.removed-extensions.php                 03-Dec-2023 00:02                1939
migration74.windows-support.php                    03-Dec-2023 00:02                3886
migration80.deprecated.php                         03-Dec-2023 00:02               18915
migration80.incompatible.php                       03-Dec-2023 00:02               98635
migration80.new-features.php                       03-Dec-2023 00:02               32546
migration80.other-changes.php                      03-Dec-2023 00:02               15090
migration80.php                                    03-Dec-2023 00:02                2446
migration81.constants.php                          03-Dec-2023 00:02                6285
migration81.deprecated.php                         03-Dec-2023 00:02               18033
migration81.incompatible.php                       03-Dec-2023 00:02               22856
migration81.new-classes.php                        03-Dec-2023 00:02                2124
migration81.new-features.php                       03-Dec-2023 00:02               23533
migration81.new-functions.php                      03-Dec-2023 00:02                8499
migration81.other-changes.php                      03-Dec-2023 00:02                9770
migration81.php                                    03-Dec-2023 00:02                2691
migration82.constants.php                          03-Dec-2023 00:02               16189
migration82.deprecated.php                         03-Dec-2023 00:02                6272
migration82.incompatible.php                       03-Dec-2023 00:02                9536
migration82.new-features.php                       03-Dec-2023 00:02                7166
migration82.new-functions.php                      03-Dec-2023 00:02                4499
migration82.other-changes.php                      03-Dec-2023 00:02               26002
migration82.php                                    03-Dec-2023 00:02                2737
migration82.windows-support.php                    03-Dec-2023 00:02                2367
migration83.constants.php                          03-Dec-2023 00:02               11477
migration83.deprecated.php                         03-Dec-2023 00:02                7233
migration83.incompatible.php                       03-Dec-2023 00:02               14731
migration83.new-classes.php                        03-Dec-2023 00:02                3399
migration83.new-features.php                       03-Dec-2023 00:02                7669
migration83.new-functions.php                      03-Dec-2023 00:02                7654
migration83.other-changes.php                      03-Dec-2023 00:02               31992
migration83.php                                    03-Dec-2023 00:02                2902
migration83.windows-support.php                    03-Dec-2023 00:02                1398
misc.configuration.php                             03-Dec-2023 00:02                5356
misc.constants.php                                 03-Dec-2023 00:02                2040
misc.installation.php                              03-Dec-2023 00:02                1279
misc.requirements.php                              03-Dec-2023 00:02                1243
misc.resources.php                                 03-Dec-2023 00:02                1236
misc.setup.php                                     03-Dec-2023 00:02                1612
mongodb-bson-binary.construct.php                  03-Dec-2023 00:02                7214
mongodb-bson-binary.getdata.php                    03-Dec-2023 00:02                4348
mongodb-bson-binary.gettype.php                    03-Dec-2023 00:02                4332
mongodb-bson-binary.jsonserialize.php              03-Dec-2023 00:02                5551
mongodb-bson-binary.serialize.php                  03-Dec-2023 00:02                3499
mongodb-bson-binary.tostring.php                   03-Dec-2023 00:02                4122
mongodb-bson-binary.unserialize.php                03-Dec-2023 00:02                4339
mongodb-bson-binaryinterface.getdata.php           03-Dec-2023 00:02                2776
mongodb-bson-binaryinterface.gettype.php           03-Dec-2023 00:02                2788
mongodb-bson-binaryinterface.tostring.php          03-Dec-2023 00:02                3259
mongodb-bson-dbpointer.construct.php               03-Dec-2023 00:02                2661
mongodb-bson-dbpointer.jsonserialize.php           03-Dec-2023 00:02                5620
mongodb-bson-dbpointer.serialize.php               03-Dec-2023 00:02                3574
mongodb-bson-dbpointer.tostring.php                03-Dec-2023 00:02                2618
mongodb-bson-dbpointer.unserialize.php             03-Dec-2023 00:02                3808
mongodb-bson-decimal128.construct.php              03-Dec-2023 00:02                5678
mongodb-bson-decimal128.jsonserialize.php          03-Dec-2023 00:02                5641
mongodb-bson-decimal128.serialize.php              03-Dec-2023 00:02                3599
mongodb-bson-decimal128.tostring.php               03-Dec-2023 00:02                4469
mongodb-bson-decimal128.unserialize.php            03-Dec-2023 00:02                4431
mongodb-bson-decimal128interface.tostring.php      03-Dec-2023 00:02                2939
mongodb-bson-document.construct.php                03-Dec-2023 00:02                3320
mongodb-bson-document.frombson.php                 03-Dec-2023 00:02                4003
mongodb-bson-document.fromjson.php                 03-Dec-2023 00:02                4546
mongodb-bson-document.fromphp.php                  03-Dec-2023 00:02                4122
mongodb-bson-document.get.php                      03-Dec-2023 00:02                4234
mongodb-bson-document.getiterator.php              03-Dec-2023 00:02                3561
mongodb-bson-document.has.php                      03-Dec-2023 00:02                3542
mongodb-bson-document.serialize.php                03-Dec-2023 00:02                3563
mongodb-bson-document.tocanonicalextendedjson.php  03-Dec-2023 00:02               12688
mongodb-bson-document.tophp.php                    03-Dec-2023 00:02                5225
mongodb-bson-document.torelaxedextendedjson.php    03-Dec-2023 00:02               12405
mongodb-bson-document.tostring.php                 03-Dec-2023 00:02                2692
mongodb-bson-document.unserialize.php              03-Dec-2023 00:02                4387
mongodb-bson-int64.construct.php                   03-Dec-2023 00:02                4449
mongodb-bson-int64.jsonserialize.php               03-Dec-2023 00:02                5280
mongodb-bson-int64.serialize.php                   03-Dec-2023 00:02                3476
mongodb-bson-int64.tostring.php                    03-Dec-2023 00:02                3772
mongodb-bson-int64.unserialize.php                 03-Dec-2023 00:02                4310
mongodb-bson-iterator.construct.php                03-Dec-2023 00:02                3393
mongodb-bson-iterator.current.php                  03-Dec-2023 00:02                3693
mongodb-bson-iterator.key.php                      03-Dec-2023 00:02                3411
mongodb-bson-iterator.next.php                     03-Dec-2023 00:02                2376
mongodb-bson-iterator.rewind.php                   03-Dec-2023 00:02                2415
mongodb-bson-iterator.valid.php                    03-Dec-2023 00:02                2682
mongodb-bson-javascript.construct.php              03-Dec-2023 00:02                6801
mongodb-bson-javascript.getcode.php                03-Dec-2023 00:02                4320
mongodb-bson-javascript.getscope.php               03-Dec-2023 00:02                5189
mongodb-bson-javascript.jsonserialize.php          03-Dec-2023 00:02                5637
mongodb-bson-javascript.serialize.php              03-Dec-2023 00:02                3599
mongodb-bson-javascript.tostring.php               03-Dec-2023 00:02                4116
mongodb-bson-javascript.unserialize.php            03-Dec-2023 00:02                4423
mongodb-bson-javascriptinterface.getcode.php       03-Dec-2023 00:02                2870
mongodb-bson-javascriptinterface.getscope.php      03-Dec-2023 00:02                2979
mongodb-bson-javascriptinterface.tostring.php      03-Dec-2023 00:02                3357
mongodb-bson-maxkey.construct.php                  03-Dec-2023 00:02                3635
mongodb-bson-maxkey.jsonserialize.php              03-Dec-2023 00:02                5557
mongodb-bson-maxkey.serialize.php                  03-Dec-2023 00:02                3503
mongodb-bson-maxkey.unserialize.php                03-Dec-2023 00:02                3741
mongodb-bson-minkey.construct.php                  03-Dec-2023 00:02                3635
mongodb-bson-minkey.jsonserialize.php              03-Dec-2023 00:02                5557
mongodb-bson-minkey.serialize.php                  03-Dec-2023 00:02                3503
mongodb-bson-minkey.unserialize.php                03-Dec-2023 00:02                3745
mongodb-bson-objectid.construct.php                03-Dec-2023 00:02                5098
mongodb-bson-objectid.gettimestamp.php             03-Dec-2023 00:02                5474
mongodb-bson-objectid.jsonserialize.php            03-Dec-2023 00:02                5603
mongodb-bson-objectid.serialize.php                03-Dec-2023 00:02                3551
mongodb-bson-objectid.tostring.php                 03-Dec-2023 00:02                4115
mongodb-bson-objectid.unserialize.php              03-Dec-2023 00:02                4377
mongodb-bson-objectidinterface.gettimestamp.php    03-Dec-2023 00:02                2941
mongodb-bson-objectidinterface.tostring.php        03-Dec-2023 00:02                2923
mongodb-bson-packedarray.construct.php             03-Dec-2023 00:02                2910
mongodb-bson-packedarray.fromphp.php               03-Dec-2023 00:02                3910
mongodb-bson-packedarray.get.php                   03-Dec-2023 00:02                4289
mongodb-bson-packedarray.getiterator.php           03-Dec-2023 00:02                3615
mongodb-bson-packedarray.has.php                   03-Dec-2023 00:02                3600
mongodb-bson-packedarray.serialize.php             03-Dec-2023 00:02                3595
mongodb-bson-packedarray.tophp.php                 03-Dec-2023 00:02                4369
mongodb-bson-packedarray.tostring.php              03-Dec-2023 00:02                2708
mongodb-bson-packedarray.unserialize.php           03-Dec-2023 00:02                4443
mongodb-bson-persistable.bsonserialize.php         03-Dec-2023 00:02                5948
mongodb-bson-regex.construct.php                   03-Dec-2023 00:02                6800
mongodb-bson-regex.getflags.php                    03-Dec-2023 00:02                4454
mongodb-bson-regex.getpattern.php                  03-Dec-2023 00:02                4301
mongodb-bson-regex.jsonserialize.php               03-Dec-2023 00:02                5536
mongodb-bson-regex.serialize.php                   03-Dec-2023 00:02                3474
mongodb-bson-regex.tostring.php                    03-Dec-2023 00:02                3799
mongodb-bson-regex.unserialize.php                 03-Dec-2023 00:02                4314
mongodb-bson-regexinterface.getflags.php           03-Dec-2023 00:02                2775
mongodb-bson-regexinterface.getpattern.php         03-Dec-2023 00:02                2818
mongodb-bson-regexinterface.tostring.php           03-Dec-2023 00:02                2849
mongodb-bson-serializable.bsonserialize.php        03-Dec-2023 00:02               16070
mongodb-bson-symbol.construct.php                  03-Dec-2023 00:02                2601
mongodb-bson-symbol.jsonserialize.php              03-Dec-2023 00:02                5557
mongodb-bson-symbol.serialize.php                  03-Dec-2023 00:02                3499
mongodb-bson-symbol.tostring.php                   03-Dec-2023 00:02                2596
mongodb-bson-symbol.unserialize.php                03-Dec-2023 00:02                3747
mongodb-bson-timestamp.construct.php               03-Dec-2023 00:02                4590
mongodb-bson-timestamp.getincrement.php            03-Dec-2023 00:02                4302
mongodb-bson-timestamp.gettimestamp.php            03-Dec-2023 00:02                4287
mongodb-bson-timestamp.jsonserialize.php           03-Dec-2023 00:02                5624
mongodb-bson-timestamp.serialize.php               03-Dec-2023 00:02                3574
mongodb-bson-timestamp.tostring.php                03-Dec-2023 00:02                3942
mongodb-bson-timestamp.unserialize.php             03-Dec-2023 00:02                4410
mongodb-bson-timestampinterface.getincrement.php   03-Dec-2023 00:02                3303
mongodb-bson-timestampinterface.gettimestamp.php   03-Dec-2023 00:02                3318
mongodb-bson-timestampinterface.tostring.php       03-Dec-2023 00:02                2941
mongodb-bson-undefined.construct.php               03-Dec-2023 00:02                2661
mongodb-bson-undefined.jsonserialize.php           03-Dec-2023 00:02                5620
mongodb-bson-undefined.serialize.php               03-Dec-2023 00:02                3574
mongodb-bson-undefined.tostring.php                03-Dec-2023 00:02                2618
mongodb-bson-undefined.unserialize.php             03-Dec-2023 00:02                3809
mongodb-bson-unserializable.bsonunserialize.php    03-Dec-2023 00:02                6868
mongodb-bson-utcdatetime.construct.php             03-Dec-2023 00:02                7188
mongodb-bson-utcdatetime.jsonserialize.php         03-Dec-2023 00:02                5662
mongodb-bson-utcdatetime.serialize.php             03-Dec-2023 00:02                3626
mongodb-bson-utcdatetime.todatetime.php            03-Dec-2023 00:02                5830
mongodb-bson-utcdatetime.tostring.php              03-Dec-2023 00:02                3897
mongodb-bson-utcdatetime.unserialize.php           03-Dec-2023 00:02                4442
mongodb-bson-utcdatetimeinterface.todatetime.php   03-Dec-2023 00:02                3278
mongodb-bson-utcdatetimeinterface.tostring.php     03-Dec-2023 00:02                2957
mongodb-driver-bulkwrite.construct.php             03-Dec-2023 00:02               18093
mongodb-driver-bulkwrite.count.php                 03-Dec-2023 00:02                6851
mongodb-driver-bulkwrite.delete.php                03-Dec-2023 00:02               11370
mongodb-driver-bulkwrite.insert.php                03-Dec-2023 00:02                9454
mongodb-driver-bulkwrite.update.php                03-Dec-2023 00:02               14528
mongodb-driver-clientencryption.addkeyaltname.php  03-Dec-2023 00:02                5466
mongodb-driver-clientencryption.construct.php      03-Dec-2023 00:02               11224
mongodb-driver-clientencryption.createdatakey.php  03-Dec-2023 00:02               10936
mongodb-driver-clientencryption.decrypt.php        03-Dec-2023 00:02                4284
mongodb-driver-clientencryption.deletekey.php      03-Dec-2023 00:02                4341
mongodb-driver-clientencryption.encrypt.php        03-Dec-2023 00:02               11643
mongodb-driver-clientencryption.encryptexpressi..> 03-Dec-2023 00:02               13032
mongodb-driver-clientencryption.getkey.php         03-Dec-2023 00:02                4367
mongodb-driver-clientencryption.getkeybyaltname..> 03-Dec-2023 00:02                4932
mongodb-driver-clientencryption.getkeys.php        03-Dec-2023 00:02                3959
mongodb-driver-clientencryption.removekeyaltnam..> 03-Dec-2023 00:02                5531
mongodb-driver-clientencryption.rewrapmanydatak..> 03-Dec-2023 00:02               11919
mongodb-driver-command.construct.php               03-Dec-2023 00:02               13930
mongodb-driver-commandexception.getresultdocume..> 03-Dec-2023 00:02                3191
mongodb-driver-cursor.construct.php                03-Dec-2023 00:02                3380
mongodb-driver-cursor.current.php                  03-Dec-2023 00:02                2870
mongodb-driver-cursor.getid.php                    03-Dec-2023 00:02                7616
mongodb-driver-cursor.getserver.php                03-Dec-2023 00:02                7494
mongodb-driver-cursor.isdead.php                   03-Dec-2023 00:02               10545
mongodb-driver-cursor.key.php                      03-Dec-2023 00:02                2590
mongodb-driver-cursor.next.php                     03-Dec-2023 00:02                3584
mongodb-driver-cursor.rewind.php                   03-Dec-2023 00:02                4003
mongodb-driver-cursor.settypemap.php               03-Dec-2023 00:02                7858
mongodb-driver-cursor.toarray.php                  03-Dec-2023 00:02                7571
mongodb-driver-cursor.valid.php                    03-Dec-2023 00:02                2707
mongodb-driver-cursorid.construct.php              03-Dec-2023 00:02                2823
mongodb-driver-cursorid.serialize.php              03-Dec-2023 00:02                3597
mongodb-driver-cursorid.tostring.php               03-Dec-2023 00:02                6776
mongodb-driver-cursorid.unserialize.php            03-Dec-2023 00:02                4449
mongodb-driver-cursorinterface.getid.php           03-Dec-2023 00:02                4070
mongodb-driver-cursorinterface.getserver.php       03-Dec-2023 00:02                4156
mongodb-driver-cursorinterface.isdead.php          03-Dec-2023 00:02                4002
mongodb-driver-cursorinterface.settypemap.php      03-Dec-2023 00:02                4031
mongodb-driver-cursorinterface.toarray.php         03-Dec-2023 00:02                3902
mongodb-driver-manager.addsubscriber.php           03-Dec-2023 00:02                5619
mongodb-driver-manager.construct.php               03-Dec-2023 00:02               73280
mongodb-driver-manager.createclientencryption.php  03-Dec-2023 00:02               12574
mongodb-driver-manager.executebulkwrite.php        03-Dec-2023 00:02               22841
mongodb-driver-manager.executecommand.php          03-Dec-2023 00:02               24865
mongodb-driver-manager.executequery.php            03-Dec-2023 00:02               16154
mongodb-driver-manager.executereadcommand.php      03-Dec-2023 00:02               10305
mongodb-driver-manager.executereadwritecommand.php 03-Dec-2023 00:02               11289
mongodb-driver-manager.executewritecommand.php     03-Dec-2023 00:02               11331
mongodb-driver-manager.getencryptedfieldsmap.php   03-Dec-2023 00:02                3713
mongodb-driver-manager.getreadconcern.php          03-Dec-2023 00:02                5913
mongodb-driver-manager.getreadpreference.php       03-Dec-2023 00:02                6508
mongodb-driver-manager.getservers.php              03-Dec-2023 00:02                7717
mongodb-driver-manager.getwriteconcern.php         03-Dec-2023 00:02                5966
mongodb-driver-manager.removesubscriber.php        03-Dec-2023 00:02                4996
mongodb-driver-manager.selectserver.php            03-Dec-2023 00:02                7111
mongodb-driver-manager.startsession.php            03-Dec-2023 00:02               11985
mongodb-driver-monitoring-commandfailedevent.ge..> 03-Dec-2023 00:02                3682
mongodb-driver-monitoring-commandfailedevent.ge..> 03-Dec-2023 00:02                3777
mongodb-driver-monitoring-commandfailedevent.ge..> 03-Dec-2023 00:02                3666
mongodb-driver-monitoring-commandfailedevent.ge..> 03-Dec-2023 00:02                4834
mongodb-driver-monitoring-commandfailedevent.ge..> 03-Dec-2023 00:02                4012
mongodb-driver-monitoring-commandfailedevent.ge..> 03-Dec-2023 00:02                4248
mongodb-driver-monitoring-commandfailedevent.ge..> 03-Dec-2023 00:02                4234
mongodb-driver-monitoring-commandfailedevent.ge..> 03-Dec-2023 00:02                3880
mongodb-driver-monitoring-commandfailedevent.ge..> 03-Dec-2023 00:02                3722
mongodb-driver-monitoring-commandstartedevent.g..> 03-Dec-2023 00:02                4019
mongodb-driver-monitoring-commandstartedevent.g..> 03-Dec-2023 00:02                3714
mongodb-driver-monitoring-commandstartedevent.g..> 03-Dec-2023 00:02                3616
mongodb-driver-monitoring-commandstartedevent.g..> 03-Dec-2023 00:02                5158
mongodb-driver-monitoring-commandstartedevent.g..> 03-Dec-2023 00:02                4724
mongodb-driver-monitoring-commandstartedevent.g..> 03-Dec-2023 00:02                4540
mongodb-driver-monitoring-commandstartedevent.g..> 03-Dec-2023 00:02                3900
mongodb-driver-monitoring-commandstartedevent.g..> 03-Dec-2023 00:02                3742
mongodb-driver-monitoring-commandsubscriber.com..> 03-Dec-2023 00:02                4963
mongodb-driver-monitoring-commandsubscriber.com..> 03-Dec-2023 00:02                5013
mongodb-driver-monitoring-commandsubscriber.com..> 03-Dec-2023 00:02                5026
mongodb-driver-monitoring-commandsucceededevent..> 03-Dec-2023 00:02                3739
mongodb-driver-monitoring-commandsucceededevent..> 03-Dec-2023 00:02                3846
mongodb-driver-monitoring-commandsucceededevent..> 03-Dec-2023 00:02                4921
mongodb-driver-monitoring-commandsucceededevent..> 03-Dec-2023 00:02                4069
mongodb-driver-monitoring-commandsucceededevent..> 03-Dec-2023 00:02                4311
mongodb-driver-monitoring-commandsucceededevent..> 03-Dec-2023 00:02                4769
mongodb-driver-monitoring-commandsucceededevent..> 03-Dec-2023 00:02                3940
mongodb-driver-monitoring-commandsucceededevent..> 03-Dec-2023 00:02                3768
mongodb-driver-monitoring-logsubscriber.log.php    03-Dec-2023 00:02                4478
mongodb-driver-monitoring-sdamsubscriber.server..> 03-Dec-2023 00:02                4831
mongodb-driver-monitoring-sdamsubscriber.server..> 03-Dec-2023 00:02                4801
mongodb-driver-monitoring-sdamsubscriber.server..> 03-Dec-2023 00:02                5368
mongodb-driver-monitoring-sdamsubscriber.server..> 03-Dec-2023 00:02                5413
mongodb-driver-monitoring-sdamsubscriber.server..> 03-Dec-2023 00:02                5444
mongodb-driver-monitoring-sdamsubscriber.server..> 03-Dec-2023 00:02                4831
mongodb-driver-monitoring-sdamsubscriber.topolo..> 03-Dec-2023 00:02                4906
mongodb-driver-monitoring-sdamsubscriber.topolo..> 03-Dec-2023 00:02                4843
mongodb-driver-monitoring-sdamsubscriber.topolo..> 03-Dec-2023 00:02                4826
mongodb-driver-monitoring-serverchangedevent.ge..> 03-Dec-2023 00:02                3134
mongodb-driver-monitoring-serverchangedevent.ge..> 03-Dec-2023 00:02                3510
mongodb-driver-monitoring-serverchangedevent.ge..> 03-Dec-2023 00:02                3204
mongodb-driver-monitoring-serverchangedevent.ge..> 03-Dec-2023 00:02                3587
mongodb-driver-monitoring-serverchangedevent.ge..> 03-Dec-2023 00:02                3310
mongodb-driver-monitoring-serverclosedevent.get..> 03-Dec-2023 00:02                3096
mongodb-driver-monitoring-serverclosedevent.get..> 03-Dec-2023 00:02                3148
mongodb-driver-monitoring-serverclosedevent.get..> 03-Dec-2023 00:02                3266
mongodb-driver-monitoring-serverheartbeatfailed..> 03-Dec-2023 00:02                3584
mongodb-driver-monitoring-serverheartbeatfailed..> 03-Dec-2023 00:02                3494
mongodb-driver-monitoring-serverheartbeatfailed..> 03-Dec-2023 00:02                3271
mongodb-driver-monitoring-serverheartbeatfailed..> 03-Dec-2023 00:02                3302
mongodb-driver-monitoring-serverheartbeatfailed..> 03-Dec-2023 00:02                3553
mongodb-driver-monitoring-serverheartbeatstarte..> 03-Dec-2023 00:02                3276
mongodb-driver-monitoring-serverheartbeatstarte..> 03-Dec-2023 00:02                3320
mongodb-driver-monitoring-serverheartbeatstarte..> 03-Dec-2023 00:02                3573
mongodb-driver-monitoring-serverheartbeatsuccee..> 03-Dec-2023 00:02                3636
mongodb-driver-monitoring-serverheartbeatsuccee..> 03-Dec-2023 00:02                3343
mongodb-driver-monitoring-serverheartbeatsuccee..> 03-Dec-2023 00:02                3354
mongodb-driver-monitoring-serverheartbeatsuccee..> 03-Dec-2023 00:02                4206
mongodb-driver-monitoring-serverheartbeatsuccee..> 03-Dec-2023 00:02                3589
mongodb-driver-monitoring-serveropeningevent.ge..> 03-Dec-2023 00:02                3114
mongodb-driver-monitoring-serveropeningevent.ge..> 03-Dec-2023 00:02                3166
mongodb-driver-monitoring-serveropeningevent.ge..> 03-Dec-2023 00:02                3298
mongodb-driver-monitoring-topologychangedevent...> 03-Dec-2023 00:02                3579
mongodb-driver-monitoring-topologychangedevent...> 03-Dec-2023 00:02                3657
mongodb-driver-monitoring-topologychangedevent...> 03-Dec-2023 00:02                3318
mongodb-driver-monitoring-topologyclosedevent.g..> 03-Dec-2023 00:02                3263
mongodb-driver-monitoring-topologyopeningevent...> 03-Dec-2023 00:02                3273
mongodb-driver-query.construct.php                 03-Dec-2023 00:02               30462
mongodb-driver-readconcern.bsonserialize.php       03-Dec-2023 00:02                6758
mongodb-driver-readconcern.construct.php           03-Dec-2023 00:02                5609
mongodb-driver-readconcern.getlevel.php            03-Dec-2023 00:02                5669
mongodb-driver-readconcern.isdefault.php           03-Dec-2023 00:02                7912
mongodb-driver-readconcern.serialize.php           03-Dec-2023 00:02                3674
mongodb-driver-readconcern.unserialize.php         03-Dec-2023 00:02                4500
mongodb-driver-readpreference.bsonserialize.php    03-Dec-2023 00:02               10364
mongodb-driver-readpreference.construct.php        03-Dec-2023 00:02               16812
mongodb-driver-readpreference.gethedge.php         03-Dec-2023 00:02                3334
mongodb-driver-readpreference.getmaxstalenessse..> 03-Dec-2023 00:02                7988
mongodb-driver-readpreference.getmode.php          03-Dec-2023 00:02                7438
mongodb-driver-readpreference.getmodestring.php    03-Dec-2023 00:02                7642
mongodb-driver-readpreference.gettagsets.php       03-Dec-2023 00:02                7984
mongodb-driver-readpreference.serialize.php        03-Dec-2023 00:02                3751
mongodb-driver-readpreference.unserialize.php      03-Dec-2023 00:02                4579
mongodb-driver-runtimeexception.haserrorlabel.php  03-Dec-2023 00:02                4172
mongodb-driver-server.construct.php                03-Dec-2023 00:02                3382
mongodb-driver-server.executebulkwrite.php         03-Dec-2023 00:02               11178
mongodb-driver-server.executecommand.php           03-Dec-2023 00:02               13281
mongodb-driver-server.executequery.php             03-Dec-2023 00:02                8408
mongodb-driver-server.executereadcommand.php       03-Dec-2023 00:02               10665
mongodb-driver-server.executereadwritecommand.php  03-Dec-2023 00:02               11819
mongodb-driver-server.executewritecommand.php      03-Dec-2023 00:02               11827
mongodb-driver-server.gethost.php                  03-Dec-2023 00:02                5403
mongodb-driver-server.getinfo.php                  03-Dec-2023 00:02               10570
mongodb-driver-server.getlatency.php               03-Dec-2023 00:02                6923
mongodb-driver-server.getport.php                  03-Dec-2023 00:02                5447
mongodb-driver-server.getserverdescription.php     03-Dec-2023 00:02                3434
mongodb-driver-server.gettags.php                  03-Dec-2023 00:02                3577
mongodb-driver-server.gettype.php                  03-Dec-2023 00:02                3688
mongodb-driver-server.isarbiter.php                03-Dec-2023 00:02                3502
mongodb-driver-server.ishidden.php                 03-Dec-2023 00:02                3496
mongodb-driver-server.ispassive.php                03-Dec-2023 00:02                3564
mongodb-driver-server.isprimary.php                03-Dec-2023 00:02                3509
mongodb-driver-server.issecondary.php              03-Dec-2023 00:02                3544
mongodb-driver-serverapi.bsonserialize.php         03-Dec-2023 00:02                3333
mongodb-driver-serverapi.construct.php             03-Dec-2023 00:02                4569
mongodb-driver-serverapi.serialize.php             03-Dec-2023 00:02                3627
mongodb-driver-serverapi.unserialize.php           03-Dec-2023 00:02                4467
mongodb-driver-serverdescription.gethellorespon..> 03-Dec-2023 00:02                5194
mongodb-driver-serverdescription.gethost.php       03-Dec-2023 00:02                3413
mongodb-driver-serverdescription.getlastupdatet..> 03-Dec-2023 00:02                3551
mongodb-driver-serverdescription.getport.php       03-Dec-2023 00:02                3470
mongodb-driver-serverdescription.getroundtripti..> 03-Dec-2023 00:02                3813
mongodb-driver-serverdescription.gettype.php       03-Dec-2023 00:02                3683
mongodb-driver-session.aborttransaction.php        03-Dec-2023 00:02                4250
mongodb-driver-session.advanceclustertime.php      03-Dec-2023 00:02                4782
mongodb-driver-session.advanceoperationtime.php    03-Dec-2023 00:02                4840
mongodb-driver-session.committransaction.php       03-Dec-2023 00:02                5641
mongodb-driver-session.construct.php               03-Dec-2023 00:02                2890
mongodb-driver-session.endsession.php              03-Dec-2023 00:02                4382
mongodb-driver-session.getclustertime.php          03-Dec-2023 00:02                3783
mongodb-driver-session.getlogicalsessionid.php     03-Dec-2023 00:02                3084
mongodb-driver-session.getoperationtime.php        03-Dec-2023 00:02                3923
mongodb-driver-session.getserver.php               03-Dec-2023 00:02                3801
mongodb-driver-session.gettransactionoptions.php   03-Dec-2023 00:02                3633
mongodb-driver-session.gettransactionstate.php     03-Dec-2023 00:02                3715
mongodb-driver-session.isdirty.php                 03-Dec-2023 00:02                2970
mongodb-driver-session.isintransaction.php         03-Dec-2023 00:02                3660
mongodb-driver-session.starttransaction.php        03-Dec-2023 00:02                9098
mongodb-driver-topologydescription.getservers.php  03-Dec-2023 00:02                3413
mongodb-driver-topologydescription.gettype.php     03-Dec-2023 00:02                3339
mongodb-driver-topologydescription.hasreadables..> 03-Dec-2023 00:02                3818
mongodb-driver-topologydescription.haswritables..> 03-Dec-2023 00:02                3180
mongodb-driver-writeconcern.bsonserialize.php      03-Dec-2023 00:02                7203
mongodb-driver-writeconcern.construct.php          03-Dec-2023 00:02               10073
mongodb-driver-writeconcern.getjournal.php         03-Dec-2023 00:02                5856
mongodb-driver-writeconcern.getw.php               03-Dec-2023 00:02                5087
mongodb-driver-writeconcern.getwtimeout.php        03-Dec-2023 00:02                5824
mongodb-driver-writeconcern.isdefault.php          03-Dec-2023 00:02                7714
mongodb-driver-writeconcern.serialize.php          03-Dec-2023 00:02                3699
mongodb-driver-writeconcern.unserialize.php        03-Dec-2023 00:02                4539
mongodb-driver-writeconcernerror.getcode.php       03-Dec-2023 00:02                6250
mongodb-driver-writeconcernerror.getinfo.php       03-Dec-2023 00:02                6467
mongodb-driver-writeconcernerror.getmessage.php    03-Dec-2023 00:02                6339
mongodb-driver-writeerror.getcode.php              03-Dec-2023 00:02                5578
mongodb-driver-writeerror.getindex.php             03-Dec-2023 00:02                6121
mongodb-driver-writeerror.getinfo.php              03-Dec-2023 00:02                2974
mongodb-driver-writeerror.getmessage.php           03-Dec-2023 00:02                5712
mongodb-driver-writeexception.getwriteresult.php   03-Dec-2023 00:02                7896
mongodb-driver-writeresult.getdeletedcount.php     03-Dec-2023 00:02                7975
mongodb-driver-writeresult.getinsertedcount.php    03-Dec-2023 00:02                8057
mongodb-driver-writeresult.getmatchedcount.php     03-Dec-2023 00:02                8635
mongodb-driver-writeresult.getmodifiedcount.php    03-Dec-2023 00:02                8882
mongodb-driver-writeresult.getserver.php           03-Dec-2023 00:02                6515
mongodb-driver-writeresult.getupsertedcount.php    03-Dec-2023 00:02                8212
mongodb-driver-writeresult.getupsertedids.php      03-Dec-2023 00:02                8753
mongodb-driver-writeresult.getwriteconcernerror..> 03-Dec-2023 00:02                7094
mongodb-driver-writeresult.getwriteerrors.php      03-Dec-2023 00:02               12913
mongodb-driver-writeresult.isacknowledged.php      03-Dec-2023 00:02                7982
mongodb.architecture.php                           03-Dec-2023 00:02                1925
mongodb.configuration.php                          03-Dec-2023 00:02                3941
mongodb.connection-handling.php                    03-Dec-2023 00:02                8693
mongodb.constants.php                              03-Dec-2023 00:02                1945
mongodb.exceptions.php                             03-Dec-2023 00:02                5152
mongodb.exceptions.tree.php                        03-Dec-2023 00:02                5562
mongodb.installation.homebrew.php                  03-Dec-2023 00:02                1990
mongodb.installation.manual.php                    03-Dec-2023 00:02                6149
mongodb.installation.pecl.php                      03-Dec-2023 00:02                4961
mongodb.installation.php                           03-Dec-2023 00:02                1808
mongodb.installation.windows.php                   03-Dec-2023 00:02                4211
mongodb.monitoring.php                             03-Dec-2023 00:02               18991
mongodb.overview.php                               03-Dec-2023 00:02                4677
mongodb.persistence.deserialization.php            03-Dec-2023 00:02               21686
mongodb.persistence.php                            03-Dec-2023 00:02                1801
mongodb.persistence.serialization.php              03-Dec-2023 00:02               20077
mongodb.requirements.php                           03-Dec-2023 00:02                3186
mongodb.security.php                               03-Dec-2023 00:02                1487
mongodb.security.request_injection.php             03-Dec-2023 00:02                2973
mongodb.security.script_injection.php              03-Dec-2023 00:02                9162
mongodb.setup.php                                  03-Dec-2023 00:02                2112
mongodb.tutorial.apm.php                           03-Dec-2023 00:02               18730
mongodb.tutorial.library.php                       03-Dec-2023 00:02               10672
mongodb.tutorial.php                               03-Dec-2023 00:02                1708
mqseries.configure.php                             03-Dec-2023 00:02                2862
mqseries.constants.php                             03-Dec-2023 00:02                2145
mqseries.ini.php                                   03-Dec-2023 00:02                1367
mqseries.requirements.php                          03-Dec-2023 00:02                1660
mqseries.resources.php                             03-Dec-2023 00:02                1706
mqseries.setup.php                                 03-Dec-2023 00:02                1674
multipleiterator.attachiterator.php                03-Dec-2023 00:02                4160
multipleiterator.construct.php                     03-Dec-2023 00:02                7986
multipleiterator.containsiterator.php              03-Dec-2023 00:02                3322
multipleiterator.countiterators.php                03-Dec-2023 00:02                2998
multipleiterator.current.php                       03-Dec-2023 00:02                4255
multipleiterator.detachiterator.php                03-Dec-2023 00:02                3200
multipleiterator.getflags.php                      03-Dec-2023 00:02                3166
multipleiterator.key.php                           03-Dec-2023 00:02                4121
multipleiterator.next.php                          03-Dec-2023 00:02                2822
multipleiterator.rewind.php                        03-Dec-2023 00:02                2840
multipleiterator.setflags.php                      03-Dec-2023 00:02                3473
multipleiterator.valid.php                         03-Dec-2023 00:02                2910
mysql-xdevapi-baseresult.getwarnings.php           03-Dec-2023 00:02                6880
mysql-xdevapi-baseresult.getwarningscount.php      03-Dec-2023 00:02                6597
mysql-xdevapi-client.close.php                     03-Dec-2023 00:02                2323
mysql-xdevapi-client.construct.php                 03-Dec-2023 00:02                3432
mysql-xdevapi-client.getsession.php                03-Dec-2023 00:02                2389
mysql-xdevapi-collection.add.php                   03-Dec-2023 00:02                9459
mysql-xdevapi-collection.addorreplaceone.php       03-Dec-2023 00:02                8291
mysql-xdevapi-collection.construct.php             03-Dec-2023 00:02                6440
mysql-xdevapi-collection.count.php                 03-Dec-2023 00:02                6428
mysql-xdevapi-collection.createindex.php           03-Dec-2023 00:02                9112
mysql-xdevapi-collection.dropindex.php             03-Dec-2023 00:02                6627
mysql-xdevapi-collection.existsindatabase.php      03-Dec-2023 00:02                5925
mysql-xdevapi-collection.find.php                  03-Dec-2023 00:02                9580
mysql-xdevapi-collection.getname.php               03-Dec