Index of /php/manual/pt_BR/


../
feeds/                                             24-Jun-2024 06:06                   -
images/                                            24-Jun-2024 06:06                   -
styles/                                            24-Jun-2024 06:05                   -
toc/                                               24-Jun-2024 06:06                   -
about.formats.php                                  24-Jun-2024 06:06                4334
about.generate.php                                 24-Jun-2024 06:06                2769
about.howtohelp.php                                24-Jun-2024 06:06                3615
about.more.php                                     24-Jun-2024 06:06                1963
about.notes.php                                    24-Jun-2024 06:06                2542
about.php                                          24-Jun-2024 06:06                1997
about.phpversions.php                              24-Jun-2024 06:06                3570
about.prototypes.php                               24-Jun-2024 06:06                7768
about.translations.php                             24-Jun-2024 06:06                3269
aliases.php                                        24-Jun-2024 06:06               29267
allowdynamicproperties.construct.php               24-Jun-2024 06:05                2285
apache.configuration.php                           24-Jun-2024 06:05                5432
apache.constants.php                               24-Jun-2024 06:05                1234
apache.installation.php                            24-Jun-2024 06:05                1370
apache.requirements.php                            24-Jun-2024 06:05                1317
apache.resources.php                               24-Jun-2024 06:05                1310
apache.setup.php                                   24-Jun-2024 06:05                1727
apcu.configuration.php                             24-Jun-2024 06:05               16824
apcu.constants.php                                 24-Jun-2024 06:05                7482
apcu.installation.php                              24-Jun-2024 06:05                3490
apcu.requirements.php                              24-Jun-2024 06:05                1303
apcu.resources.php                                 24-Jun-2024 06:05                1296
apcu.setup.php                                     24-Jun-2024 06:05                1685
apcuiterator.construct.php                         24-Jun-2024 06:05                7248
apcuiterator.current.php                           24-Jun-2024 06:05                3043
apcuiterator.gettotalcount.php                     24-Jun-2024 06:05                3280
apcuiterator.gettotalhits.php                      24-Jun-2024 06:05                3436
apcuiterator.gettotalsize.php                      24-Jun-2024 06:05                3128
apcuiterator.key.php                               24-Jun-2024 06:05                2846
apcuiterator.next.php                              24-Jun-2024 06:05                3116
apcuiterator.rewind.php                            24-Jun-2024 06:05                2762
apcuiterator.valid.php                             24-Jun-2024 06:05                3018
appendices.php                                     24-Jun-2024 06:06               13692
appenditerator.append.php                          24-Jun-2024 06:05                5508
appenditerator.construct.php                       24-Jun-2024 06:05               10179
appenditerator.current.php                         24-Jun-2024 06:05                3488
appenditerator.getarrayiterator.php                24-Jun-2024 06:05                3113
appenditerator.getiteratorindex.php                24-Jun-2024 06:05                6694
appenditerator.key.php                             24-Jun-2024 06:05                7932
appenditerator.next.php                            24-Jun-2024 06:05                3412
appenditerator.rewind.php                          24-Jun-2024 06:05                3402
appenditerator.valid.php                           24-Jun-2024 06:05                3388
array.configuration.php                            24-Jun-2024 06:06                1359
array.constants.php                                24-Jun-2024 06:06               11929
array.requirements.php                             24-Jun-2024 06:06                1340
array.resources.php                                24-Jun-2024 06:06                1303
array.setup.php                                    24-Jun-2024 06:06                1621
array.sorting.php                                  24-Jun-2024 06:06                7048
arrayaccess.offsetexists.php                       24-Jun-2024 06:05                9167
arrayaccess.offsetget.php                          24-Jun-2024 06:05                5022
arrayaccess.offsetset.php                          24-Jun-2024 06:05                5241
arrayaccess.offsetunset.php                        24-Jun-2024 06:05                2864
arrayiterator.append.php                           24-Jun-2024 06:05                3581
arrayiterator.asort.php                            24-Jun-2024 06:05                7507
arrayiterator.construct.php                        24-Jun-2024 06:05                3814
arrayiterator.count.php                            24-Jun-2024 06:05                3265
arrayiterator.current.php                          24-Jun-2024 06:05                5243
arrayiterator.getarraycopy.php                     24-Jun-2024 06:05                3135
arrayiterator.getflags.php                         24-Jun-2024 06:05                3159
arrayiterator.key.php                              24-Jun-2024 06:05                4084
arrayiterator.ksort.php                            24-Jun-2024 06:05                7454
arrayiterator.natcasesort.php                      24-Jun-2024 06:05                4984
arrayiterator.natsort.php                          24-Jun-2024 06:05                4860
arrayiterator.next.php                             24-Jun-2024 06:05                4683
arrayiterator.offsetexists.php                     24-Jun-2024 06:05                3383
arrayiterator.offsetget.php                        24-Jun-2024 06:05                3409
arrayiterator.offsetset.php                        24-Jun-2024 06:05                3701
arrayiterator.offsetunset.php                      24-Jun-2024 06:05                3864
arrayiterator.rewind.php                           24-Jun-2024 06:05                4656
arrayiterator.seek.php                             24-Jun-2024 06:05                2664
arrayiterator.serialize.php                        24-Jun-2024 06:05                2902
arrayiterator.setflags.php                         24-Jun-2024 06:05                4220
arrayiterator.uasort.php                           24-Jun-2024 06:05                6632
arrayiterator.uksort.php                           24-Jun-2024 06:05                6532
arrayiterator.unserialize.php                      24-Jun-2024 06:05                3149
arrayiterator.valid.php                            24-Jun-2024 06:05                4737
arrayobject.append.php                             24-Jun-2024 06:05                5530
arrayobject.asort.php                              24-Jun-2024 06:05               10413
arrayobject.construct.php                          24-Jun-2024 06:05                6337
arrayobject.count.php                              24-Jun-2024 06:05                5442
arrayobject.exchangearray.php                      24-Jun-2024 06:05                6491
arrayobject.getarraycopy.php                       24-Jun-2024 06:05                5311
arrayobject.getflags.php                           24-Jun-2024 06:05                6207
arrayobject.getiterator.php                        24-Jun-2024 06:05                5299
arrayobject.getiteratorclass.php                   24-Jun-2024 06:05                6653
arrayobject.ksort.php                              24-Jun-2024 06:05               10083
arrayobject.natcasesort.php                        24-Jun-2024 06:05                8565
arrayobject.natsort.php                            24-Jun-2024 06:05                8202
arrayobject.offsetexists.php                       24-Jun-2024 06:05                4990
arrayobject.offsetget.php                          24-Jun-2024 06:05                5185
arrayobject.offsetset.php                          24-Jun-2024 06:05                6804
arrayobject.offsetunset.php                        24-Jun-2024 06:05                4290
arrayobject.serialize.php                          24-Jun-2024 06:05                5135
arrayobject.setflags.php                           24-Jun-2024 06:05                6841
arrayobject.setiteratorclass.php                   24-Jun-2024 06:05                5896
arrayobject.uasort.php                             24-Jun-2024 06:05               11165
arrayobject.uksort.php                             24-Jun-2024 06:05               10553
arrayobject.unserialize.php                        24-Jun-2024 06:05                3588
attribute.construct.php                            24-Jun-2024 06:05                2384
backedenum.from.php                                24-Jun-2024 06:05                6272
backedenum.tryfrom.php                             24-Jun-2024 06:05                6687
bc.configuration.php                               24-Jun-2024 06:05                2640
bc.constants.php                                   24-Jun-2024 06:05                1208
bc.installation.php                                24-Jun-2024 06:05                1543
bc.requirements.php                                24-Jun-2024 06:05                1289
bc.resources.php                                   24-Jun-2024 06:05                1282
bc.setup.php                                       24-Jun-2024 06:05                1685
book.apache.php                                    24-Jun-2024 06:06                3643
book.apcu.php                                      24-Jun-2024 06:05                4871
book.array.php                                     24-Jun-2024 06:06               12958
book.bc.php                                        24-Jun-2024 06:05                3394
book.bson.php                                      24-Jun-2024 06:05               25691
book.bzip2.php                                     24-Jun-2024 06:05                3160
book.calendar.php                                  24-Jun-2024 06:05                4753
book.classobj.php                                  24-Jun-2024 06:06                4534
book.cmark.php                                     24-Jun-2024 06:06                9266
book.com.php                                       24-Jun-2024 06:06                8181
book.componere.php                                 24-Jun-2024 06:05                6265
book.ctype.php                                     24-Jun-2024 06:06                3510
book.cubrid.php                                    24-Jun-2024 06:05               14035
book.curl.php                                      24-Jun-2024 06:05                7805
book.datetime.php                                  24-Jun-2024 06:05               18339
book.dba.php                                       24-Jun-2024 06:05                3576
book.dbase.php                                     24-Jun-2024 06:05                3558
book.dio.php                                       24-Jun-2024 06:05                3387
book.dir.php                                       24-Jun-2024 06:05                3329
book.dom.php                                       24-Jun-2024 06:06               22305
book.ds.php                                        24-Jun-2024 06:05               26932
book.eio.php                                       24-Jun-2024 06:05                8094
book.enchant.php                                   24-Jun-2024 06:05                5538
book.errorfunc.php                                 24-Jun-2024 06:05                3802
book.ev.php                                        24-Jun-2024 06:05               13504
book.event.php                                     24-Jun-2024 06:05               23372
book.exec.php                                      24-Jun-2024 06:05                3401
book.exif.php                                      24-Jun-2024 06:05                2710
book.expect.php                                    24-Jun-2024 06:05                2629
book.fann.php                                      24-Jun-2024 06:05               23244
book.fdf.php                                       24-Jun-2024 06:05                5766
book.ffi.php                                       24-Jun-2024 06:05                5771
book.fileinfo.php                                  24-Jun-2024 06:05                3352
book.filesystem.php                                24-Jun-2024 06:05               10997
book.filter.php                                    24-Jun-2024 06:06                3664
book.fpm.php                                       24-Jun-2024 06:06                2068
book.ftp.php                                       24-Jun-2024 06:05                6294
book.funchand.php                                  24-Jun-2024 06:06                3842
book.gearman.php                                   24-Jun-2024 06:05               14930
book.gender.php                                    24-Jun-2024 06:05                2678
book.geoip.php                                     24-Jun-2024 06:05                4520
book.gettext.php                                   24-Jun-2024 06:05                3170
book.gmagick.php                                   24-Jun-2024 06:05               22722
book.gmp.php                                       24-Jun-2024 06:05                7027
book.gnupg.php                                     24-Jun-2024 06:05                5009
book.hash.php                                      24-Jun-2024 06:05                4271
book.hrtime.php                                    24-Jun-2024 06:05                3612
book.ibase.php                                     24-Jun-2024 06:05               13001
book.ibm-db2.php                                   24-Jun-2024 06:05                8797
book.iconv.php                                     24-Jun-2024 06:05                3655
book.igbinary.php                                  24-Jun-2024 06:05                2273
book.image.php                                     24-Jun-2024 06:05               16878
book.imagick.php                                   24-Jun-2024 06:05               63953
book.imap.php                                      24-Jun-2024 06:05               10492
book.info.php                                      24-Jun-2024 06:05                8527
book.inotify.php                                   24-Jun-2024 06:05                2715
book.intl.php                                      24-Jun-2024 06:05               51638
book.json.php                                      24-Jun-2024 06:05                3075
book.ldap.php                                      24-Jun-2024 06:05               10100
book.libxml.php                                    24-Jun-2024 06:06                3546
book.lua.php                                       24-Jun-2024 06:05                2901
book.luasandbox.php                                24-Jun-2024 06:05                5690
book.lzf.php                                       24-Jun-2024 06:05                2364
book.mail.php                                      24-Jun-2024 06:05                2191
book.mailparse.php                                 24-Jun-2024 06:05                4361
book.math.php                                      24-Jun-2024 06:05                5706
book.mbstring.php                                  24-Jun-2024 06:05               11618
book.mcrypt.php                                    24-Jun-2024 06:05                6532
book.memcache.php                                  24-Jun-2024 06:05                4364
book.memcached.php                                 24-Jun-2024 06:05                8888
book.mhash.php                                     24-Jun-2024 06:05                2654
book.misc.php                                      24-Jun-2024 06:05                5800
book.mongodb.php                                   24-Jun-2024 06:05               26866
book.mqseries.php                                  24-Jun-2024 06:05                3316
book.mysql-xdevapi.php                             24-Jun-2024 06:05               29176
book.mysql.php                                     24-Jun-2024 06:05                8346
book.mysqli.php                                    24-Jun-2024 06:05               20244
book.mysqlnd.php                                   24-Jun-2024 06:05                2615
book.network.php                                   24-Jun-2024 06:05                6044
book.oauth.php                                     24-Jun-2024 06:06                7956
book.oci8.php                                      24-Jun-2024 06:05               17398
book.opcache.php                                   24-Jun-2024 06:05                2906
book.openal.php                                    24-Jun-2024 06:05                4613
book.openssl.php                                   24-Jun-2024 06:05               11037
book.outcontrol.php                                24-Jun-2024 06:05                5514
book.parallel.php                                  24-Jun-2024 06:05                5778
book.parle.php                                     24-Jun-2024 06:06                8891
book.password.php                                  24-Jun-2024 06:05                2652
book.pcntl.php                                     24-Jun-2024 06:05                5210
book.pcre.php                                      24-Jun-2024 06:06                3973
book.pdo.php                                       24-Jun-2024 06:05                8993
book.pgsql.php                                     24-Jun-2024 06:05               13749
book.phar.php                                      24-Jun-2024 06:05               15835
book.phpdbg.php                                    24-Jun-2024 06:05                3239
book.posix.php                                     24-Jun-2024 06:05                6882
book.ps.php                                        24-Jun-2024 06:05                9329
book.pspell.php                                    24-Jun-2024 06:05                4589
book.pthreads.php                                  24-Jun-2024 06:05                5578
book.quickhash.php                                 24-Jun-2024 06:06                9039
book.radius.php                                    24-Jun-2024 06:05                5704
book.random.php                                    24-Jun-2024 06:05                9376
book.rar.php                                       24-Jun-2024 06:05                5774
book.readline.php                                  24-Jun-2024 06:05                4033
book.recode.php                                    24-Jun-2024 06:05                2457
book.reflection.php                                24-Jun-2024 06:06               40330
book.rnp.php                                       24-Jun-2024 06:05                6188
book.rpminfo.php                                   24-Jun-2024 06:05                2629
book.rrd.php                                       24-Jun-2024 06:05                5237
book.runkit7.php                                   24-Jun-2024 06:05                4355
book.scoutapm.php                                  24-Jun-2024 06:05                2329
book.seaslog.php                                   24-Jun-2024 06:05                5332
book.sem.php                                       24-Jun-2024 06:05                4293
book.session.php                                   24-Jun-2024 06:06                8775
book.shmop.php                                     24-Jun-2024 06:05                3059
book.simdjson.php                                  24-Jun-2024 06:05                2769
book.simplexml.php                                 24-Jun-2024 06:06                5764
book.snmp.php                                      24-Jun-2024 06:05                5983
book.soap.php                                      24-Jun-2024 06:06                6646
book.sockets.php                                   24-Jun-2024 06:05                7224
book.sodium.php                                    24-Jun-2024 06:05               17579
book.solr.php                                      24-Jun-2024 06:05               53351
book.spl.php                                       24-Jun-2024 06:05               10253
book.sqlite3.php                                   24-Jun-2024 06:05                7971
book.sqlsrv.php                                    24-Jun-2024 06:05                5924
book.ssdeep.php                                    24-Jun-2024 06:06                2457
book.ssh2.php                                      24-Jun-2024 06:05                5587
book.stats.php                                     24-Jun-2024 06:05               11950
book.stomp.php                                     24-Jun-2024 06:05                4264
book.stream.php                                    24-Jun-2024 06:05               12509
book.strings.php                                   24-Jun-2024 06:06               13888
book.svm.php                                       24-Jun-2024 06:05                3787
book.svn.php                                       24-Jun-2024 06:05                7732
book.swoole.php                                    24-Jun-2024 06:05               41482
book.sync.php                                      24-Jun-2024 06:05                4921
book.taint.php                                     24-Jun-2024 06:05                2651
book.tcpwrap.php                                   24-Jun-2024 06:05                2183
book.tidy.php                                      24-Jun-2024 06:05                6723
book.tokenizer.php                                 24-Jun-2024 06:05                3260
book.trader.php                                    24-Jun-2024 06:05               17646
book.ui.php                                        24-Jun-2024 06:06               28016
book.uodbc.php                                     24-Jun-2024 06:05                7401
book.uopz.php                                      24-Jun-2024 06:05                5223
book.url.php                                       24-Jun-2024 06:05                3059
book.v8js.php                                      24-Jun-2024 06:05                3212
book.var.php                                       24-Jun-2024 06:06                6494
book.var_representation.php                        24-Jun-2024 06:05                2248
book.varnish.php                                   24-Jun-2024 06:05                5485
book.wddx.php                                      24-Jun-2024 06:06                2974
book.win32service.php                              24-Jun-2024 06:06                4147
book.wincache.php                                  24-Jun-2024 06:05                5727
book.wkhtmltox.php                                 24-Jun-2024 06:05                3419
book.xattr.php                                     24-Jun-2024 06:05                2585
book.xdiff.php                                     24-Jun-2024 06:05                4268
book.xhprof.php                                    24-Jun-2024 06:05                2572
book.xlswriter.php                                 24-Jun-2024 06:05                4512
book.xml.php                                       24-Jun-2024 06:06                5729
book.xmldiff.php                                   24-Jun-2024 06:06                3210
book.xmlreader.php                                 24-Jun-2024 06:06                4935
book.xmlrpc.php                                    24-Jun-2024 06:06                4096
book.xmlwriter.php                                 24-Jun-2024 06:06                6648
book.xsl.php                                       24-Jun-2024 06:06                4043
book.yac.php                                       24-Jun-2024 06:05                2703
book.yaconf.php                                    24-Jun-2024 06:05                2265
book.yaf.php                                       24-Jun-2024 06:05               34775
book.yaml.php                                      24-Jun-2024 06:05                2902
book.yar.php                                       24-Jun-2024 06:06                3804
book.yaz.php                                       24-Jun-2024 06:05                4481
book.zip.php                                       24-Jun-2024 06:05               11205
book.zlib.php                                      24-Jun-2024 06:05                5715
book.zmq.php                                       24-Jun-2024 06:05                5975
book.zookeeper.php                                 24-Jun-2024 06:05                6781
bzip2.configuration.php                            24-Jun-2024 06:05                1365
bzip2.constants.php                                24-Jun-2024 06:05                1211
bzip2.examples.php                                 24-Jun-2024 06:05                4099
bzip2.installation.php                             24-Jun-2024 06:05                1490
bzip2.requirements.php                             24-Jun-2024 06:05                1473
bzip2.resources.php                                24-Jun-2024 06:05                1389
bzip2.setup.php                                    24-Jun-2024 06:05                1714
cachingiterator.construct.php                      24-Jun-2024 06:05                2867
cachingiterator.count.php                          24-Jun-2024 06:05                2510
cachingiterator.current.php                        24-Jun-2024 06:05                2827
cachingiterator.getcache.php                       24-Jun-2024 06:05                5906
cachingiterator.getflags.php                       24-Jun-2024 06:05                2551
cachingiterator.hasnext.php                        24-Jun-2024 06:05                2651
cachingiterator.key.php                            24-Jun-2024 06:05                2227
cachingiterator.next.php                           24-Jun-2024 06:05                2451
cachingiterator.offsetexists.php                   24-Jun-2024 06:05                2996
cachingiterator.offsetget.php                      24-Jun-2024 06:05                2734
cachingiterator.offsetset.php                      24-Jun-2024 06:05                3105
cachingiterator.offsetunset.php                    24-Jun-2024 06:05                2774
cachingiterator.rewind.php                         24-Jun-2024 06:05                2462
cachingiterator.setflags.php                       24-Jun-2024 06:05                2841
cachingiterator.tostring.php                       24-Jun-2024 06:05                2654
cachingiterator.valid.php                          24-Jun-2024 06:05                2683
calendar.configuration.php                         24-Jun-2024 06:05                1386
calendar.constants.php                             24-Jun-2024 06:05               13388
calendar.installation.php                          24-Jun-2024 06:05                1575
calendar.requirements.php                          24-Jun-2024 06:05                1331
calendar.resources.php                             24-Jun-2024 06:05                1324
calendar.setup.php                                 24-Jun-2024 06:05                1752
callbackfilteriterator.accept.php                  24-Jun-2024 06:05                3604
callbackfilteriterator.construct.php               24-Jun-2024 06:05                3973
cc.license.php                                     24-Jun-2024 06:06               20792
changelog.misc.php                                 24-Jun-2024 06:05                1370
changelog.mysql.php                                24-Jun-2024 06:05                2656
changelog.mysql_xdevapi.php                        24-Jun-2024 06:05                2396
changelog.mysqli.php                               24-Jun-2024 06:05                1408
changelog.strings.php                              24-Jun-2024 06:06                1444
class.addressinfo.php                              24-Jun-2024 06:05                1774
class.allowdynamicproperties.php                   24-Jun-2024 06:05                5046
class.apcuiterator.php                             24-Jun-2024 06:05                7519
class.appenditerator.php                           24-Jun-2024 06:05                7940
class.argumentcounterror.php                       24-Jun-2024 06:05                8697
class.arithmeticerror.php                          24-Jun-2024 06:05                8861
class.arrayaccess.php                              24-Jun-2024 06:05               11830
class.arrayiterator.php                            24-Jun-2024 06:05               17257
class.arrayobject.php                              24-Jun-2024 06:05               17084
class.assertionerror.php                           24-Jun-2024 06:05                8553
class.attribute.php                                24-Jun-2024 06:05                8714
class.backedenum.php                               24-Jun-2024 06:05                4435
class.badfunctioncallexception.php                 24-Jun-2024 06:05                8640
class.badmethodcallexception.php                   24-Jun-2024 06:05                8646
class.cachingiterator.php                          24-Jun-2024 06:05               17422
class.callbackfilteriterator.php                   24-Jun-2024 06:05               11591
class.closedgeneratorexception.php                 24-Jun-2024 06:05                8779
class.closure.php                                  24-Jun-2024 06:05                6981
class.collator.php                                 24-Jun-2024 06:05               37587
class.collectable.php                              24-Jun-2024 06:05                2559
class.com-exception.php                            24-Jun-2024 06:06                8427
class.com-safearray-proxy.php                      24-Jun-2024 06:06                1944
class.com.php                                      24-Jun-2024 06:06               12540
class.commonmark-cql.php                           24-Jun-2024 06:06                7604
class.commonmark-interfaces-ivisitable.php         24-Jun-2024 06:06                3014
class.commonmark-interfaces-ivisitor.php           24-Jun-2024 06:06                4626
class.commonmark-node-blockquote.php               24-Jun-2024 06:06                8458
class.commonmark-node-bulletlist.php               24-Jun-2024 06:06               10643
class.commonmark-node-code.php                     24-Jun-2024 06:06                9455
class.commonmark-node-codeblock.php                24-Jun-2024 06:06               10843
class.commonmark-node-customblock.php              24-Jun-2024 06:06                9208
class.commonmark-node-custominline.php             24-Jun-2024 06:06                9184
class.commonmark-node-document.php                 24-Jun-2024 06:06                8426
class.commonmark-node-heading.php                  24-Jun-2024 06:06                9820
class.commonmark-node-htmlblock.php                24-Jun-2024 06:06                9509
class.commonmark-node-htmlinline.php               24-Jun-2024 06:06                9485
class.commonmark-node-image.php                    24-Jun-2024 06:06               10728
class.commonmark-node-item.php                     24-Jun-2024 06:06                8425
class.commonmark-node-linebreak.php                24-Jun-2024 06:06                8439
class.commonmark-node-link.php                     24-Jun-2024 06:06               10721
class.commonmark-node-orderedlist.php              24-Jun-2024 06:06               11605
class.commonmark-node-paragraph.php                24-Jun-2024 06:06                8464
class.commonmark-node-softbreak.php                24-Jun-2024 06:06                8457
class.commonmark-node-text-emphasis.php            24-Jun-2024 06:06                8486
class.commonmark-node-text-strong.php              24-Jun-2024 06:06                8475
class.commonmark-node-text.php                     24-Jun-2024 06:06                9858
class.commonmark-node-thematicbreak.php            24-Jun-2024 06:06                8486
class.commonmark-node.php                          24-Jun-2024 06:06                9482
class.commonmark-parser.php                        24-Jun-2024 06:06                3875
class.compersisthelper.php                         24-Jun-2024 06:06                7489
class.compileerror.php                             24-Jun-2024 06:05                8466
class.componere-abstract-definition.php            24-Jun-2024 06:05                4769
class.componere-definition.php                     24-Jun-2024 06:05               10267
class.componere-method.php                         24-Jun-2024 06:05                4349
class.componere-patch.php                          24-Jun-2024 06:05                8362
class.componere-value.php                          24-Jun-2024 06:05                5452
class.countable.php                                24-Jun-2024 06:05                2586
class.curlfile.php                                 24-Jun-2024 06:05                8414
class.curlhandle.php                               24-Jun-2024 06:05                1811
class.curlmultihandle.php                          24-Jun-2024 06:05                1850
class.curlsharehandle.php                          24-Jun-2024 06:05                1846
class.curlstringfile.php                           24-Jun-2024 06:05                5649
class.dateerror.php                                24-Jun-2024 06:05                9116
class.dateexception.php                            24-Jun-2024 06:05                9727
class.dateinterval.php                             24-Jun-2024 06:05               14104
class.dateinvalidoperationexception.php            24-Jun-2024 06:05                9181
class.dateinvalidtimezoneexception.php             24-Jun-2024 06:05                8751
class.datemalformedintervalstringexception.php     24-Jun-2024 06:05                8854
class.datemalformedperiodstringexception.php       24-Jun-2024 06:05                8835
class.datemalformedstringexception.php             24-Jun-2024 06:05                9133
class.dateobjecterror.php                          24-Jun-2024 06:05                8903
class.dateperiod.php                               24-Jun-2024 06:05               22285
class.daterangeerror.php                           24-Jun-2024 06:05                9082
class.datetime.php                                 24-Jun-2024 06:05               23437
class.datetimeimmutable.php                        24-Jun-2024 06:05               23538
class.datetimeinterface.php                        24-Jun-2024 06:05               20285
class.datetimezone.php                             24-Jun-2024 06:05               15922
class.deflatecontext.php                           24-Jun-2024 06:05                1855
class.directory.php                                24-Jun-2024 06:05                5641
class.directoryiterator.php                        24-Jun-2024 06:05               20200
class.divisionbyzeroerror.php                      24-Jun-2024 06:05                8517
class.domainexception.php                          24-Jun-2024 06:05                8545
class.domattr.php                                  24-Jun-2024 06:06               28331
class.domcdatasection.php                          24-Jun-2024 06:06               32145
class.domcharacterdata.php                         24-Jun-2024 06:06               33503
class.domchildnode.php                             24-Jun-2024 06:06                4287
class.domcomment.php                               24-Jun-2024 06:06               30814
class.domdocument.php                              24-Jun-2024 06:06               68812
class.domdocumentfragment.php                      24-Jun-2024 06:06               29217
class.domdocumenttype.php                          24-Jun-2024 06:06               27288
class.domelement.php                               24-Jun-2024 06:06               53340
class.domentity.php                                24-Jun-2024 06:06               28008
class.domentityreference.php                       24-Jun-2024 06:06               23391
class.domexception.php                             24-Jun-2024 06:06                9381
class.domimplementation.php                        24-Jun-2024 06:06                6055
class.domnamednodemap.php                          24-Jun-2024 06:06                7474
class.domnamespacenode.php                         24-Jun-2024 06:06                9425
class.domnode.php                                  24-Jun-2024 06:06               32720
class.domnodelist.php                              24-Jun-2024 06:06                6073
class.domnotation.php                              24-Jun-2024 06:06               23676
class.domparentnode.php                            24-Jun-2024 06:06                3954
class.domprocessinginstruction.php                 24-Jun-2024 06:06               24923
class.domtext.php                                  24-Jun-2024 06:06               33829
class.domxpath.php                                 24-Jun-2024 06:06                8768
class.dotnet.php                                   24-Jun-2024 06:06                6949
class.ds-collection.php                            24-Jun-2024 06:05                6098
class.ds-deque.php                                 24-Jun-2024 06:05               22400
class.ds-hashable.php                              24-Jun-2024 06:05                4122
class.ds-map.php                                   24-Jun-2024 06:05               23383
class.ds-pair.php                                  24-Jun-2024 06:05                4644
class.ds-priorityqueue.php                         24-Jun-2024 06:05                8400
class.ds-queue.php                                 24-Jun-2024 06:05                7934
class.ds-sequence.php                              24-Jun-2024 06:05               24007
class.ds-set.php                                   24-Jun-2024 06:05               18777
class.ds-stack.php                                 24-Jun-2024 06:05                7260
class.ds-vector.php                                24-Jun-2024 06:05               21896
class.emptyiterator.php                            24-Jun-2024 06:05                4115
class.enchantbroker.php                            24-Jun-2024 06:05                1851
class.enchantdictionary.php                        24-Jun-2024 06:05                1841
class.error.php                                    24-Jun-2024 06:05               10904
class.errorexception.php                           24-Jun-2024 06:05               14559
class.ev.php                                       24-Jun-2024 06:05               42352
class.evcheck.php                                  24-Jun-2024 06:05               10853
class.evchild.php                                  24-Jun-2024 06:05               12528
class.evembed.php                                  24-Jun-2024 06:05               10025
class.event.php                                    24-Jun-2024 06:05               18769
class.eventbase.php                                24-Jun-2024 06:05               15257
class.eventbuffer.php                              24-Jun-2024 06:05               23658
class.eventbufferevent.php                         24-Jun-2024 06:05               38269
class.eventconfig.php                              24-Jun-2024 06:05                7905
class.eventdnsbase.php                             24-Jun-2024 06:05               14381
class.eventexception.php                           24-Jun-2024 06:05                8597
class.eventhttp.php                                24-Jun-2024 06:05                9721
class.eventhttpconnection.php                      24-Jun-2024 06:05               10532
class.eventhttprequest.php                         24-Jun-2024 06:05               22927
class.eventlistener.php                            24-Jun-2024 06:05               12928
class.eventsslcontext.php                          24-Jun-2024 06:05               19440
class.eventutil.php                                24-Jun-2024 06:05               26015
class.evfork.php                                   24-Jun-2024 06:05                9019
class.evidle.php                                   24-Jun-2024 06:05                9846
class.evio.php                                     24-Jun-2024 06:05               12635
class.evloop.php                                   24-Jun-2024 06:05               31539
class.evperiodic.php                               24-Jun-2024 06:05               14950
class.evprepare.php                                24-Jun-2024 06:05               10992
class.evsignal.php                                 24-Jun-2024 06:05               11939
class.evstat.php                                   24-Jun-2024 06:05               14415
class.evtimer.php                                  24-Jun-2024 06:05               14328
class.evwatcher.php                                24-Jun-2024 06:05               10000
class.exception.php                                24-Jun-2024 06:05               11205
class.fannconnection.php                           24-Jun-2024 06:05                6571
class.ffi-cdata.php                                24-Jun-2024 06:05                6189
class.ffi-ctype.php                                24-Jun-2024 06:05               31271
class.ffi-exception.php                            24-Jun-2024 06:05                8240
class.ffi-parserexception.php                      24-Jun-2024 06:05                8295
class.ffi.php                                      24-Jun-2024 06:05               18405
class.fiber.php                                    24-Jun-2024 06:05                7870
class.fibererror.php                               24-Jun-2024 06:05                8214
class.filesystemiterator.php                       24-Jun-2024 06:05               32002
class.filteriterator.php                           24-Jun-2024 06:05                7405
class.finfo.php                                    24-Jun-2024 06:05                6300
class.ftp-connection.php                           24-Jun-2024 06:05                1813
class.gdfont.php                                   24-Jun-2024 06:05                1754
class.gdimage.php                                  24-Jun-2024 06:05                1750
class.gearmanclient.php                            24-Jun-2024 06:05               37791
class.gearmanexception.php                         24-Jun-2024 06:05                7240
class.gearmanjob.php                               24-Jun-2024 06:05                9253
class.gearmantask.php                              24-Jun-2024 06:05                8896
class.gearmanworker.php                            24-Jun-2024 06:05               13467
class.gender.php                                   24-Jun-2024 06:05               42244
class.generator.php                                24-Jun-2024 06:05                6609
class.globiterator.php                             24-Jun-2024 06:05               26560
class.gmagick.php                                  24-Jun-2024 06:05               87080
class.gmagickdraw.php                              24-Jun-2024 06:05               24471
class.gmagickpixel.php                             24-Jun-2024 06:05                5948
class.gmp.php                                      24-Jun-2024 06:05                4268
class.hashcontext.php                              24-Jun-2024 06:05                3374
class.hrtime-performancecounter.php                24-Jun-2024 06:05                3851
class.hrtime-stopwatch.php                         24-Jun-2024 06:05                7066
class.hrtime-unit.php                              24-Jun-2024 06:05                4466
class.imagick.php                                  24-Jun-2024 06:05              286414
class.imagickdraw.php                              24-Jun-2024 06:05               82968
class.imagickkernel.php                            24-Jun-2024 06:05                6563
class.imagickpixel.php                             24-Jun-2024 06:05               13872
class.imagickpixeliterator.php                     24-Jun-2024 06:05                9647
class.imap-connection.php                          24-Jun-2024 06:05                1816
class.infiniteiterator.php                         24-Jun-2024 06:05                5314
class.inflatecontext.php                           24-Jun-2024 06:05                1851
class.internaliterator.php                         24-Jun-2024 06:05                4857
class.intlbreakiterator.php                        24-Jun-2024 06:05               31039
class.intlcalendar.php                             24-Jun-2024 06:05               73674
class.intlchar.php                                 24-Jun-2024 06:05              475021
class.intlcodepointbreakiterator.php               24-Jun-2024 06:05               21583
class.intldateformatter.php                        24-Jun-2024 06:05               32982
class.intldatepatterngenerator.php                 24-Jun-2024 06:05                4819
class.intlexception.php                            24-Jun-2024 06:05                8703
class.intlgregoriancalendar.php                    24-Jun-2024 06:05               53366
class.intliterator.php                             24-Jun-2024 06:05                5171
class.intlpartsiterator.php                        24-Jun-2024 06:05                7231
class.intlrulebasedbreakiterator.php               24-Jun-2024 06:05               24629
class.intltimezone.php                             24-Jun-2024 06:05               29067
class.invalidargumentexception.php                 24-Jun-2024 06:05                8562
class.iterator.php                                 24-Jun-2024 06:05               11456
class.iteratoraggregate.php                        24-Jun-2024 06:05                6278
class.iteratoriterator.php                         24-Jun-2024 06:05                6446
class.jsonexception.php                            24-Jun-2024 06:05                8962
class.jsonserializable.php                         24-Jun-2024 06:05                2826
class.ldap-connection.php                          24-Jun-2024 06:05                1849
class.ldap-result-entry.php                        24-Jun-2024 06:05                1864
class.ldap-result.php                              24-Jun-2024 06:05                1841
class.lengthexception.php                          24-Jun-2024 06:05                8497
class.libxmlerror.php                              24-Jun-2024 06:06                5697
class.limititerator.php                            24-Jun-2024 06:05               11367
class.locale.php                                   24-Jun-2024 06:05               29299
class.logicexception.php                           24-Jun-2024 06:05                8561
class.lua.php                                      24-Jun-2024 06:05                7906
class.luaclosure.php                               24-Jun-2024 06:05                2726
class.luasandbox.php                               24-Jun-2024 06:05               14180
class.luasandboxerror.php                          24-Jun-2024 06:05               10121
class.luasandboxerrorerror.php                     24-Jun-2024 06:05                7653
class.luasandboxfatalerror.php                     24-Jun-2024 06:05                7775
class.luasandboxfunction.php                       24-Jun-2024 06:05                3960
class.luasandboxmemoryerror.php                    24-Jun-2024 06:05                7966
class.luasandboxruntimeerror.php                   24-Jun-2024 06:05                7795
class.luasandboxsyntaxerror.php                    24-Jun-2024 06:05                7657
class.luasandboxtimeouterror.php                   24-Jun-2024 06:05                7950
class.memcache.php                                 24-Jun-2024 06:05               19198
class.memcached.php                                24-Jun-2024 06:05               48205
class.memcachedexception.php                       24-Jun-2024 06:05                7541
class.messageformatter.php                         24-Jun-2024 06:05               12492
class.mongodb-bson-binary.php                      24-Jun-2024 06:05               17064
class.mongodb-bson-binaryinterface.php             24-Jun-2024 06:05                4806
class.mongodb-bson-dbpointer.php                   24-Jun-2024 06:05                6081
class.mongodb-bson-decimal128.php                  24-Jun-2024 06:05                7849
class.mongodb-bson-decimal128interface.php         24-Jun-2024 06:05                3933
class.mongodb-bson-document.php                    24-Jun-2024 06:05               14125
class.mongodb-bson-int64.php                       24-Jun-2024 06:05                7551
class.mongodb-bson-iterator.php                    24-Jun-2024 06:05                5025
class.mongodb-bson-javascript.php                  24-Jun-2024 06:05                8808
class.mongodb-bson-javascriptinterface.php         24-Jun-2024 06:05                5036
class.mongodb-bson-maxkey.php                      24-Jun-2024 06:05                5907
class.mongodb-bson-maxkeyinterface.php             24-Jun-2024 06:05                2248
class.mongodb-bson-minkey.php                      24-Jun-2024 06:05                5898
class.mongodb-bson-minkeyinterface.php             24-Jun-2024 06:05                2229
class.mongodb-bson-objectid.php                    24-Jun-2024 06:05                9275
class.mongodb-bson-objectidinterface.php           24-Jun-2024 06:05                4423
class.mongodb-bson-packedarray.php                 24-Jun-2024 06:05               11946
class.mongodb-bson-persistable.php                 24-Jun-2024 06:05                6185
class.mongodb-bson-regex.php                       24-Jun-2024 06:05                8239
class.mongodb-bson-regexinterface.php              24-Jun-2024 06:05                4825
class.mongodb-bson-serializable.php                24-Jun-2024 06:05                4323
class.mongodb-bson-symbol.php                      24-Jun-2024 06:05                5969
class.mongodb-bson-timestamp.php                   24-Jun-2024 06:05                8486
class.mongodb-bson-timestampinterface.php          24-Jun-2024 06:05                4983
class.mongodb-bson-type.php                        24-Jun-2024 06:05                2077
class.mongodb-bson-undefined.php                   24-Jun-2024 06:05                6057
class.mongodb-bson-unserializable.php              24-Jun-2024 06:05                4066
class.mongodb-bson-utcdatetime.php                 24-Jun-2024 06:05                8091
class.mongodb-bson-utcdatetimeinterface.php        24-Jun-2024 06:05                4496
class.mongodb-driver-bulkwrite.php                 24-Jun-2024 06:05               24146
class.mongodb-driver-clientencryption.php          24-Jun-2024 06:05               26343
class.mongodb-driver-command.php                   24-Jun-2024 06:05               14261
class.mongodb-driver-cursor.php                    24-Jun-2024 06:05               25931
class.mongodb-driver-cursorid.php                  24-Jun-2024 06:05                5600
class.mongodb-driver-cursorinterface.php           24-Jun-2024 06:05                6284
class.mongodb-driver-exception-authenticationex..> 24-Jun-2024 06:05                9207
class.mongodb-driver-exception-bulkwriteexcepti..> 24-Jun-2024 06:05               10061
class.mongodb-driver-exception-commandexception..> 24-Jun-2024 06:05               10957
class.mongodb-driver-exception-connectionexcept..> 24-Jun-2024 06:05                9276
class.mongodb-driver-exception-connectiontimeou..> 24-Jun-2024 06:05                9664
class.mongodb-driver-exception-encryptionexcept..> 24-Jun-2024 06:05                9210
class.mongodb-driver-exception-exception.php       24-Jun-2024 06:05                2329
class.mongodb-driver-exception-executiontimeout..> 24-Jun-2024 06:05               10329
class.mongodb-driver-exception-invalidargumente..> 24-Jun-2024 06:05                8236
class.mongodb-driver-exception-logicexception.php  24-Jun-2024 06:05                8120
class.mongodb-driver-exception-runtimeexception..> 24-Jun-2024 06:05               11720
class.mongodb-driver-exception-serverexception.php 24-Jun-2024 06:05                9287
class.mongodb-driver-exception-sslconnectionexc..> 24-Jun-2024 06:05                9558
class.mongodb-driver-exception-unexpectedvaluee..> 24-Jun-2024 06:05                8253
class.mongodb-driver-exception-writeexception.php  24-Jun-2024 06:05               12238
class.mongodb-driver-manager.php                   24-Jun-2024 06:05               21846
class.mongodb-driver-monitoring-commandfailedev..> 24-Jun-2024 06:05                8679
class.mongodb-driver-monitoring-commandstartede..> 24-Jun-2024 06:05                7602
class.mongodb-driver-monitoring-commandsubscrib..> 24-Jun-2024 06:05                6372
class.mongodb-driver-monitoring-commandsucceede..> 24-Jun-2024 06:05                8270
class.mongodb-driver-monitoring-logsubscriber.php  24-Jun-2024 06:05               10181
class.mongodb-driver-monitoring-sdamsubscriber.php 24-Jun-2024 06:05               11722
class.mongodb-driver-monitoring-serverchangedev..> 24-Jun-2024 06:05                5792
class.mongodb-driver-monitoring-serverclosedeve..> 24-Jun-2024 06:05                4439
class.mongodb-driver-monitoring-serverheartbeat..> 24-Jun-2024 06:05                5790
class.mongodb-driver-monitoring-serverheartbeat..> 24-Jun-2024 06:05                4617
class.mongodb-driver-monitoring-serverheartbeat..> 24-Jun-2024 06:05                5862
class.mongodb-driver-monitoring-serveropeningev..> 24-Jun-2024 06:05                4459
class.mongodb-driver-monitoring-subscriber.php     24-Jun-2024 06:05                2692
class.mongodb-driver-monitoring-topologychanged..> 24-Jun-2024 06:05                4787
class.mongodb-driver-monitoring-topologyclosede..> 24-Jun-2024 06:05                3398
class.mongodb-driver-monitoring-topologyopening..> 24-Jun-2024 06:05                3412
class.mongodb-driver-query.php                     24-Jun-2024 06:05                3471
class.mongodb-driver-readconcern.php               24-Jun-2024 06:05               17760
class.mongodb-driver-readpreference.php            24-Jun-2024 06:05               21969
class.mongodb-driver-server.php                    24-Jun-2024 06:05               27239
class.mongodb-driver-serverapi.php                 24-Jun-2024 06:05               14122
class.mongodb-driver-serverdescription.php         24-Jun-2024 06:05               16929
class.mongodb-driver-session.php                   24-Jun-2024 06:05               15588
class.mongodb-driver-topologydescription.php       24-Jun-2024 06:05               11693
class.mongodb-driver-writeconcern.php              24-Jun-2024 06:05               10354
class.mongodb-driver-writeconcernerror.php         24-Jun-2024 06:05                4430
class.mongodb-driver-writeerror.php                24-Jun-2024 06:05                4754
class.mongodb-driver-writeresult.php               24-Jun-2024 06:05                8732
class.multipleiterator.php                         24-Jun-2024 06:05               11811
class.mysql-xdevapi-baseresult.php                 24-Jun-2024 06:05                3095
class.mysql-xdevapi-client.php                     24-Jun-2024 06:05                3177
class.mysql-xdevapi-collection.php                 24-Jun-2024 06:05               10857
class.mysql-xdevapi-collectionadd.php              24-Jun-2024 06:05                2996
class.mysql-xdevapi-collectionfind.php             24-Jun-2024 06:05                8876
class.mysql-xdevapi-collectionmodify.php           24-Jun-2024 06:05               10333
class.mysql-xdevapi-collectionremove.php           24-Jun-2024 06:05                5270
class.mysql-xdevapi-columnresult.php               24-Jun-2024 06:05                6820
class.mysql-xdevapi-crudoperationbindable.php      24-Jun-2024 06:05                3032
class.mysql-xdevapi-crudoperationlimitable.php     24-Jun-2024 06:05                3038
class.mysql-xdevapi-crudoperationskippable.php     24-Jun-2024 06:05                3049
class.mysql-xdevapi-crudoperationsortable.php      24-Jun-2024 06:05                3025
class.mysql-xdevapi-databaseobject.php             24-Jun-2024 06:05                3596
class.mysql-xdevapi-docresult.php                  24-Jun-2024 06:05                4098
class.mysql-xdevapi-exception.php                  24-Jun-2024 06:05                2259
class.mysql-xdevapi-executable.php                 24-Jun-2024 06:05                2674
class.mysql-xdevapi-executionstatus.php            24-Jun-2024 06:05                4916
class.mysql-xdevapi-expression.php                 24-Jun-2024 06:05                3309
class.mysql-xdevapi-result.php                     24-Jun-2024 06:05                4482
class.mysql-xdevapi-rowresult.php                  24-Jun-2024 06:05                5195
class.mysql-xdevapi-schema.php                     24-Jun-2024 06:05                7911
class.mysql-xdevapi-schemaobject.php               24-Jun-2024 06:05                2859
class.mysql-xdevapi-session.php                    24-Jun-2024 06:05                9759
class.mysql-xdevapi-sqlstatement.php               24-Jun-2024 06:05                6725
class.mysql-xdevapi-sqlstatementresult.php         24-Jun-2024 06:05                7377
class.mysql-xdevapi-statement.php                  24-Jun-2024 06:05                5083
class.mysql-xdevapi-table.php                      24-Jun-2024 06:05                7480
class.mysql-xdevapi-tabledelete.php                24-Jun-2024 06:05                5235
class.mysql-xdevapi-tableinsert.php                24-Jun-2024 06:05                3556
class.mysql-xdevapi-tableselect.php                24-Jun-2024 06:05                8380
class.mysql-xdevapi-tableupdate.php                24-Jun-2024 06:05                6170
class.mysql-xdevapi-warning.php                    24-Jun-2024 06:05                3806
class.mysqli-driver.php                            24-Jun-2024 06:05                8175
class.mysqli-result.php                            24-Jun-2024 06:05               16362
class.mysqli-sql-exception.php                     24-Jun-2024 06:05               10098
class.mysqli-stmt.php                              24-Jun-2024 06:05               19443
class.mysqli-warning.php                           24-Jun-2024 06:05                4468
class.mysqli.php                                   24-Jun-2024 06:05               46223
class.norewinditerator.php                         24-Jun-2024 06:05                6808
class.normalizer.php                               24-Jun-2024 06:05               13841
class.numberformatter.php                          24-Jun-2024 06:05               75991
class.oauth.php                                    24-Jun-2024 06:06               20424
class.oauthexception.php                           24-Jun-2024 06:06                8580
class.oauthprovider.php                            24-Jun-2024 06:06               13245
class.ocicollection.php                            24-Jun-2024 06:05                7166
class.ocilob.php                                   24-Jun-2024 06:05               15415
class.opensslasymmetrickey.php                     24-Jun-2024 06:05                1914
class.opensslcertificate.php                       24-Jun-2024 06:05                1918
class.opensslcertificatesigningrequest.php         24-Jun-2024 06:05                2005
class.outeriterator.php                            24-Jun-2024 06:05                4376
class.outofboundsexception.php                     24-Jun-2024 06:05                8620
class.outofrangeexception.php                      24-Jun-2024 06:05                8611
class.overflowexception.php                        24-Jun-2024 06:05                8522
class.override.php                                 24-Jun-2024 06:05                4067
class.parallel-channel.php                         24-Jun-2024 06:05                8401
class.parallel-events-event-type.php               24-Jun-2024 06:05                3438
class.parallel-events-event.php                    24-Jun-2024 06:05                3581
class.parallel-events-input.php                    24-Jun-2024 06:05                4843
class.parallel-events.php                          24-Jun-2024 06:05                7195
class.parallel-future.php                          24-Jun-2024 06:05                7883
class.parallel-runtime.php                         24-Jun-2024 06:05                6548
class.parallel-sync.php                            24-Jun-2024 06:05                5313
class.parentiterator.php                           24-Jun-2024 06:05                9651
class.parle-errorinfo.php                          24-Jun-2024 06:06                3909
class.parle-lexer.php                              24-Jun-2024 06:06               13238
class.parle-lexerexception.php                     24-Jun-2024 06:06                7790
class.parle-parser.php                             24-Jun-2024 06:06               18166
class.parle-parserexception.php                    24-Jun-2024 06:06                7772
class.parle-rlexer.php                             24-Jun-2024 06:06               15473
class.parle-rparser.php                            24-Jun-2024 06:06               18339
class.parle-stack.php                              24-Jun-2024 06:06                4867
class.parle-token.php                              24-Jun-2024 06:06                4978
class.parseerror.php                               24-Jun-2024 06:05                8998
class.pdo.php                                      24-Jun-2024 06:05               43101
class.pdoexception.php                             24-Jun-2024 06:05               10436
class.pdorow.php                                   24-Jun-2024 06:05                4194
class.pdostatement.php                             24-Jun-2024 06:05               23524
class.pgsql-connection.php                         24-Jun-2024 06:05                1873
class.pgsql-lob.php                                24-Jun-2024 06:05                1815
class.pgsql-result.php                             24-Jun-2024 06:05                1847
class.phar.php                                     24-Jun-2024 06:05               74231
class.phardata.php                                 24-Jun-2024 06:05               49635
class.pharexception.php                            24-Jun-2024 06:05                8480
class.pharfileinfo.php                             24-Jun-2024 06:05               21695
class.php-user-filter.php                          24-Jun-2024 06:05                6526
class.phptoken.php                                 24-Jun-2024 06:05                8788
class.pool.php                                     24-Jun-2024 06:05                7780
class.pspell-config.php                            24-Jun-2024 06:05                1840
class.pspell-dictionary.php                        24-Jun-2024 06:05                1886
class.quickhashinthash.php                         24-Jun-2024 06:06               15145
class.quickhashintset.php                          24-Jun-2024 06:06               12923
class.quickhashintstringhash.php                   24-Jun-2024 06:06               16041
class.quickhashstringinthash.php                   24-Jun-2024 06:06               13710
class.random-brokenrandomengineerror.php           24-Jun-2024 06:05                8592
class.random-cryptosafeengine.php                  24-Jun-2024 06:05                2524
class.random-engine-mt19937.php                    24-Jun-2024 06:05                5406
class.random-engine-pcgoneseq128xslrr64.php        24-Jun-2024 06:05                6219
class.random-engine-secure.php                     24-Jun-2024 06:05                3460
class.random-engine-xoshiro256starstar.php         24-Jun-2024 06:05                6405
class.random-engine.php                            24-Jun-2024 06:05                3894
class.random-randomerror.php                       24-Jun-2024 06:05                8510
class.random-randomexception.php                   24-Jun-2024 06:05                8624
class.random-randomizer.php                        24-Jun-2024 06:05               10627
class.rangeexception.php                           24-Jun-2024 06:05                8774
class.rararchive.php                               24-Jun-2024 06:05                7876
class.rarentry.php                                 24-Jun-2024 06:05               51348
class.rarexception.php                             24-Jun-2024 06:05                8410
class.recursivearrayiterator.php                   24-Jun-2024 06:05               15950
class.recursivecachingiterator.php                 24-Jun-2024 06:05               14145
class.recursivecallbackfilteriterator.php          24-Jun-2024 06:05               13396
class.recursivedirectoryiterator.php               24-Jun-2024 06:05               30026
class.recursivefilteriterator.php                  24-Jun-2024 06:05                8287
class.recursiveiterator.php                        24-Jun-2024 06:05                4921
class.recursiveiteratoriterator.php                24-Jun-2024 06:05               14852
class.recursiveregexiterator.php                   24-Jun-2024 06:05               14791
class.recursivetreeiterator.php                    24-Jun-2024 06:05               25814
class.reflection.php                               24-Jun-2024 06:06                3497
class.reflectionattribute.php                      24-Jun-2024 06:06                6498
class.reflectionclass.php                          24-Jun-2024 06:06               38255
class.reflectionclassconstant.php                  24-Jun-2024 06:06               16538
class.reflectionenum.php                           24-Jun-2024 06:06               31576
class.reflectionenumbackedcase.php                 24-Jun-2024 06:06               12997
class.reflectionenumunitcase.php                   24-Jun-2024 06:06               12627
class.reflectionexception.php                      24-Jun-2024 06:06                8479
class.reflectionextension.php                      24-Jun-2024 06:06               10844
class.reflectionfiber.php                          24-Jun-2024 06:06                5329
class.reflectionfunction.php                       24-Jun-2024 06:06               21440
class.reflectionfunctionabstract.php               24-Jun-2024 06:06               20492
class.reflectiongenerator.php                      24-Jun-2024 06:06                6500
class.reflectionintersectiontype.php               24-Jun-2024 06:06                3503
class.reflectionmethod.php                         24-Jun-2024 06:06               33130
class.reflectionnamedtype.php                      24-Jun-2024 06:06                3808
class.reflectionobject.php                         24-Jun-2024 06:06               29345
class.reflectionparameter.php                      24-Jun-2024 06:06               16901
class.reflectionproperty.php                       24-Jun-2024 06:06               22561
class.reflectionreference.php                      24-Jun-2024 06:06                4228
class.reflectiontype.php                           24-Jun-2024 06:06                4567
class.reflectionuniontype.php                      24-Jun-2024 06:06                3381
class.reflectionzendextension.php                  24-Jun-2024 06:06                7979
class.reflector.php                                24-Jun-2024 06:06                3960
class.regexiterator.php                            24-Jun-2024 06:05               17898
class.resourcebundle.php                           24-Jun-2024 06:05               10772
class.returntypewillchange.php                     24-Jun-2024 06:05                3291
class.rnpffi.php                                   24-Jun-2024 06:05                1692
class.rrdcreator.php                               24-Jun-2024 06:05                4528
class.rrdgraph.php                                 24-Jun-2024 06:05                3950
class.rrdupdater.php                               24-Jun-2024 06:05                3336
class.runtimeexception.php                         24-Jun-2024 06:05                8521
class.seaslog.php                                  24-Jun-2024 06:05               21986
class.seekableiterator.php                         24-Jun-2024 06:05               11410
class.sensitiveparameter.php                       24-Jun-2024 06:05                6376
class.sensitiveparametervalue.php                  24-Jun-2024 06:05                5030
class.serializable.php                             24-Jun-2024 06:05                8242
class.sessionhandler.php                           24-Jun-2024 06:06               25802
class.sessionhandlerinterface.php                  24-Jun-2024 06:06               15851
class.sessionidinterface.php                       24-Jun-2024 06:06                3294
class.sessionupdatetimestamphandlerinterface.php   24-Jun-2024 06:06                4533
class.shmop.php                                    24-Jun-2024 06:05                1748
class.simdjsonexception.php                        24-Jun-2024 06:05                5067
class.simdjsonvalueerror.php                       24-Jun-2024 06:05                8383
class.simplexmlelement.php                         24-Jun-2024 06:06               18774
class.simplexmliterator.php                        24-Jun-2024 06:06               16710
class.snmp.php                                     24-Jun-2024 06:05               28329
class.snmpexception.php                            24-Jun-2024 06:05                9085
class.soapclient.php                               24-Jun-2024 06:06               34539
class.soapfault.php                                24-Jun-2024 06:06               14373
class.soapheader.php                               24-Jun-2024 06:06                6079
class.soapparam.php                                24-Jun-2024 06:06                3761
class.soapserver.php                               24-Jun-2024 06:06               10103
class.soapvar.php                                  24-Jun-2024 06:06                7895
class.socket.php                                   24-Jun-2024 06:05                1797
class.sodiumexception.php                          24-Jun-2024 06:05                8447
class.solrclient.php                               24-Jun-2024 06:05               24755
class.solrclientexception.php                      24-Jun-2024 06:05                9726
class.solrcollapsefunction.php                     24-Jun-2024 06:05               11815
class.solrdismaxquery.php                          24-Jun-2024 06:05              111914
class.solrdocument.php                             24-Jun-2024 06:05               23479
class.solrdocumentfield.php                        24-Jun-2024 06:05                4678
class.solrexception.php                            24-Jun-2024 06:05               10116
class.solrgenericresponse.php                      24-Jun-2024 06:05               12680
class.solrillegalargumentexception.php             24-Jun-2024 06:05                9850
class.solrillegaloperationexception.php            24-Jun-2024 06:05                9888
class.solrinputdocument.php                        24-Jun-2024 06:05               19518
class.solrmissingmandatoryparameterexception.php   24-Jun-2024 06:05                9041
class.solrmodifiableparams.php                     24-Jun-2024 06:05                8996
class.solrobject.php                               24-Jun-2024 06:05                5866
class.solrparams.php                               24-Jun-2024 06:05                9178
class.solrpingresponse.php                         24-Jun-2024 06:05               11155
class.solrquery.php                                24-Jun-2024 06:05              119059
class.solrqueryresponse.php                        24-Jun-2024 06:05               12599
class.solrresponse.php                             24-Jun-2024 06:05               14351
class.solrserverexception.php                      24-Jun-2024 06:05                9732
class.solrupdateresponse.php                       24-Jun-2024 06:05               12647
class.solrutils.php                                24-Jun-2024 06:05                4966
class.spldoublylinkedlist.php                      24-Jun-2024 06:05               17726
class.splfileinfo.php                              24-Jun-2024 06:05               18539
class.splfileobject.php                            24-Jun-2024 06:05               37791
class.splfixedarray.php                            24-Jun-2024 06:05               20046
class.splheap.php                                  24-Jun-2024 06:05                7890
class.splmaxheap.php                               24-Jun-2024 06:05                7231
class.splminheap.php                               24-Jun-2024 06:05                7242
class.splobjectstorage.php                         24-Jun-2024 06:05               21344
class.splobserver.php                              24-Jun-2024 06:05                2864
class.splpriorityqueue.php                         24-Jun-2024 06:05               11940
class.splqueue.php                                 24-Jun-2024 06:05               17248
class.splstack.php                                 24-Jun-2024 06:05               14432
class.splsubject.php                               24-Jun-2024 06:05                3730
class.spltempfileobject.php                        24-Jun-2024 06:05               31886
class.spoofchecker.php                             24-Jun-2024 06:05               17798
class.sqlite3.php                                  24-Jun-2024 06:05               40182
class.sqlite3exception.php                         24-Jun-2024 06:05                8431
class.sqlite3result.php                            24-Jun-2024 06:05                5926
class.sqlite3stmt.php                              24-Jun-2024 06:05                8537
class.stdclass.php                                 24-Jun-2024 06:05                6767
class.stomp.php                                    24-Jun-2024 06:05               21692
class.stompexception.php                           24-Jun-2024 06:05                5885
class.stompframe.php                               24-Jun-2024 06:05                4377
class.streamwrapper.php                            24-Jun-2024 06:05               20632
class.stringable.php                               24-Jun-2024 06:05                8294
class.svm.php                                      24-Jun-2024 06:05               18484
class.svmmodel.php                                 24-Jun-2024 06:05                6948
class.swoole-async.php                             24-Jun-2024 06:05                8196
class.swoole-atomic.php                            24-Jun-2024 06:05                5124
class.swoole-buffer.php                            24-Jun-2024 06:05                7766
class.swoole-channel.php                           24-Jun-2024 06:05                4002
class.swoole-client.php                            24-Jun-2024 06:05               16738
class.swoole-connection-iterator.php               24-Jun-2024 06:05                7616
class.swoole-coroutine.php                         24-Jun-2024 06:05               19186
class.swoole-event.php                             24-Jun-2024 06:05                7628
class.swoole-exception.php                         24-Jun-2024 06:05                4574
class.swoole-http-client.php                       24-Jun-2024 06:05               15087
class.swoole-http-request.php                      24-Jun-2024 06:05                3062
class.swoole-http-response.php                     24-Jun-2024 06:05               11013
class.swoole-http-server.php                       24-Jun-2024 06:05               26464
class.swoole-lock.php                              24-Jun-2024 06:05                4838
class.swoole-mmap.php                              24-Jun-2024 06:05                3109
class.swoole-mysql-exception.php                   24-Jun-2024 06:05                4615
class.swoole-mysql.php                             24-Jun-2024 06:05                5528
class.swoole-process.php                           24-Jun-2024 06:05               13820
class.swoole-redis-server.php                      24-Jun-2024 06:05               32111
class.swoole-serialize.php                         24-Jun-2024 06:05                3609
class.swoole-server.php                            24-Jun-2024 06:05               30269
class.swoole-table.php                             24-Jun-2024 06:05               12815
class.swoole-timer.php                             24-Jun-2024 06:05                5093
class.swoole-websocket-frame.php                   24-Jun-2024 06:05                1951
class.swoole-websocket-server.php                  24-Jun-2024 06:05                7899
class.syncevent.php                                24-Jun-2024 06:05                5014
class.syncmutex.php                                24-Jun-2024 06:05                4301
class.syncreaderwriter.php                         24-Jun-2024 06:05                5271
class.syncsemaphore.php                            24-Jun-2024 06:05                4710
class.syncsharedmemory.php                         24-Jun-2024 06:05                5637
class.sysvmessagequeue.php                         24-Jun-2024 06:05                1843
class.sysvsemaphore.php                            24-Jun-2024 06:05                1828
class.sysvsharedmemory.php                         24-Jun-2024 06:05                1846
class.thread.php                                   24-Jun-2024 06:05               11437
class.threaded.php                                 24-Jun-2024 06:05                8893
class.throwable.php                                24-Jun-2024 06:05                7338
class.tidy.php                                     24-Jun-2024 06:05               18876
class.tidynode.php                                 24-Jun-2024 06:05               11599
class.transliterator.php                           24-Jun-2024 06:05               10296
class.traversable.php                              24-Jun-2024 06:05                4455
class.typeerror.php                                24-Jun-2024 06:05                9506
class.uconverter.php                               24-Jun-2024 06:05               41442
class.ui-area.php                                  24-Jun-2024 06:06               12254
class.ui-control.php                               24-Jun-2024 06:06                5475
class.ui-controls-box.php                          24-Jun-2024 06:06               10123
class.ui-controls-button.php                       24-Jun-2024 06:06                6676
class.ui-controls-check.php                        24-Jun-2024 06:06                7520
class.ui-controls-colorbutton.php                  24-Jun-2024 06:06                6555
class.ui-controls-combo.php                        24-Jun-2024 06:06                6644
class.ui-controls-editablecombo.php                24-Jun-2024 06:06                6756
class.ui-controls-entry.php                        24-Jun-2024 06:06                9644
class.ui-controls-form.php                         24-Jun-2024 06:06                8046
class.ui-controls-grid.php                         24-Jun-2024 06:06               13154
class.ui-controls-group.php                        24-Jun-2024 06:06                8354
class.ui-controls-label.php                        24-Jun-2024 06:06                6427
class.ui-controls-multilineentry.php               24-Jun-2024 06:06                9887
class.ui-controls-picker.php                       24-Jun-2024 06:06                7574
class.ui-controls-progress.php                     24-Jun-2024 06:06                5928
class.ui-controls-radio.php                        24-Jun-2024 06:06                6623
class.ui-controls-separator.php                    24-Jun-2024 06:06                7078
class.ui-controls-slider.php                       24-Jun-2024 06:06                7011
class.ui-controls-spin.php                         24-Jun-2024 06:06                6881
class.ui-controls-tab.php                          24-Jun-2024 06:06                9152
class.ui-draw-brush-gradient.php                   24-Jun-2024 06:06                7336
class.ui-draw-brush-lineargradient.php             24-Jun-2024 06:06                6588
class.ui-draw-brush-radialgradient.php             24-Jun-2024 06:06                6774
class.ui-draw-brush.php                            24-Jun-2024 06:06                4435
class.ui-draw-color.php                            24-Jun-2024 06:06                8591
class.ui-draw-line-cap.php                         24-Jun-2024 06:06                3753
class.ui-draw-line-join.php                        24-Jun-2024 06:06                3737
class.ui-draw-matrix.php                           24-Jun-2024 06:06                5625
class.ui-draw-path.php                             24-Jun-2024 06:06               10767
class.ui-draw-pen.php                              24-Jun-2024 06:06                8132
class.ui-draw-stroke.php                           24-Jun-2024 06:06                6883
class.ui-draw-text-font-descriptor.php             24-Jun-2024 06:06                6045
class.ui-draw-text-font-italic.php                 24-Jun-2024 06:06                4112
class.ui-draw-text-font-stretch.php                24-Jun-2024 06:06                8308
class.ui-draw-text-font-weight.php                 24-Jun-2024 06:06                8910
class.ui-draw-text-font.php                        24-Jun-2024 06:06                4874
class.ui-draw-text-layout.php                      24-Jun-2024 06:06                5284
class.ui-exception-invalidargumentexception.php    24-Jun-2024 06:06                7806
class.ui-exception-runtimeexception.php            24-Jun-2024 06:06                7729
class.ui-executor.php                              24-Jun-2024 06:06                5435
class.ui-key.php                                   24-Jun-2024 06:06               21352
class.ui-menu.php                                  24-Jun-2024 06:06                6293
class.ui-menuitem.php                              24-Jun-2024 06:06                3763
class.ui-point.php                                 24-Jun-2024 06:06                6322
class.ui-size.php                                  24-Jun-2024 06:06                6406
class.ui-window.php                                24-Jun-2024 06:06               13096
class.underflowexception.php                       24-Jun-2024 06:05                8587
class.unexpectedvalueexception.php                 24-Jun-2024 06:05                8790
class.unhandledmatcherror.php                      24-Jun-2024 06:05                8640
class.unitenum.php                                 24-Jun-2024 06:05                2863
class.v8js.php                                     24-Jun-2024 06:05                9057
class.v8jsexception.php                            24-Jun-2024 06:05               11358
class.valueerror.php                               24-Jun-2024 06:05                8575
class.variant.php                                  24-Jun-2024 06:06                5681
class.varnishadmin.php                             24-Jun-2024 06:05               11535
class.varnishlog.php                               24-Jun-2024 06:05               34801
class.varnishstat.php                              24-Jun-2024 06:05                3012
class.volatile.php                                 24-Jun-2024 06:05               11815
class.vtiful-kernel-excel.php                      24-Jun-2024 06:05               12051
class.vtiful-kernel-format.php                     24-Jun-2024 06:05               16084
class.weakmap.php                                  24-Jun-2024 06:05                9375
class.weakreference.php                            24-Jun-2024 06:05                5699
class.win32serviceexception.php                    24-Jun-2024 06:06                7846
class.wkhtmltox-image-converter.php                24-Jun-2024 06:05                4162
class.wkhtmltox-pdf-converter.php                  24-Jun-2024 06:05                4518
class.wkhtmltox-pdf-object.php                     24-Jun-2024 06:05                3000
class.worker.php                                   24-Jun-2024 06:05                8561
class.xmldiff-base.php                             24-Jun-2024 06:06                4136
class.xmldiff-dom.php                              24-Jun-2024 06:06                5079
class.xmldiff-file.php                             24-Jun-2024 06:06                5055
class.xmldiff-memory.php                           24-Jun-2024 06:06                5087
class.xmlparser.php                                24-Jun-2024 06:06                1837
class.xmlreader.php                                24-Jun-2024 06:06               40820
class.xmlwriter.php                                24-Jun-2024 06:06               32380
class.xsltprocessor.php                            24-Jun-2024 06:06               11685
class.yac.php                                      24-Jun-2024 06:05                9573
class.yaconf.php                                   24-Jun-2024 06:05                3500
class.yaf-action-abstract.php                      24-Jun-2024 06:05               12738
class.yaf-application.php                          24-Jun-2024 06:05               12673
class.yaf-bootstrap-abstract.php                   24-Jun-2024 06:05                5574
class.yaf-config-abstract.php                      24-Jun-2024 06:05                5231
class.yaf-config-ini.php                           24-Jun-2024 06:05               17814
class.yaf-config-simple.php                        24-Jun-2024 06:05               13240
class.yaf-controller-abstract.php                  24-Jun-2024 06:05               19232
class.yaf-dispatcher.php                           24-Jun-2024 06:05               20267
class.yaf-exception-dispatchfailed.php             24-Jun-2024 06:05                2668
class.yaf-exception-loadfailed-action.php          24-Jun-2024 06:05                2739
class.yaf-exception-loadfailed-controller.php      24-Jun-2024 06:05                2764
class.yaf-exception-loadfailed-module.php          24-Jun-2024 06:05                2728
class.yaf-exception-loadfailed-view.php            24-Jun-2024 06:05                2668
class.yaf-exception-loadfailed.php                 24-Jun-2024 06:05                2642
class.yaf-exception-routerfailed.php               24-Jun-2024 06:05                2653
class.yaf-exception-startuperror.php               24-Jun-2024 06:05                2651
class.yaf-exception-typeerror.php                  24-Jun-2024 06:05                2622
class.yaf-exception.php                            24-Jun-2024 06:05                8499
class.yaf-loader.php                               24-Jun-2024 06:05               18850
class.yaf-plugin-abstract.php                      24-Jun-2024 06:05               16061
class.yaf-registry.php                             24-Jun-2024 06:05                6043
class.yaf-request-abstract.php                     24-Jun-2024 06:05               23761
class.yaf-request-http.php                         24-Jun-2024 06:05               23225
class.yaf-request-simple.php                       24-Jun-2024 06:05               22712
class.yaf-response-abstract.php                    24-Jun-2024 06:05               11827
class.yaf-route-interface.php                      24-Jun-2024 06:05                3746
class.yaf-route-map.php                            24-Jun-2024 06:05                6519
class.yaf-route-regex.php                          24-Jun-2024 06:05                8412
class.yaf-route-rewrite.php                        24-Jun-2024 06:05                7516
class.yaf-route-simple.php                         24-Jun-2024 06:05                6592
class.yaf-route-static.php                         24-Jun-2024 06:05                5066
class.yaf-route-supervar.php                       24-Jun-2024 06:05                4757
class.yaf-router.php                               24-Jun-2024 06:05               12062
class.yaf-session.php                              24-Jun-2024 06:05               12658
class.yaf-view-interface.php                       24-Jun-2024 06:05                6075
class.yaf-view-simple.php                          24-Jun-2024 06:05               11293
class.yar-client-exception.php                     24-Jun-2024 06:06                6642
class.yar-client.php                               24-Jun-2024 06:06                5846
class.yar-concurrent-client.php                    24-Jun-2024 06:06                6646
class.yar-server-exception.php                     24-Jun-2024 06:06                7099
class.yar-server.php                               24-Jun-2024 06:06                3496
class.ziparchive.php                               24-Jun-2024 06:05               91002
class.zmq.php                                      24-Jun-2024 06:05               42306
class.zmqcontext.php                               24-Jun-2024 06:05                5695
class.zmqdevice.php                                24-Jun-2024 06:05                7223
class.zmqpoll.php                                  24-Jun-2024 06:05                5267
class.zmqsocket.php                                24-Jun-2024 06:05               11615
class.zookeeper.php                                24-Jun-2024 06:05               56122
class.zookeeperauthenticationexception.php         24-Jun-2024 06:05                7736
class.zookeeperconfig.php                          24-Jun-2024 06:05                6455
class.zookeeperconnectionexception.php             24-Jun-2024 06:05                7731
class.zookeeperexception.php                       24-Jun-2024 06:05                7597
class.zookeepermarshallingexception.php            24-Jun-2024 06:05                7752
class.zookeepernonodeexception.php                 24-Jun-2024 06:05                7719
class.zookeeperoperationtimeoutexception.php       24-Jun-2024 06:05                7762
class.zookeepersessionexception.php                24-Jun-2024 06:05                7689
classobj.configuration.php                         24-Jun-2024 06:06                1380
classobj.constants.php                             24-Jun-2024 06:06                1242
classobj.examples.php                              24-Jun-2024 06:06               13556
classobj.requirements.php                          24-Jun-2024 06:06                1361
classobj.resources.php                             24-Jun-2024 06:06                1324
classobj.setup.php                                 24-Jun-2024 06:06                1663
closure.bind.php                                   24-Jun-2024 06:05                7948
closure.bindto.php                                 24-Jun-2024 06:05                9548
closure.call.php                                   24-Jun-2024 06:05                6371
closure.construct.php                              24-Jun-2024 06:05                2471
closure.fromcallable.php                           24-Jun-2024 06:05                3840
cmark.constants.php                                24-Jun-2024 06:06                4300
cmark.installation.php                             24-Jun-2024 06:06                2096
cmark.requirements.php                             24-Jun-2024 06:06                1407
cmark.setup.php                                    24-Jun-2024 06:06                1533
collator.asort.php                                 24-Jun-2024 06:05                9663
collator.compare.php                               24-Jun-2024 06:05               10635
collator.construct.php                             24-Jun-2024 06:05                5876
collator.create.php                                24-Jun-2024 06:05                5667
collator.getattribute.php                          24-Jun-2024 06:05                6177
collator.geterrorcode.php                          24-Jun-2024 06:05                5417
collator.geterrormessage.php                       24-Jun-2024 06:05                5434
collator.getlocale.php                             24-Jun-2024 06:05                6938
collator.getsortkey.php                            24-Jun-2024 06:05                7164
collator.getstrength.php                           24-Jun-2024 06:05                4961
collator.setattribute.php                          24-Jun-2024 06:05                6785
collator.setstrength.php                           24-Jun-2024 06:05               13745
collator.sort.php                                  24-Jun-2024 06:05                8478
collator.sortwithsortkeys.php                      24-Jun-2024 06:05                6655
collectable.isgarbage.php                          24-Jun-2024 06:05                3469
com.configuration.php                              24-Jun-2024 06:06                8054
com.constants.php                                  24-Jun-2024 06:06               26322
com.construct.php                                  24-Jun-2024 06:06                9514
com.error-handling.php                             24-Jun-2024 06:06                1640
com.examples.arrays.php                            24-Jun-2024 06:06                2116
com.examples.foreach.php                           24-Jun-2024 06:06                2923
com.examples.php                                   24-Jun-2024 06:06                1467
com.installation.php                               24-Jun-2024 06:06                1611
com.requirements.php                               24-Jun-2024 06:06                1363
com.resources.php                                  24-Jun-2024 06:06                1286
com.setup.php                                      24-Jun-2024 06:06                1686
commonmark-cql.construct.php                       24-Jun-2024 06:06                2242
commonmark-cql.invoke.php                          24-Jun-2024 06:06                3979
commonmark-interfaces-ivisitable.accept.php        24-Jun-2024 06:06                3176
commonmark-interfaces-ivisitor.enter.php           24-Jun-2024 06:06                4191
commonmark-interfaces-ivisitor.leave.php           24-Jun-2024 06:06                4199
commonmark-node-bulletlist.construct.php           24-Jun-2024 06:06                3225
commonmark-node-codeblock.construct.php            24-Jun-2024 06:06                2862
commonmark-node-heading.construct.php              24-Jun-2024 06:06                2666
commonmark-node-image.construct.php                24-Jun-2024 06:06                3305
commonmark-node-link.construct.php                 24-Jun-2024 06:06                3302
commonmark-node-orderedlist.construct.php          24-Jun-2024 06:06                4184
commonmark-node-text.construct.php                 24-Jun-2024 06:06                2696
commonmark-node.accept.php                         24-Jun-2024 06:06                2916
commonmark-node.appendchild.php                    24-Jun-2024 06:06                2733
commonmark-node.insertafter.php                    24-Jun-2024 06:06                2758
commonmark-node.insertbefore.php                   24-Jun-2024 06:06                2756
commonmark-node.prependchild.php                   24-Jun-2024 06:06                2760
commonmark-node.replace.php                        24-Jun-2024 06:06                2704
commonmark-node.unlink.php                         24-Jun-2024 06:06                2413
commonmark-parser.construct.php                    24-Jun-2024 06:06                3859
commonmark-parser.finish.php                       24-Jun-2024 06:06                2443
commonmark-parser.parse.php                        24-Jun-2024 06:06                2663
compersisthelper.construct.php                     24-Jun-2024 06:06                3647
compersisthelper.getcurfilename.php                24-Jun-2024 06:06                3168
compersisthelper.getmaxstreamsize.php              24-Jun-2024 06:06                3174
compersisthelper.initnew.php                       24-Jun-2024 06:06                3124
compersisthelper.loadfromfile.php                  24-Jun-2024 06:06                4335
compersisthelper.loadfromstream.php                24-Jun-2024 06:06                3552
compersisthelper.savetofile.php                    24-Jun-2024 06:06                6378
compersisthelper.savetostream.php                  24-Jun-2024 06:06                3579
componere-abstract-definition.addinterface.php     24-Jun-2024 06:05                3289
componere-abstract-definition.addmethod.php        24-Jun-2024 06:05                4014
componere-abstract-definition.addtrait.php         24-Jun-2024 06:05                3241
componere-abstract-definition.getreflector.php     24-Jun-2024 06:05                2423
componere-definition.addconstant.php               24-Jun-2024 06:05                4335
componere-definition.addproperty.php               24-Jun-2024 06:05                3746
componere-definition.construct.php                 24-Jun-2024 06:05                5974
componere-definition.getclosure.php                24-Jun-2024 06:05                3452
componere-definition.getclosures.php               24-Jun-2024 06:05                2704
componere-definition.isregistered.php              24-Jun-2024 06:05                2305
componere-definition.register.php                  24-Jun-2024 06:05                2451
componere-method.construct.php                     24-Jun-2024 06:05                2236
componere-method.getreflector.php                  24-Jun-2024 06:05                2226
componere-method.setprivate.php                    24-Jun-2024 06:05                2453
componere-method.setprotected.php                  24-Jun-2024 06:05                2468
componere-method.setstatic.php                     24-Jun-2024 06:05                2051
componere-patch.apply.php                          24-Jun-2024 06:05                1910
componere-patch.construct.php                      24-Jun-2024 06:05                3646
componere-patch.derive.php                         24-Jun-2024 06:05                3146
componere-patch.getclosure.php                     24-Jun-2024 06:05                3083
componere-patch.getclosures.php                    24-Jun-2024 06:05                2226
componere-patch.isapplied.php                      24-Jun-2024 06:05                1864
componere-patch.revert.php                         24-Jun-2024 06:05                1907
componere-value.construct.php                      24-Jun-2024 06:05                2668
componere-value.hasdefault.php                     24-Jun-2024 06:05                1923
componere-value.isprivate.php                      24-Jun-2024 06:05                1929
componere-value.isprotected.php                    24-Jun-2024 06:05                1939
componere-value.isstatic.php                       24-Jun-2024 06:05                1923
componere-value.setprivate.php                     24-Jun-2024 06:05                2476
componere-value.setprotected.php                   24-Jun-2024 06:05                2490
componere-value.setstatic.php                      24-Jun-2024 06:05                2068
componere.cast.php                                 24-Jun-2024 06:05                4934
componere.cast_by_ref.php                          24-Jun-2024 06:05                5102
componere.installation.php                         24-Jun-2024 06:05                1418
componere.requirements.php                         24-Jun-2024 06:05                1293
componere.setup.php                                24-Jun-2024 06:05                1569
configuration.changes.modes.php                    24-Jun-2024 06:05                4085
configuration.changes.php                          24-Jun-2024 06:05                8928
configuration.file.per-user.php                    24-Jun-2024 06:05                3230
configuration.file.php                             24-Jun-2024 06:05               10306
configuration.php                                  24-Jun-2024 06:05                1835
configure.about.php                                24-Jun-2024 06:06               12825
configure.php                                      24-Jun-2024 06:06                1514
context.ftp.php                                    24-Jun-2024 06:05                4440
context.http.php                                   24-Jun-2024 06:05               16299
context.params.php                                 24-Jun-2024 06:05                2600
context.phar.php                                   24-Jun-2024 06:05                2913
context.php                                        24-Jun-2024 06:05                3272
context.socket.php                                 24-Jun-2024 06:05                9647
context.ssl.php                                    24-Jun-2024 06:05               12843
context.zip.php                                    24-Jun-2024 06:05                4393
context.zlib.php                                   24-Jun-2024 06:05                2589
control-structures.alternative-syntax.php          24-Jun-2024 06:05                6818
control-structures.break.php                       24-Jun-2024 06:05                4628
control-structures.continue.php                    24-Jun-2024 06:05                7986
control-structures.declare.php                     24-Jun-2024 06:05               10173
control-structures.do.while.php                    24-Jun-2024 06:05                5073
control-structures.else.php                        24-Jun-2024 06:05                4816
control-structures.elseif.php                      24-Jun-2024 06:05                7604
control-structures.for.php                         24-Jun-2024 06:05               11703
control-structures.foreach.php                     24-Jun-2024 06:05               20762
control-structures.goto.php                        24-Jun-2024 06:05                7121
control-structures.if.php                          24-Jun-2024 06:05                4847
control-structures.intro.php                       24-Jun-2024 06:05                2626
control-structures.match.php                       24-Jun-2024 06:05               20353
control-structures.switch.php                      24-Jun-2024 06:05               18895
control-structures.while.php                       24-Jun-2024 06:05                4639
copyright.php                                      24-Jun-2024 06:05                2081
countable.count.php                                24-Jun-2024 06:05                5373
ctype.configuration.php                            24-Jun-2024 06:06                1365
ctype.constants.php                                24-Jun-2024 06:06                1228
ctype.installation.php                             24-Jun-2024 06:06                1608
ctype.requirements.php                             24-Jun-2024 06:06                1342
ctype.resources.php                                24-Jun-2024 06:06                1303
ctype.setup.php                                    24-Jun-2024 06:06                1698
cubrid.configuration.php                           24-Jun-2024 06:05                1311
cubrid.constants.php                               24-Jun-2024 06:05               13866
cubrid.examples.php                                24-Jun-2024 06:05               13883
cubrid.installation.php                            24-Jun-2024 06:05                2193
cubrid.requirements.php                            24-Jun-2024 06:05                1369
cubrid.resources.php                               24-Jun-2024 06:05                3191
cubrid.setup.php                                   24-Jun-2024 06:05                1709
cubridmysql.cubrid.php                             24-Jun-2024 06:05                4959
curl.configuration.php                             24-Jun-2024 06:05                2677
curl.constants.php                                 24-Jun-2024 06:05              205969
curl.examples-basic.php                            24-Jun-2024 06:05                4650
curl.examples.php                                  24-Jun-2024 06:05                1431
curl.installation.php                              24-Jun-2024 06:05                2591
curl.requirements.php                              24-Jun-2024 06:05                1580
curl.resources.php                                 24-Jun-2024 06:05                1478
curl.setup.php                                     24-Jun-2024 06:05                1706
curlfile.construct.php                             24-Jun-2024 06:05               21310
curlfile.getfilename.php                           24-Jun-2024 06:05                2191
curlfile.getmimetype.php                           24-Jun-2024 06:05                2190
curlfile.getpostfilename.php                       24-Jun-2024 06:05                2270
curlfile.setmimetype.php                           24-Jun-2024 06:05                2501
curlfile.setpostfilename.php                       24-Jun-2024 06:05                2561
curlstringfile.construct.php                       24-Jun-2024 06:05                7057
dateinterval.construct.php                         24-Jun-2024 06:05               13654
dateinterval.createfromdatestring.php              24-Jun-2024 06:05               15665
dateinterval.format.php                            24-Jun-2024 06:05               14973
dateperiod.construct.php                           24-Jun-2024 06:05               20040
dateperiod.createfromiso8601string.php             24-Jun-2024 06:05                8030
dateperiod.getdateinterval.php                     24-Jun-2024 06:05                4833
dateperiod.getenddate.php                          24-Jun-2024 06:05                7770
dateperiod.getrecurrences.php                      24-Jun-2024 06:05                8957
dateperiod.getstartdate.php                        24-Jun-2024 06:05                5306
datetime.add.php                                   24-Jun-2024 06:05                4906
datetime.configuration.php                         24-Jun-2024 06:05                6444
datetime.constants.php                             24-Jun-2024 06:05                3001
datetime.construct.php                             24-Jun-2024 06:05                6349
datetime.createfromformat.php                      24-Jun-2024 06:05                7477
datetime.createfromimmutable.php                   24-Jun-2024 06:05                4942
datetime.createfrominterface.php                   24-Jun-2024 06:05                4901
datetime.diff.php                                  24-Jun-2024 06:05               17354
datetime.error.tree.php                            24-Jun-2024 06:05                3346
datetime.examples-arithmetic.php                   24-Jun-2024 06:05               15403
datetime.examples.php                              24-Jun-2024 06:05                1509
datetime.format.php                                24-Jun-2024 06:05               27082
datetime.formats.php                               24-Jun-2024 06:05               56052
datetime.getlasterrors.php                         24-Jun-2024 06:05                1900
datetime.getoffset.php                             24-Jun-2024 06:05                7956
datetime.gettimestamp.php                          24-Jun-2024 06:05               10372
datetime.gettimezone.php                           24-Jun-2024 06:05                7859
datetime.installation.php                          24-Jun-2024 06:05                1766
datetime.modify.php                                24-Jun-2024 06:05               14392
datetime.requirements.php                          24-Jun-2024 06:05                1331
datetime.resources.php                             24-Jun-2024 06:05                1324
datetime.set-state.php                             24-Jun-2024 06:05                2905
datetime.setdate.php                               24-Jun-2024 06:05                5541
datetime.setisodate.php                            24-Jun-2024 06:05                5747
datetime.settime.php                               24-Jun-2024 06:05                7147
datetime.settimestamp.php                          24-Jun-2024 06:05                5054
datetime.settimezone.php                           24-Jun-2024 06:05                9422
datetime.setup.php                                 24-Jun-2024 06:05                1761
datetime.sub.php                                   24-Jun-2024 06:05                6334
datetime.wakeup.php                                24-Jun-2024 06:05                3059
datetimeimmutable.add.php                          24-Jun-2024 06:05               10553
datetimeimmutable.construct.php                    24-Jun-2024 06:05               18590
datetimeimmutable.createfromformat.php             24-Jun-2024 06:05               47932
datetimeimmutable.createfrominterface.php          24-Jun-2024 06:05                5160
datetimeimmutable.createfrommutable.php            24-Jun-2024 06:05                5087
datetimeimmutable.getlasterrors.php                24-Jun-2024 06:05                5680
datetimeimmutable.modify.php                       24-Jun-2024 06:05                9395
datetimeimmutable.set-state.php                    24-Jun-2024 06:05                2809
datetimeimmutable.setdate.php                      24-Jun-2024 06:05                9182
datetimeimmutable.setisodate.php                   24-Jun-2024 06:05               12837
datetimeimmutable.settime.php                      24-Jun-2024 06:05               12062
datetimeimmutable.settimestamp.php                 24-Jun-2024 06:05                5852
datetimeimmutable.settimezone.php                  24-Jun-2024 06:05                6062
datetimeimmutable.sub.php                          24-Jun-2024 06:05               12067
datetimezone.construct.php                         24-Jun-2024 06:05               10759
datetimezone.getlocation.php                       24-Jun-2024 06:05                6035
datetimezone.getname.php                           24-Jun-2024 06:05                3684
datetimezone.getoffset.php                         24-Jun-2024 06:05                7153
datetimezone.gettransitions.php                    24-Jun-2024 06:05               12256
datetimezone.listabbreviations.php                 24-Jun-2024 06:05                6166
datetimezone.listidentifiers.php                   24-Jun-2024 06:05               14775
dba.configuration.php                              24-Jun-2024 06:05                2418
dba.constants.php                                  24-Jun-2024 06:05                2220
dba.example.php                                    24-Jun-2024 06:05                6240
dba.examples.php                                   24-Jun-2024 06:05                1367
dba.installation.php                               24-Jun-2024 06:05                9510
dba.requirements.php                               24-Jun-2024 06:05                7369
dba.resources.php                                  24-Jun-2024 06:05                1555
dba.setup.php                                      24-Jun-2024 06:05                1690
dbase.configuration.php                            24-Jun-2024 06:05                1365
dbase.constants.php                                24-Jun-2024 06:05                3809
dbase.installation.php                             24-Jun-2024 06:05                1697
dbase.requirements.php                             24-Jun-2024 06:05                1310
dbase.resources.php                                24-Jun-2024 06:05                1584
dbase.setup.php                                    24-Jun-2024 06:05                1714
debugger-about.php                                 24-Jun-2024 06:06                1594
debugger.php                                       24-Jun-2024 06:06                1427
dio.configuration.php                              24-Jun-2024 06:05                1351
dio.constants.php                                  24-Jun-2024 06:05               11087
dio.installation.php                               24-Jun-2024 06:05                2125
dio.requirements.php                               24-Jun-2024 06:05                1296
dio.resources.php                                  24-Jun-2024 06:05                1427
dio.setup.php                                      24-Jun-2024 06:05                1694
dir.configuration.php                              24-Jun-2024 06:05                1345
dir.constants.php                                  24-Jun-2024 06:05                2845
dir.requirements.php                               24-Jun-2024 06:05                1326
dir.resources.php                                  24-Jun-2024 06:05                1289
dir.setup.php                                      24-Jun-2024 06:05                1614
directory.close.php                                24-Jun-2024 06:05                2257
directory.read.php                                 24-Jun-2024 06:05                2391
directory.rewind.php                               24-Jun-2024 06:05                2296
directoryiterator.construct.php                    24-Jun-2024 06:05                5871
directoryiterator.current.php                      24-Jun-2024 06:05                6152
directoryiterator.getbasename.php                  24-Jun-2024 06:05                6420
directoryiterator.getextension.php                 24-Jun-2024 06:05                6196
directoryiterator.getfilename.php                  24-Jun-2024 06:05                5170
directoryiterator.isdot.php                        24-Jun-2024 06:05                5342
directoryiterator.key.php                          24-Jun-2024 06:05                6639
directoryiterator.next.php                         24-Jun-2024 06:05                5511
directoryiterator.rewind.php                       24-Jun-2024 06:05                5435
directoryiterator.seek.php                         24-Jun-2024 06:05                5404
directoryiterator.tostring.php                     24-Jun-2024 06:05                4691
directoryiterator.valid.php                        24-Jun-2024 06:05                5852
doc.changelog.php                                  24-Jun-2024 06:06                1364
dom.configuration.php                              24-Jun-2024 06:06                1351
dom.constants.php                                  24-Jun-2024 06:06               19636
dom.examples.php                                   24-Jun-2024 06:06                3008
dom.installation.php                               24-Jun-2024 06:06                1423
dom.requirements.php                               24-Jun-2024 06:06                1620
dom.resources.php                                  24-Jun-2024 06:06                1289
dom.setup.php                                      24-Jun-2024 06:06                1683
domattr.construct.php                              24-Jun-2024 06:06                5589
domattr.isid.php                                   24-Jun-2024 06:06                5046
domcdatasection.construct.php                      24-Jun-2024 06:06                5213
domcharacterdata.after.php                         24-Jun-2024 06:06                7901
domcharacterdata.appenddata.php                    24-Jun-2024 06:06                4450
domcharacterdata.before.php                        24-Jun-2024 06:06                7496
domcharacterdata.deletedata.php                    24-Jun-2024 06:06                5147
domcharacterdata.insertdata.php                    24-Jun-2024 06:06                4846
domcharacterdata.remove.php                        24-Jun-2024 06:06                5486
domcharacterdata.replacedata.php                   24-Jun-2024 06:06                5552
domcharacterdata.replacewith.php                   24-Jun-2024 06:06                7977
domcharacterdata.substringdata.php                 24-Jun-2024 06:06                4999
domchildnode.after.php                             24-Jun-2024 06:06                5774
domchildnode.before.php                            24-Jun-2024 06:06                5176
domchildnode.remove.php                            24-Jun-2024 06:06                3149
domchildnode.replacewith.php                       24-Jun-2024 06:06                5370
domcomment.construct.php                           24-Jun-2024 06:06                5036
domdocument.adoptnode.php                          24-Jun-2024 06:06                6757
domdocument.append.php                             24-Jun-2024 06:06                6913
domdocument.construct.php                          24-Jun-2024 06:06                4401
domdocument.createattribute.php                    24-Jun-2024 06:06                5980
domdocument.createattributens.php                  24-Jun-2024 06:06                8305
domdocument.createcdatasection.php                 24-Jun-2024 06:06                5588
domdocument.createcomment.php                      24-Jun-2024 06:06                5983
domdocument.createdocumentfragment.php             24-Jun-2024 06:06                5827
domdocument.createelement.php                      24-Jun-2024 06:06               11577
domdocument.createelementns.php                    24-Jun-2024 06:06               14162
domdocument.createentityreference.php              24-Jun-2024 06:06                6333
domdocument.createprocessinginstruction.php        24-Jun-2024 06:06                6616
domdocument.createtextnode.php                     24-Jun-2024 06:06                5984
domdocument.getelementbyid.php                     24-Jun-2024 06:06                7737
domdocument.getelementsbytagname.php               24-Jun-2024 06:06                6156
domdocument.getelementsbytagnamens.php             24-Jun-2024 06:06                7815
domdocument.importnode.php                         24-Jun-2024 06:06                8988
domdocument.load.php                               24-Jun-2024 06:06                6742
domdocument.loadhtml.php                           24-Jun-2024 06:06                7959
domdocument.loadhtmlfile.php                       24-Jun-2024 06:06                8108
domdocument.loadxml.php                            24-Jun-2024 06:06                6433
domdocument.normalizedocument.php                  24-Jun-2024 06:06                2984
domdocument.prepend.php                            24-Jun-2024 06:06                6992
domdocument.registernodeclass.php                  24-Jun-2024 06:06               20996
domdocument.relaxngvalidate.php                    24-Jun-2024 06:06                4069
domdocument.relaxngvalidatesource.php              24-Jun-2024 06:06                4123
domdocument.replacechildren.php                    24-Jun-2024 06:06                7298
domdocument.save.php                               24-Jun-2024 06:06                7669
domdocument.savehtml.php                           24-Jun-2024 06:06                7609
domdocument.savehtmlfile.php                       24-Jun-2024 06:06                8042
domdocument.savexml.php                            24-Jun-2024 06:06                9805
domdocument.schemavalidate.php                     24-Jun-2024 06:06                4507
domdocument.schemavalidatesource.php               24-Jun-2024 06:06                4562
domdocument.validate.php                           24-Jun-2024 06:06                6147
domdocument.xinclude.php                           24-Jun-2024 06:06                7193
domdocumentfragment.append.php                     24-Jun-2024 06:06                7607
domdocumentfragment.appendxml.php                  24-Jun-2024 06:06                5585
domdocumentfragment.construct.php                  24-Jun-2024 06:06                2160
domdocumentfragment.prepend.php                    24-Jun-2024 06:06                7648
domdocumentfragment.replacechildren.php            24-Jun-2024 06:06                8054
domelement.after.php                               24-Jun-2024 06:06                7573
domelement.append.php                              24-Jun-2024 06:06                7228
domelement.before.php                              24-Jun-2024 06:06                7131
domelement.construct.php                           24-Jun-2024 06:06                6707
domelement.getattribute.php                        24-Jun-2024 06:06                3540
domelement.getattributenames.php                   24-Jun-2024 06:06                4004
domelement.getattributenode.php                    24-Jun-2024 06:06                4124
domelement.getattributenodens.php                  24-Jun-2024 06:06                4617
domelement.getattributens.php                      24-Jun-2024 06:06                4083
domelement.getelementsbytagname.php                24-Jun-2024 06:06                3738
domelement.getelementsbytagnamens.php              24-Jun-2024 06:06                4845
domelement.hasattribute.php                        24-Jun-2024 06:06                3833
domelement.hasattributens.php                      24-Jun-2024 06:06                4308
domelement.insertadjacentelement.php               24-Jun-2024 06:06                6700
domelement.insertadjacenttext.php                  24-Jun-2024 06:06                6511
domelement.prepend.php                             24-Jun-2024 06:06                7264
domelement.remove.php                              24-Jun-2024 06:06                5091
domelement.removeattribute.php                     24-Jun-2024 06:06                4056
domelement.removeattributenode.php                 24-Jun-2024 06:06                4487
domelement.removeattributens.php                   24-Jun-2024 06:06                4345
domelement.replacechildren.php                     24-Jun-2024 06:06                7847
domelement.replacewith.php                         24-Jun-2024 06:06                7931
domelement.setattribute.php                        24-Jun-2024 06:06                6210
domelement.setattributenode.php                    24-Jun-2024 06:06                4791
domelement.setattributenodens.php                  24-Jun-2024 06:06                4862
domelement.setattributens.php                      24-Jun-2024 06:06                5272
domelement.setidattribute.php                      24-Jun-2024 06:06                4901
domelement.setidattributenode.php                  24-Jun-2024 06:06                4898
domelement.setidattributens.php                    24-Jun-2024 06:06                5351
domelement.toggleattribute.php                     24-Jun-2024 06:06                6435
domentityreference.construct.php                   24-Jun-2024 06:06                4876
domimplementation.construct.php                    24-Jun-2024 06:06                2167
domimplementation.createdocument.php               24-Jun-2024 06:06                7411
domimplementation.createdocumenttype.php           24-Jun-2024 06:06                9948
domimplementation.hasfeature.php                   24-Jun-2024 06:06                9361
domnamednodemap.count.php                          24-Jun-2024 06:06                2437
domnamednodemap.getiterator.php                    24-Jun-2024 06:06                3225
domnamednodemap.getnameditem.php                   24-Jun-2024 06:06                3512
domnamednodemap.getnameditemns.php                 24-Jun-2024 06:06                3964
domnamednodemap.item.php                           24-Jun-2024 06:06                3080
domnode.appendchild.php                            24-Jun-2024 06:06                8845
domnode.c14n.php                                   24-Jun-2024 06:06                8080
domnode.c14nfile.php                               24-Jun-2024 06:06                5795
domnode.clonenode.php                              24-Jun-2024 06:06                2854
domnode.contains.php                               24-Jun-2024 06:06                5387
domnode.getlineno.php                              24-Jun-2024 06:06                4930
domnode.getnodepath.php                            24-Jun-2024 06:06                5266
domnode.getrootnode.php                            24-Jun-2024 06:06                4426
domnode.hasattributes.php                          24-Jun-2024 06:06                2993
domnode.haschildnodes.php                          24-Jun-2024 06:06                2858
domnode.insertbefore.php                           24-Jun-2024 06:06                5491
domnode.isdefaultnamespace.php                     24-Jun-2024 06:06                2950
domnode.isequalnode.php                            24-Jun-2024 06:06                4732
domnode.issamenode.php                             24-Jun-2024 06:06                2798
domnode.issupported.php                            24-Jun-2024 06:06                3877
domnode.lookupnamespaceuri.php                     24-Jun-2024 06:06                3622
domnode.lookupprefix.php                           24-Jun-2024 06:06                3252
domnode.normalize.php                              24-Jun-2024 06:06                2831
domnode.removechild.php                            24-Jun-2024 06:06                7052
domnode.replacechild.php                           24-Jun-2024 06:06                5734
domnodelist.count.php                              24-Jun-2024 06:06                2365
domnodelist.getiterator.php                        24-Jun-2024 06:06                3124
domnodelist.item.php                               24-Jun-2024 06:06                6994
domparentnode.append.php                           24-Jun-2024 06:06                4831
domparentnode.prepend.php                          24-Jun-2024 06:06                4870
domparentnode.replacechildren.php                  24-Jun-2024 06:06                6666
domprocessinginstruction.construct.php             24-Jun-2024 06:06                6734
domtext.construct.php                              24-Jun-2024 06:06                4821
domtext.iselementcontentwhitespace.php             24-Jun-2024 06:06                2670
domtext.iswhitespaceinelementcontent.php           24-Jun-2024 06:06                2897
domtext.splittext.php                              24-Jun-2024 06:06                3221
domxpath.construct.php                             24-Jun-2024 06:06                3606
domxpath.evaluate.php                              24-Jun-2024 06:06                8089
domxpath.query.php                                 24-Jun-2024 06:06               12555
domxpath.registernamespace.php                     24-Jun-2024 06:06                3298
domxpath.registerphpfunctions.php                  24-Jun-2024 06:06               13840
dotnet.construct.php                               24-Jun-2024 06:06                3131
ds-collection.clear.php                            24-Jun-2024 06:05                3939
ds-collection.copy.php                             24-Jun-2024 06:05                4329
ds-collection.isempty.php                          24-Jun-2024 06:05                4266
ds-collection.toarray.php                          24-Jun-2024 06:05                4257
ds-deque.allocate.php                              24-Jun-2024 06:05                4731
ds-deque.apply.php                                 24-Jun-2024 06:05                5002
ds-deque.capacity.php                              24-Jun-2024 06:05                3961
ds-deque.clear.php                                 24-Jun-2024 06:05                3851
ds-deque.construct.php                             24-Jun-2024 06:05                4344
ds-deque.contains.php                              24-Jun-2024 06:05                7126
ds-deque.copy.php                                  24-Jun-2024 06:05                4198
ds-deque.count.php                                 24-Jun-2024 06:05                1627
ds-deque.filter.php                                24-Jun-2024 06:05                7610
ds-deque.find.php                                  24-Jun-2024 06:05                5440
ds-deque.first.php                                 24-Jun-2024 06:05                3774
ds-deque.get.php                                   24-Jun-2024 06:05                6638
ds-deque.insert.php                                24-Jun-2024 06:05                6688
ds-deque.isempty.php                               24-Jun-2024 06:05                4155
ds-deque.join.php                                  24-Jun-2024 06:05                5765
ds-deque.jsonserialize.php                         24-Jun-2024 06:05                1920
ds-deque.last.php                                  24-Jun-2024 06:05                3758
ds-deque.map.php                                   24-Jun-2024 06:05                5313
ds-deque.merge.php                                 24-Jun-2024 06:05                4900
ds-deque.pop.php                                   24-Jun-2024 06:05                4258
ds-deque.push.php                                  24-Jun-2024 06:05                4697
ds-deque.reduce.php                                24-Jun-2024 06:05                8012
ds-deque.remove.php                                24-Jun-2024 06:05                4887
ds-deque.reverse.php                               24-Jun-2024 06:05                3681
ds-deque.reversed.php                              24-Jun-2024 06:05                4019
ds-deque.rotate.php                                24-Jun-2024 06:05                5115
ds-deque.set.php                                   24-Jun-2024 06:05                6107
ds-deque.shift.php                                 24-Jun-2024 06:05                4357
ds-deque.slice.php                                 24-Jun-2024 06:05                7209
ds-deque.sort.php                                  24-Jun-2024 06:05                7430
ds-deque.sorted.php                                24-Jun-2024 06:05                7465
ds-deque.sum.php                                   24-Jun-2024 06:05                5268
ds-deque.toarray.php                               24-Jun-2024 06:05                4143
ds-deque.unshift.php                               24-Jun-2024 06:05                4755
ds-hashable.equals.php                             24-Jun-2024 06:05                3711
ds-hashable.hash.php                               24-Jun-2024 06:05                7574
ds-map.allocate.php                                24-Jun-2024 06:05                4595
ds-map.apply.php                                   24-Jun-2024 06:05                5749
ds-map.capacity.php                                24-Jun-2024 06:05                3253
ds-map.clear.php                                   24-Jun-2024 06:05                4335
ds-map.construct.php                               24-Jun-2024 06:05                4855
ds-map.copy.php                                    24-Jun-2024 06:05                4062
ds-map.count.php                                   24-Jun-2024 06:05                1590
ds-map.diff.php                                    24-Jun-2024 06:05                5493
ds-map.filter.php                                  24-Jun-2024 06:05                8460
ds-map.first.php                                   24-Jun-2024 06:05                4067
ds-map.get.php                                     24-Jun-2024 06:05                8529
ds-map.haskey.php                                  24-Jun-2024 06:05                4703
ds-map.hasvalue.php                                24-Jun-2024 06:05                4737
ds-map.intersect.php                               24-Jun-2024 06:05                5990
ds-map.isempty.php                                 24-Jun-2024 06:05                4382
ds-map.jsonserialize.php                           24-Jun-2024 06:05                1898
ds-map.keys.php                                    24-Jun-2024 06:05                3971
ds-map.ksort.php                                   24-Jun-2024 06:05                8137
ds-map.ksorted.php                                 24-Jun-2024 06:05                8233
ds-map.last.php                                    24-Jun-2024 06:05                4052
ds-map.map.php                                     24-Jun-2024 06:05                6336
ds-map.merge.php                                   24-Jun-2024 06:05                5921
ds-map.pairs.php                                   24-Jun-2024 06:05                4378
ds-map.put.php                                     24-Jun-2024 06:05               14024
ds-map.putall.php                                  24-Jun-2024 06:05                5578
ds-map.reduce.php                                  24-Jun-2024 06:05                8928
ds-map.remove.php                                  24-Jun-2024 06:05                7066
ds-map.reverse.php                                 24-Jun-2024 06:05                4138
ds-map.reversed.php                                24-Jun-2024 06:05                4250
ds-map.skip.php                                    24-Jun-2024 06:05                4658
ds-map.slice.php                                   24-Jun-2024 06:05                8094
ds-map.sort.php                                    24-Jun-2024 06:05                8069
ds-map.sorted.php                                  24-Jun-2024 06:05                8216
ds-map.sum.php                                     24-Jun-2024 06:05                5756
ds-map.toarray.php                                 24-Jun-2024 06:05                5174
ds-map.union.php                                   24-Jun-2024 06:05                5958
ds-map.values.php                                  24-Jun-2024 06:05                3964
ds-map.xor.php                                     24-Jun-2024 06:05                5500
ds-pair.clear.php                                  24-Jun-2024 06:05                3762
ds-pair.construct.php                              24-Jun-2024 06:05                2624
ds-pair.copy.php                                   24-Jun-2024 06:05                4110
ds-pair.isempty.php                                24-Jun-2024 06:05                4104
ds-pair.jsonserialize.php                          24-Jun-2024 06:05                1918
ds-pair.toarray.php                                24-Jun-2024 06:05                4089
ds-priorityqueue.allocate.php                      24-Jun-2024 06:05                4930
ds-priorityqueue.capacity.php                      24-Jun-2024 06:05                3465
ds-priorityqueue.clear.php                         24-Jun-2024 06:05                4517
ds-priorityqueue.construct.php                     24-Jun-2024 06:05                2949
ds-priorityqueue.copy.php                          24-Jun-2024 06:05                4502
ds-priorityqueue.count.php                         24-Jun-2024 06:05                1736
ds-priorityqueue.isempty.php                       24-Jun-2024 06:05                5067
ds-priorityqueue.jsonserialize.php                 24-Jun-2024 06:05                2038
ds-priorityqueue.peek.php                          24-Jun-2024 06:05                4723
ds-priorityqueue.pop.php                           24-Jun-2024 06:05                5521
ds-priorityqueue.push.php                          24-Jun-2024 06:05                5621
ds-priorityqueue.toarray.php                       24-Jun-2024 06:05                5258
ds-queue.allocate.php                              24-Jun-2024 06:05                4981
ds-queue.capacity.php                              24-Jun-2024 06:05                3972
ds-queue.clear.php                                 24-Jun-2024 06:05                3845
ds-queue.construct.php                             24-Jun-2024 06:05                4339
ds-queue.copy.php                                  24-Jun-2024 06:05                4301
ds-queue.count.php                                 24-Jun-2024 06:05                1624
ds-queue.isempty.php                               24-Jun-2024 06:05                4173
ds-queue.jsonserialize.php                         24-Jun-2024 06:05                1926
ds-queue.peek.php                                  24-Jun-2024 06:05                4330
ds-queue.pop.php                                   24-Jun-2024 06:05                4865
ds-queue.push.php                                  24-Jun-2024 06:05                4718
ds-queue.toarray.php                               24-Jun-2024 06:05                4320
ds-sequence.allocate.php                           24-Jun-2024 06:05                4637
ds-sequence.apply.php                              24-Jun-2024 06:05                5125
ds-sequence.capacity.php                           24-Jun-2024 06:05                4521
ds-sequence.contains.php                           24-Jun-2024 06:05                7259
ds-sequence.filter.php                             24-Jun-2024 06:05                7820
ds-sequence.find.php                               24-Jun-2024 06:05                5572
ds-sequence.first.php                              24-Jun-2024 06:05                3892
ds-sequence.get.php                                24-Jun-2024 06:05                6772
ds-sequence.insert.php                             24-Jun-2024 06:05                6826
ds-sequence.join.php                               24-Jun-2024 06:05                5872
ds-sequence.last.php                               24-Jun-2024 06:05                3861
ds-sequence.map.php                                24-Jun-2024 06:05                5480
ds-sequence.merge.php                              24-Jun-2024 06:05                5067
ds-sequence.pop.php                                24-Jun-2024 06:05                4375
ds-sequence.push.php                               24-Jun-2024 06:05                4830
ds-sequence.reduce.php                             24-Jun-2024 06:05                8131
ds-sequence.remove.php                             24-Jun-2024 06:05                5006
ds-sequence.reverse.php                            24-Jun-2024 06:05                3804
ds-sequence.reversed.php                           24-Jun-2024 06:05                4162
ds-sequence.rotate.php                             24-Jun-2024 06:05                5265
ds-sequence.set.php                                24-Jun-2024 06:05                6240
ds-sequence.shift.php                              24-Jun-2024 06:05                4474
ds-sequence.slice.php                              24-Jun-2024 06:05                7419
ds-sequence.sort.php                               24-Jun-2024 06:05                7587
ds-sequence.sorted.php                             24-Jun-2024 06:05                7620
ds-sequence.sum.php                                24-Jun-2024 06:05                5427
ds-sequence.unshift.php                            24-Jun-2024 06:05                4910
ds-set.add.php                                     24-Jun-2024 06:05               12292
ds-set.allocate.php                                24-Jun-2024 06:05                4611
ds-set.capacity.php                                24-Jun-2024 06:05                3924
ds-set.clear.php                                   24-Jun-2024 06:05                3797
ds-set.construct.php                               24-Jun-2024 06:05                4296
ds-set.contains.php                                24-Jun-2024 06:05                7359
ds-set.copy.php                                    24-Jun-2024 06:05                4253
ds-set.count.php                                   24-Jun-2024 06:05                1594
ds-set.diff.php                                    24-Jun-2024 06:05                4797
ds-set.filter.php                                  24-Jun-2024 06:05                7641
ds-set.first.php                                   24-Jun-2024 06:05                3739
ds-set.get.php                                     24-Jun-2024 06:05                6587
ds-set.intersect.php                               24-Jun-2024 06:05                5038
ds-set.isempty.php                                 24-Jun-2024 06:05                4133
ds-set.join.php                                    24-Jun-2024 06:05                5720
ds-set.jsonserialize.php                           24-Jun-2024 06:05                1892
ds-set.last.php                                    24-Jun-2024 06:05                3740
ds-set.merge.php                                   24-Jun-2024 06:05                4867
ds-set.reduce.php                                  24-Jun-2024 06:05                7953
ds-set.remove.php                                  24-Jun-2024 06:05                5023
ds-set.reverse.php                                 24-Jun-2024 06:05                3645
ds-set.reversed.php                                24-Jun-2024 06:05                3989
ds-set.slice.php                                   24-Jun-2024 06:05                7172
ds-set.sort.php                                    24-Jun-2024 06:05                7402
ds-set.sorted.php                                  24-Jun-2024 06:05                7432
ds-set.sum.php                                     24-Jun-2024 06:05                5250
ds-set.toarray.php                                 24-Jun-2024 06:05                4122
ds-set.union.php                                   24-Jun-2024 06:05                4974
ds-set.xor.php                                     24-Jun-2024 06:05                4961
ds-stack.allocate.php                              24-Jun-2024 06:05                2917
ds-stack.capacity.php                              24-Jun-2024 06:05                2196
ds-stack.clear.php                                 24-Jun-2024 06:05                3842
ds-stack.construct.php                             24-Jun-2024 06:05                4309
ds-stack.copy.php                                  24-Jun-2024 06:05                4299
ds-stack.count.php                                 24-Jun-2024 06:05                1625
ds-stack.isempty.php                               24-Jun-2024 06:05                4176
ds-stack.jsonserialize.php                         24-Jun-2024 06:05                1926
ds-stack.peek.php                                  24-Jun-2024 06:05                4321
ds-stack.pop.php                                   24-Jun-2024 06:05                4859
ds-stack.push.php                                  24-Jun-2024 06:05                4739
ds-stack.toarray.php                               24-Jun-2024 06:05                4153
ds-vector.allocate.php                             24-Jun-2024 06:05                4562
ds-vector.apply.php                                24-Jun-2024 06:05                5048
ds-vector.capacity.php                             24-Jun-2024 06:05                4426
ds-vector.clear.php                                24-Jun-2024 06:05                3872
ds-vector.construct.php                            24-Jun-2024 06:05                4373
ds-vector.contains.php                             24-Jun-2024 06:05                7180
ds-vector.copy.php                                 24-Jun-2024 06:05                4325
ds-vector.count.php                                24-Jun-2024 06:05                1641
ds-vector.filter.php                               24-Jun-2024 06:05                7717
ds-vector.find.php                                 24-Jun-2024 06:05                5485
ds-vector.first.php                                24-Jun-2024 06:05                3794
ds-vector.get.php                                  24-Jun-2024 06:05                6676
ds-vector.insert.php                               24-Jun-2024 06:05                6734
ds-vector.isempty.php                              24-Jun-2024 06:05                4181
ds-vector.join.php                                 24-Jun-2024 06:05                5804
ds-vector.jsonserialize.php                        24-Jun-2024 06:05                1934
ds-vector.last.php                                 24-Jun-2024 06:05                3786
ds-vector.map.php                                  24-Jun-2024 06:05                5385
ds-vector.merge.php                                24-Jun-2024 06:05                4969
ds-vector.pop.php                                  24-Jun-2024 06:05                4288
ds-vector.push.php                                 24-Jun-2024 06:05                4730
ds-vector.reduce.php                               24-Jun-2024 06:05                8031
ds-vector.remove.php                               24-Jun-2024 06:05                4919
ds-vector.reverse.php                              24-Jun-2024 06:05                3712
ds-vector.reversed.php                             24-Jun-2024 06:05                4069
ds-vector.rotate.php                               24-Jun-2024 06:05                5117
ds-vector.set.php                                  24-Jun-2024 06:05                6155
ds-vector.shift.php                                24-Jun-2024 06:05                4387
ds-vector.slice.php                                24-Jun-2024 06:05                7291
ds-vector.sort.php                                 24-Jun-2024 06:05                7486
ds-vector.sorted.php                               24-Jun-2024 06:05                7521
ds-vector.sum.php                                  24-Jun-2024 06:05                5317
ds-vector.toarray.php                              24-Jun-2024 06:05                4176
ds-vector.unshift.php                              24-Jun-2024 06:05                4818
ds.constants.php                                   24-Jun-2024 06:05                1215
ds.examples.php                                    24-Jun-2024 06:05                4759
ds.installation.php                                24-Jun-2024 06:05                2619
ds.requirements.php                                24-Jun-2024 06:05                1311
ds.setup.php                                       24-Jun-2024 06:05                1513
eio.configuration.php                              24-Jun-2024 06:05                1346
eio.constants.php                                  24-Jun-2024 06:05               21884
eio.examples.php                                   24-Jun-2024 06:05               27130
eio.installation.php                               24-Jun-2024 06:05                1828
eio.requirements.php                               24-Jun-2024 06:05                1414
eio.resources.php                                  24-Jun-2024 06:05                1321
eio.setup.php                                      24-Jun-2024 06:05                1692
emptyiterator.current.php                          24-Jun-2024 06:05                2769
emptyiterator.key.php                              24-Jun-2024 06:05                2733
emptyiterator.next.php                             24-Jun-2024 06:05                2426
emptyiterator.rewind.php                           24-Jun-2024 06:05                2448
emptyiterator.valid.php                            24-Jun-2024 06:05                2749
enchant.configuration.php                          24-Jun-2024 06:05                1376
enchant.constants.php                              24-Jun-2024 06:05                2969
enchant.examples.php                               24-Jun-2024 06:05                5476
enchant.installation.php                           24-Jun-2024 06:05                3286
enchant.requirements.php                           24-Jun-2024 06:05                1897
enchant.resources.php                              24-Jun-2024 06:05                1428
enchant.setup.php                                  24-Jun-2024 06:05                1737
error.clone.php                                    24-Jun-2024 06:05                2847
error.construct.php                                24-Jun-2024 06:05                3459
error.getcode.php                                  24-Jun-2024 06:05                4107
error.getfile.php                                  24-Jun-2024 06:05                3798
error.getline.php                                  24-Jun-2024 06:05                3994
error.getmessage.php                               24-Jun-2024 06:05                3879
error.getprevious.php                              24-Jun-2024 06:05                6572
error.gettrace.php                                 24-Jun-2024 06:05                4372
error.gettraceasstring.php                         24-Jun-2024 06:05                4166
error.tostring.php                                 24-Jun-2024 06:05                4043
errorexception.construct.php                       24-Jun-2024 06:05                6233
errorexception.getseverity.php                     24-Jun-2024 06:05                4371
errorfunc.configuration.php                        24-Jun-2024 06:05               26105
errorfunc.constants.php                            24-Jun-2024 06:05               11708
errorfunc.examples.php                             24-Jun-2024 06:05               19316
errorfunc.requirements.php                         24-Jun-2024 06:05                1368
errorfunc.resources.php                            24-Jun-2024 06:05                1331
errorfunc.setup.php                                24-Jun-2024 06:05                1686
ev.backend.php                                     24-Jun-2024 06:05                3410
ev.configuration.php                               24-Jun-2024 06:05                1341
ev.depth.php                                       24-Jun-2024 06:05                3280
ev.embeddablebackends.php                          24-Jun-2024 06:05                6491
ev.examples.php                                    24-Jun-2024 06:05               41957
ev.feedsignal.php                                  24-Jun-2024 06:05                3402
ev.feedsignalevent.php                             24-Jun-2024 06:05                3189
ev.global.constants.php                            24-Jun-2024 06:05                1352
ev.installation.php                                24-Jun-2024 06:05                1825
ev.iteration.php                                   24-Jun-2024 06:05                2656
ev.now.php                                         24-Jun-2024 06:05                3127
ev.nowupdate.php                                   24-Jun-2024 06:05                3209
ev.periodic-modes.php                              24-Jun-2024 06:05                7701
ev.recommendedbackends.php                         24-Jun-2024 06:05                7183
ev.requirements.php                                24-Jun-2024 06:05                1349
ev.resources.php                                   24-Jun-2024 06:05                1286
ev.resume.php                                      24-Jun-2024 06:05                3731
ev.run.php                                         24-Jun-2024 06:05                5100
ev.setup.php                                       24-Jun-2024 06:05                1647
ev.sleep.php                                       24-Jun-2024 06:05                2461
ev.stop.php                                        24-Jun-2024 06:05                2901
ev.supportedbackends.php                           24-Jun-2024 06:05                6473
ev.suspend.php                                     24-Jun-2024 06:05                3498
ev.time.php                                        24-Jun-2024 06:05                2701
ev.verify.php                                      24-Jun-2024 06:05                2289
ev.watcher-callbacks.php                           24-Jun-2024 06:05                4562
ev.watchers.php                                    24-Jun-2024 06:05                3482
evcheck.construct.php                              24-Jun-2024 06:05                3676
evcheck.createstopped.php                          24-Jun-2024 06:05                3784
evchild.construct.php                              24-Jun-2024 06:05                6753
evchild.createstopped.php                          24-Jun-2024 06:05                5155
evchild.set.php                                    24-Jun-2024 06:05                3238
evembed.construct.php                              24-Jun-2024 06:05                7981
evembed.createstopped.php                          24-Jun-2024 06:05                4797
evembed.set.php                                    24-Jun-2024 06:05                2585
evembed.sweep.php                                  24-Jun-2024 06:05                3094
event.add.php                                      24-Jun-2024 06:05               10325
event.addsignal.php                                24-Jun-2024 06:05                1702
event.addtimer.php                                 24-Jun-2024 06:05                1711
event.callbacks.php                                24-Jun-2024 06:05                5924
event.configuration.php                            24-Jun-2024 06:05                1365
event.construct.php                                24-Jun-2024 06:05                4604
event.constructing.signal.events.php               24-Jun-2024 06:05                6243
event.del.php                                      24-Jun-2024 06:05                2662
event.delsignal.php                                24-Jun-2024 06:05                1702
event.deltimer.php                                 24-Jun-2024 06:05                1699
event.examples.php                                 24-Jun-2024 06:05              166149
event.flags.php                                    24-Jun-2024 06:05                2789
event.free.php                                     24-Jun-2024 06:05                3051
event.getsupportedmethods.php                      24-Jun-2024 06:05                2698
event.installation.php                             24-Jun-2024 06:05                1855
event.pending.php                                  24-Jun-2024 06:05                3146
event.persistence.php                              24-Jun-2024 06:05                3226
event.requirements.php                             24-Jun-2024 06:05                1596
event.resources.php                                24-Jun-2024 06:05                1279
event.set.php                                      24-Jun-2024 06:05                4723
event.setpriority.php                              24-Jun-2024 06:05                2639
event.settimer.php                                 24-Jun-2024 06:05                4152
event.setup.php                                    24-Jun-2024 06:05                1689
event.signal.php                                   24-Jun-2024 06:05                4337
event.timer.php                                    24-Jun-2024 06:05                3627
eventbase.construct.php                            24-Jun-2024 06:05                3077
eventbase.dispatch.php                             24-Jun-2024 06:05                3355
eventbase.exit.php                                 24-Jun-2024 06:05                3138
eventbase.free.php                                 24-Jun-2024 06:05                3406
eventbase.getfeatures.php                          24-Jun-2024 06:05                5813
eventbase.getmethod.php                            24-Jun-2024 06:05                4594
eventbase.gettimeofdaycached.php                   24-Jun-2024 06:05                2769
eventbase.gotexit.php                              24-Jun-2024 06:05                3389
eventbase.gotstop.php                              24-Jun-2024 06:05                3361
eventbase.loop.php                                 24-Jun-2024 06:05                3680
eventbase.priorityinit.php                         24-Jun-2024 06:05                3115
eventbase.reinit.php                               24-Jun-2024 06:05                2446
eventbase.stop.php                                 24-Jun-2024 06:05                2915
eventbuffer.add.php                                24-Jun-2024 06:05                3116
eventbuffer.addbuffer.php                          24-Jun-2024 06:05                3468
eventbuffer.appendfrom.php                         24-Jun-2024 06:05                4975
eventbuffer.construct.php                          24-Jun-2024 06:05                2006
eventbuffer.copyout.php                            24-Jun-2024 06:05                4011
eventbuffer.drain.php                              24-Jun-2024 06:05                3591
eventbuffer.enablelocking.php                      24-Jun-2024 06:05                2935
eventbuffer.expand.php                             24-Jun-2024 06:05                2912
eventbuffer.freeze.php                             24-Jun-2024 06:05                3164
eventbuffer.lock.php                               24-Jun-2024 06:05                3060
eventbuffer.prepend.php                            24-Jun-2024 06:05                3591
eventbuffer.prependbuffer.php                      24-Jun-2024 06:05                3753
eventbuffer.pullup.php                             24-Jun-2024 06:05                4717
eventbuffer.read.php                               24-Jun-2024 06:05                5000
eventbuffer.readfrom.php                           24-Jun-2024 06:05                4424
eventbuffer.readline.php                           24-Jun-2024 06:05                4345
eventbuffer.search.php                             24-Jun-2024 06:05                8439
eventbuffer.searcheol.php                          24-Jun-2024 06:05                4975
eventbuffer.substr.php                             24-Jun-2024 06:05                3631
eventbuffer.unfreeze.php                           24-Jun-2024 06:05                3178
eventbuffer.unlock.php                             24-Jun-2024 06:05                2890
eventbuffer.write.php                              24-Jun-2024 06:05                3537
eventbufferevent.about.callbacks.php               24-Jun-2024 06:05                6364
eventbufferevent.close.php                         24-Jun-2024 06:05                2624
eventbufferevent.connect.php                       24-Jun-2024 06:05               23973
eventbufferevent.connecthost.php                   24-Jun-2024 06:05               17859
eventbufferevent.construct.php                     24-Jun-2024 06:05                6926
eventbufferevent.createpair.php                    24-Jun-2024 06:05                4391
eventbufferevent.disable.php                       24-Jun-2024 06:05                3619
eventbufferevent.enable.php                        24-Jun-2024 06:05                4089
eventbufferevent.free.php                          24-Jun-2024 06:05                2845
eventbufferevent.getdnserrorstring.php             24-Jun-2024 06:05                3168
eventbufferevent.getenabled.php                    24-Jun-2024 06:05                3117
eventbufferevent.getinput.php                      24-Jun-2024 06:05                5071
eventbufferevent.getoutput.php                     24-Jun-2024 06:05                7952
eventbufferevent.read.php                          24-Jun-2024 06:05                3133
eventbufferevent.readbuffer.php                    24-Jun-2024 06:05                3305
eventbufferevent.setcallbacks.php                  24-Jun-2024 06:05                4625
eventbufferevent.setpriority.php                   24-Jun-2024 06:05                3020
eventbufferevent.settimeouts.php                   24-Jun-2024 06:05                3246
eventbufferevent.setwatermark.php                  24-Jun-2024 06:05                4157
eventbufferevent.sslerror.php                      24-Jun-2024 06:05                5953
eventbufferevent.sslfilter.php                     24-Jun-2024 06:05               34605
eventbufferevent.sslgetcipherinfo.php              24-Jun-2024 06:05                2979
eventbufferevent.sslgetciphername.php              24-Jun-2024 06:05                2882
eventbufferevent.sslgetcipherversion.php           24-Jun-2024 06:05                2911
eventbufferevent.sslgetprotocol.php                24-Jun-2024 06:05                2788
eventbufferevent.sslrenegotiate.php                24-Jun-2024 06:05                2879
eventbufferevent.sslsocket.php                     24-Jun-2024 06:05                5956
eventbufferevent.write.php                         24-Jun-2024 06:05                3301
eventbufferevent.writebuffer.php                   24-Jun-2024 06:05                3441
eventconfig.avoidmethod.php                        24-Jun-2024 06:05                4475
eventconfig.construct.php                          24-Jun-2024 06:05                4112
eventconfig.requirefeatures.php                    24-Jun-2024 06:05                6067
eventconfig.setflags.php                           24-Jun-2024 06:05                3418
eventconfig.setmaxdispatchinterval.php             24-Jun-2024 06:05                4614
eventdnsbase.addnameserverip.php                   24-Jun-2024 06:05                3048
eventdnsbase.addsearch.php                         24-Jun-2024 06:05                2615
eventdnsbase.clearsearch.php                       24-Jun-2024 06:05                2866
eventdnsbase.construct.php                         24-Jun-2024 06:05                7586
eventdnsbase.countnameservers.php                  24-Jun-2024 06:05                2595
eventdnsbase.loadhosts.php                         24-Jun-2024 06:05                2921
eventdnsbase.parseresolvconf.php                   24-Jun-2024 06:05                4297
eventdnsbase.setoption.php                         24-Jun-2024 06:05                3495
eventdnsbase.setsearchndots.php                    24-Jun-2024 06:05                2984
eventhttp.accept.php                               24-Jun-2024 06:05               12467
eventhttp.addserveralias.php                       24-Jun-2024 06:05                6517
eventhttp.bind.php                                 24-Jun-2024 06:05                7930
eventhttp.construct.php                            24-Jun-2024 06:05               17460
eventhttp.removeserveralias.php                    24-Jun-2024 06:05                3311
eventhttp.setallowedmethods.php                    24-Jun-2024 06:05                3454
eventhttp.setcallback.php                          24-Jun-2024 06:05               18129
eventhttp.setdefaultcallback.php                   24-Jun-2024 06:05                7935
eventhttp.setmaxbodysize.php                       24-Jun-2024 06:05                2969
eventhttp.setmaxheaderssize.php                    24-Jun-2024 06:05                2881
eventhttp.settimeout.php                           24-Jun-2024 06:05                2568
eventhttpconnection.construct.php                  24-Jun-2024 06:05                5177
eventhttpconnection.getbase.php                    24-Jun-2024 06:05                2670
eventhttpconnection.getpeer.php                    24-Jun-2024 06:05                3084
eventhttpconnection.makerequest.php                24-Jun-2024 06:05               11737
eventhttpconnection.setclosecallback.php           24-Jun-2024 06:05                9501
eventhttpconnection.setlocaladdress.php            24-Jun-2024 06:05                3268
eventhttpconnection.setlocalport.php               24-Jun-2024 06:05                3154
eventhttpconnection.setmaxbodysize.php             24-Jun-2024 06:05                3193
eventhttpconnection.setmaxheaderssize.php          24-Jun-2024 06:05                3214
eventhttpconnection.setretries.php                 24-Jun-2024 06:05                2798
eventhttpconnection.settimeout.php                 24-Jun-2024 06:05                2695
eventhttprequest.addheader.php                     24-Jun-2024 06:05                4033
eventhttprequest.cancel.php                        24-Jun-2024 06:05                2899
eventhttprequest.clearheaders.php                  24-Jun-2024 06:05                2851
eventhttprequest.closeconnection.php               24-Jun-2024 06:05                2454
eventhttprequest.construct.php                     24-Jun-2024 06:05               11472
eventhttprequest.findheader.php                    24-Jun-2024 06:05                3596
eventhttprequest.free.php                          24-Jun-2024 06:05                2362
eventhttprequest.getbufferevent.php                24-Jun-2024 06:05                3728
eventhttprequest.getcommand.php                    24-Jun-2024 06:05                2734
eventhttprequest.getconnection.php                 24-Jun-2024 06:05                4482
eventhttprequest.gethost.php                       24-Jun-2024 06:05                2911
eventhttprequest.getinputbuffer.php                24-Jun-2024 06:05                2813
eventhttprequest.getinputheaders.php               24-Jun-2024 06:05                2904
eventhttprequest.getoutputbuffer.php               24-Jun-2024 06:05                2872
eventhttprequest.getoutputheaders.php              24-Jun-2024 06:05                2855
eventhttprequest.getresponsecode.php               24-Jun-2024 06:05                3191
eventhttprequest.geturi.php                        24-Jun-2024 06:05                3104
eventhttprequest.removeheader.php                  24-Jun-2024 06:05                3556
eventhttprequest.senderror.php                     24-Jun-2024 06:05                5908
eventhttprequest.sendreply.php                     24-Jun-2024 06:05                4104
eventhttprequest.sendreplychunk.php                24-Jun-2024 06:05                3476
eventhttprequest.sendreplyend.php                  24-Jun-2024 06:05                3084
eventhttprequest.sendreplystart.php                24-Jun-2024 06:05                4363
eventlistener.construct.php                        24-Jun-2024 06:05               22481
eventlistener.disable.php                          24-Jun-2024 06:05                2866
eventlistener.enable.php                           24-Jun-2024 06:05                2852
eventlistener.getbase.php                          24-Jun-2024 06:05                2373
eventlistener.getsocketname.php                    24-Jun-2024 06:05                3416
eventlistener.setcallback.php                      24-Jun-2024 06:05                6076
eventlistener.seterrorcallback.php                 24-Jun-2024 06:05                4445
eventsslcontext.construct.php                      24-Jun-2024 06:05                5349
eventutil.construct.php                            24-Jun-2024 06:05                2200
eventutil.getlastsocketerrno.php                   24-Jun-2024 06:05                3345
eventutil.getlastsocketerror.php                   24-Jun-2024 06:05                3161
eventutil.getsocketfd.php                          24-Jun-2024 06:05                3263
eventutil.getsocketname.php                        24-Jun-2024 06:05                3819
eventutil.setsocketoption.php                      24-Jun-2024 06:05                5749
eventutil.sslrandpoll.php                          24-Jun-2024 06:05                2427
evfork.construct.php                               24-Jun-2024 06:05                3702
evfork.createstopped.php                           24-Jun-2024 06:05                3986
evidle.construct.php                               24-Jun-2024 06:05                3706
evidle.createstopped.php                           24-Jun-2024 06:05                4184
evio.construct.php                                 24-Jun-2024 06:05                4854
evio.createstopped.php                             24-Jun-2024 06:05                5190
evio.set.php                                       24-Jun-2024 06:05                2880
evloop.backend.php                                 24-Jun-2024 06:05                2757
evloop.check.php                                   24-Jun-2024 06:05                3341
evloop.child.php                                   24-Jun-2024 06:05                3823
evloop.construct.php                               24-Jun-2024 06:05                4073
evloop.defaultloop.php                             24-Jun-2024 06:05                4670
evloop.embed.php                                   24-Jun-2024 06:05                3866
evloop.fork.php                                    24-Jun-2024 06:05                3423
evloop.idle.php                                    24-Jun-2024 06:05                3443
evloop.invokepending.php                           24-Jun-2024 06:05                2269
evloop.io.php                                      24-Jun-2024 06:05                3879
evloop.loopfork.php                                24-Jun-2024 06:05                2607
evloop.now.php                                     24-Jun-2024 06:05                2871
evloop.nowupdate.php                               24-Jun-2024 06:05                3188
evloop.periodic.php                                24-Jun-2024 06:05                4017
evloop.prepare.php                                 24-Jun-2024 06:05                3441
evloop.resume.php                                  24-Jun-2024 06:05                2848
evloop.run.php                                     24-Jun-2024 06:05                5083
evloop.signal.php                                  24-Jun-2024 06:05                3746
evloop.stat.php                                    24-Jun-2024 06:05                3927
evloop.stop.php                                    24-Jun-2024 06:05                3013
evloop.suspend.php                                 24-Jun-2024 06:05                2840
evloop.timer.php                                   24-Jun-2024 06:05                3944
evloop.verify.php                                  24-Jun-2024 06:05                2613
evperiodic.again.php                               24-Jun-2024 06:05                2603
evperiodic.at.php                                  24-Jun-2024 06:05                2674
evperiodic.construct.php                           24-Jun-2024 06:05               10095
evperiodic.createstopped.php                       24-Jun-2024 06:05                5892
evperiodic.set.php                                 24-Jun-2024 06:05                3237
evprepare.construct.php                            24-Jun-2024 06:05                3609
evprepare.createstopped.php                        24-Jun-2024 06:05                4347
evsignal.construct.php                             24-Jun-2024 06:05                5543
evsignal.createstopped.php                         24-Jun-2024 06:05                4872
evsignal.set.php                                   24-Jun-2024 06:05                2537
evstat.attr.php                                    24-Jun-2024 06:05                8269
evstat.construct.php                               24-Jun-2024 06:05                7262
evstat.createstopped.php                           24-Jun-2024 06:05                5248
evstat.prev.php                                    24-Jun-2024 06:05                2969
evstat.set.php                                     24-Jun-2024 06:05                2896
evstat.stat.php                                    24-Jun-2024 06:05                3026
evtimer.again.php                                  24-Jun-2024 06:05                3098
evtimer.construct.php                              24-Jun-2024 06:05               12700
evtimer.createstopped.php                          24-Jun-2024 06:05                8400
evtimer.set.php                                    24-Jun-2024 06:05                3053
evwatcher.clear.php                                24-Jun-2024 06:05                2861
evwatcher.construct.php                            24-Jun-2024 06:05                2141
evwatcher.feed.php                                 24-Jun-2024 06:05                2650
evwatcher.getloop.php                              24-Jun-2024 06:05                2347
evwatcher.invoke.php                               24-Jun-2024 06:05                2657
evwatcher.keepalive.php                            24-Jun-2024 06:05                5381
evwatcher.setcallback.php                          24-Jun-2024 06:05                2612
evwatcher.start.php                                24-Jun-2024 06:05                2545
evwatcher.stop.php                                 24-Jun-2024 06:05                2514
example.xml-external-entity.php                    24-Jun-2024 06:06               21594
example.xml-map-tags.php                           24-Jun-2024 06:06                8281
example.xml-structure.php                          24-Jun-2024 06:06                6306
example.xmlwriter-namespace.php                    24-Jun-2024 06:06                5410
example.xmlwriter-oop.php                          24-Jun-2024 06:06                3418
example.xmlwriter-simple.php                       24-Jun-2024 06:06                8665
exception.clone.php                                24-Jun-2024 06:05                3100
exception.construct.php                            24-Jun-2024 06:05                3824
exception.getcode.php                              24-Jun-2024 06:05                4693
exception.getfile.php                              24-Jun-2024 06:05                3906
exception.getline.php                              24-Jun-2024 06:05                4128
exception.getmessage.php                           24-Jun-2024 06:05                3993
exception.getprevious.php                          24-Jun-2024 06:05                6855
exception.gettrace.php                             24-Jun-2024 06:05                4463
exception.gettraceasstring.php                     24-Jun-2024 06:05                4257
exception.tostring.php                             24-Jun-2024 06:05                4203
exec.configuration.php                             24-Jun-2024 06:05                1352
exec.constants.php                                 24-Jun-2024 06:05                1282
exec.requirements.php                              24-Jun-2024 06:05                1333
exec.resources.php                                 24-Jun-2024 06:05                1432
exec.setup.php                                     24-Jun-2024 06:05                1650
exif.configuration.php                             24-Jun-2024 06:05                7693
exif.constants.php                                 24-Jun-2024 06:05                2166
exif.installation.php                              24-Jun-2024 06:05                1761
exif.requirements.php                              24-Jun-2024 06:05                1904
exif.resources.php                                 24-Jun-2024 06:05                1296
exif.setup.php                                     24-Jun-2024 06:05                1707
expect.configuration.php                           24-Jun-2024 06:05                5531
expect.constants.php                               24-Jun-2024 06:05                3942
expect.examples-usage.php                          24-Jun-2024 06:05               12256
expect.examples.php                                24-Jun-2024 06:05                1431
expect.installation.php                            24-Jun-2024 06:05                2474
expect.requirements.php                            24-Jun-2024 06:05                1420
expect.resources.php                               24-Jun-2024 06:05                1505
expect.setup.php                                   24-Jun-2024 06:05                1730
extensions.alphabetical.php                        24-Jun-2024 06:06               21085
extensions.membership.php                          24-Jun-2024 06:06               20758
extensions.php                                     24-Jun-2024 06:06                1767
extensions.state.php                               24-Jun-2024 06:06                2789
fann.configuration.php                             24-Jun-2024 06:05                1355
fann.constants.php                                 24-Jun-2024 06:05               23666
fann.examples-1.php                                24-Jun-2024 06:05                8578
fann.examples.php                                  24-Jun-2024 06:05                1385
fann.installation.php                              24-Jun-2024 06:05                4998
fann.requirements.php                              24-Jun-2024 06:05                1275
fann.resources.php                                 24-Jun-2024 06:05                1242
fann.setup.php                                     24-Jun-2024 06:05                1677
fannconnection.construct.php                       24-Jun-2024 06:05                3035
fannconnection.getfromneuron.php                   24-Jun-2024 06:05                2400
fannconnection.gettoneuron.php                     24-Jun-2024 06:05                2388
fannconnection.getweight.php                       24-Jun-2024 06:05                2323
fannconnection.setweight.php                       24-Jun-2024 06:05                2969
faq.build.php                                      24-Jun-2024 06:06               24206
faq.com.php                                        24-Jun-2024 06:06               12035
faq.databases.php                                  24-Jun-2024 06:06                7961
faq.general.php                                    24-Jun-2024 06:06                4885
faq.html.php                                       24-Jun-2024 06:06               20247
faq.installation.php                               24-Jun-2024 06:06               26203
faq.mailinglist.php                                24-Jun-2024 06:06               10818
faq.misc.php                                       24-Jun-2024 06:06                4625
faq.obtaining.php                                  24-Jun-2024 06:06               10871
faq.passwords.php                                  24-Jun-2024 06:06                9915
faq.php                                            24-Jun-2024 06:06                2127
faq.using.php                                      24-Jun-2024 06:06               23044
fdf.configuration.php                              24-Jun-2024 06:05                1348
fdf.constants.php                                  24-Jun-2024 06:05                9279
fdf.examples.php                                   24-Jun-2024 06:05                6068
fdf.installation.php                               24-Jun-2024 06:05                3518
fdf.requirements.php                               24-Jun-2024 06:05                1612
fdf.resources.php                                  24-Jun-2024 06:05                1802
fdf.setup.php                                      24-Jun-2024 06:05                1685
features.commandline.differences.php               24-Jun-2024 06:05               12691
features.commandline.ini.php                       24-Jun-2024 06:05                2356
features.commandline.interactive.php               24-Jun-2024 06:05                9081
features.commandline.io-streams.php                24-Jun-2024 06:05                6034
features.commandline.options.php                   24-Jun-2024 06:05               26568
features.commandline.php                           24-Jun-2024 06:05                7704
features.commandline.usage.php                     24-Jun-2024 06:05               14340
features.commandline.webserver.php                 24-Jun-2024 06:05               13460
features.connection-handling.php                   24-Jun-2024 06:05                5703
features.cookies.php                               24-Jun-2024 06:05                3121
features.dtrace.dtrace.php                         24-Jun-2024 06:05               14610
features.dtrace.introduction.php                   24-Jun-2024 06:05                3585
features.dtrace.php                                24-Jun-2024 06:05                1767
features.dtrace.systemtap.php                      24-Jun-2024 06:05                8258
features.file-upload.common-pitfalls.php           24-Jun-2024 06:05                5525
features.file-upload.errors.php                    24-Jun-2024 06:05                3784
features.file-upload.errors.seealso.php            24-Jun-2024 06:05                1402
features.file-upload.multiple.php                  24-Jun-2024 06:05                6716
features.file-upload.php                           24-Jun-2024 06:05                1997
features.file-upload.post-method.php               24-Jun-2024 06:05               16255
features.file-upload.put-method.php                24-Jun-2024 06:05                5882
features.gc.collecting-cycles.php                  24-Jun-2024 06:05                8403
features.gc.performance-considerations.php         24-Jun-2024 06:05               14304
features.gc.php                                    24-Jun-2024 06:05                1880
features.gc.refcounting-basics.php                 24-Jun-2024 06:05               21946
features.http-auth.php                             24-Jun-2024 06:05               23336
features.persistent-connections.php                24-Jun-2024 06:05                8900
features.php                                       24-Jun-2024 06:05                4263
features.remote-files.php                          24-Jun-2024 06:05                8102
features.session.security.management.php           24-Jun-2024 06:06               26089
features.sessions.php                              24-Jun-2024 06:05                1462
features.xforms.php                                24-Jun-2024 06:05                5476
ffi-ctype.getalignment.php                         24-Jun-2024 06:05                2375
ffi-ctype.getarrayelementtype.php                  24-Jun-2024 06:05                2461
ffi-ctype.getarraylength.php                       24-Jun-2024 06:05                2418
ffi-ctype.getattributes.php                        24-Jun-2024 06:05                2394
ffi-ctype.getenumkind.php                          24-Jun-2024 06:05                2370
ffi-ctype.getfuncabi.php                           24-Jun-2024 06:05                2378
ffi-ctype.getfuncparametercount.php                24-Jun-2024 06:05                2484
ffi-ctype.getfuncparametertype.php                 24-Jun-2024 06:05                2723
ffi-ctype.getfuncreturntype.php                    24-Jun-2024 06:05                2443
ffi-ctype.getkind.php                              24-Jun-2024 06:05                2332
ffi-ctype.getname.php                              24-Jun-2024 06:05                2338
ffi-ctype.getpointertype.php                       24-Jun-2024 06:05                2387
ffi-ctype.getsize.php                              24-Jun-2024 06:05                2350
ffi-ctype.getstructfieldnames.php                  24-Jun-2024 06:05                2460
ffi-ctype.getstructfieldoffset.php                 24-Jun-2024 06:05                2719
ffi-ctype.getstructfieldtype.php                   24-Jun-2024 06:05                2681
ffi.addr.php                                       24-Jun-2024 06:05                2809
ffi.alignof.php                                    24-Jun-2024 06:05                2939
ffi.arraytype.php                                  24-Jun-2024 06:05                4639
ffi.cast.php                                       24-Jun-2024 06:05                4861
ffi.cdef.php                                       24-Jun-2024 06:05                4479
ffi.configuration.php                              24-Jun-2024 06:05                4448
ffi.constants.php                                  24-Jun-2024 06:05                1192
ffi.examples-basic.php                             24-Jun-2024 06:05               15841
ffi.examples-callback.php                          24-Jun-2024 06:05                4942
ffi.examples-complete.php                          24-Jun-2024 06:05                5356
ffi.examples.php                                   24-Jun-2024 06:05                1542
ffi.free.php                                       24-Jun-2024 06:05                2451
ffi.installation.php                               24-Jun-2024 06:05                1541
ffi.isnull.php                                     24-Jun-2024 06:05                2552
ffi.load.php                                       24-Jun-2024 06:05                4322
ffi.memcmp.php                                     24-Jun-2024 06:05                4117
ffi.memcpy.php                                     24-Jun-2024 06:05                3303
ffi.memset.php                                     24-Jun-2024 06:05                3143
ffi.new.php                                        24-Jun-2024 06:05                5193
ffi.requirements.php                               24-Jun-2024 06:05                1371
ffi.resources.php                                  24-Jun-2024 06:05                1286
ffi.scope.php                                      24-Jun-2024 06:05                3161
ffi.setup.php                                      24-Jun-2024 06:05                1675
ffi.sizeof.php                                     24-Jun-2024 06:05                2780
ffi.string.php                                     24-Jun-2024 06:05                4230
ffi.type.php                                       24-Jun-2024 06:05                3607
ffi.typeof.php                                     24-Jun-2024 06:05                2873
fiber.construct.php                                24-Jun-2024 06:05                2392
fiber.getcurrent.php                               24-Jun-2024 06:05                2570
fiber.getreturn.php                                24-Jun-2024 06:05                2595
fiber.isrunning.php                                24-Jun-2024 06:05                2796
fiber.isstarted.php                                24-Jun-2024 06:05                2368
fiber.issuspended.php                              24-Jun-2024 06:05                2394
fiber.isterminated.php                             24-Jun-2024 06:05                2448
fiber.resume.php                                   24-Jun-2024 06:05                3414
fiber.start.php                                    24-Jun-2024 06:05                3089
fiber.suspend.php                                  24-Jun-2024 06:05                4073
fiber.throw.php                                    24-Jun-2024 06:05                3262
fibererror.construct.php                           24-Jun-2024 06:05                2223
fileinfo.configuration.php                         24-Jun-2024 06:05                1386
fileinfo.constants.php                             24-Jun-2024 06:05                6613
fileinfo.installation.php                          24-Jun-2024 06:05                1846
fileinfo.requirements.php                          24-Jun-2024 06:05                1331
fileinfo.resources.php                             24-Jun-2024 06:05                1494
fileinfo.setup.php                                 24-Jun-2024 06:05                1753
filesystem.configuration.php                       24-Jun-2024 06:05                7750
filesystem.constants.php                           24-Jun-2024 06:05               13747
filesystem.requirements.php                        24-Jun-2024 06:05                1375
filesystem.resources.php                           24-Jun-2024 06:05                1510
filesystem.setup.php                               24-Jun-2024 06:05                1735
filesystemiterator.construct.php                   24-Jun-2024 06:05                7736
filesystemiterator.current.php                     24-Jun-2024 06:05                5454
filesystemiterator.getflags.php                    24-Jun-2024 06:05                3325
filesystemiterator.key.php                         24-Jun-2024 06:05                5157
filesystemiterator.next.php                        24-Jun-2024 06:05                4574
filesystemiterator.rewind.php                      24-Jun-2024 06:05                5175
filesystemiterator.setflags.php                    24-Jun-2024 06:05                6788
filter.configuration.php                           24-Jun-2024 06:06                5249
filter.constants.php                               24-Jun-2024 06:06               25278
filter.examples.php                                24-Jun-2024 06:06                1492
filter.examples.sanitization.php                   24-Jun-2024 06:06                5622
filter.examples.validation.php                     24-Jun-2024 06:06               10174
filter.filters.flags.php                           24-Jun-2024 06:06               17071
filter.filters.misc.php                            24-Jun-2024 06:06                1994
filter.filters.php                                 24-Jun-2024 06:06                1688
filter.filters.sanitize.php                        24-Jun-2024 06:06               13882
filter.filters.validate.php                        24-Jun-2024 06:06               14167
filter.installation.php                            24-Jun-2024 06:06                1445
filter.requirements.php                            24-Jun-2024 06:06                1317
filter.resources.php                               24-Jun-2024 06:06                1293
filter.setup.php                                   24-Jun-2024 06:06                1717
filteriterator.accept.php                          24-Jun-2024 06:05                5327
filteriterator.construct.php                       24-Jun-2024 06:05                3110
filteriterator.current.php                         24-Jun-2024 06:05                3013
filteriterator.key.php                             24-Jun-2024 06:05                2949
filteriterator.next.php                            24-Jun-2024 06:05                2955
filteriterator.rewind.php                          24-Jun-2024 06:05                3148
filteriterator.valid.php                           24-Jun-2024 06:05                2851
filters.compression.php                            24-Jun-2024 06:06               15656
filters.convert.php                                24-Jun-2024 06:06               11671
filters.encryption.php                             24-Jun-2024 06:06               41104
filters.php                                        24-Jun-2024 06:06                3433
filters.string.php                                 24-Jun-2024 06:06               10191
finfo.buffer.php                                   24-Jun-2024 06:05                2919
finfo.construct.php                                24-Jun-2024 06:05                3121
finfo.file.php                                     24-Jun-2024 06:05                2910
finfo.set-flags.php                                24-Jun-2024 06:05                2161
fpm.observability.php                              24-Jun-2024 06:06                1442
fpm.setup.php                                      24-Jun-2024 06:06                1364
fpm.status.php                                     24-Jun-2024 06:06               10147
ftp.configuration.php                              24-Jun-2024 06:05                1351
ftp.constants.php                                  24-Jun-2024 06:05                5463
ftp.examples-basic.php                             24-Jun-2024 06:05                4870
ftp.examples.php                                   24-Jun-2024 06:05                1396
ftp.installation.php                               24-Jun-2024 06:05                1571
ftp.requirements.php                               24-Jun-2024 06:05                1296
ftp.resources.php                                  24-Jun-2024 06:05                1573
ftp.setup.php                                      24-Jun-2024 06:05                1688
funchand.configuration.php                         24-Jun-2024 06:06                1380
funchand.constants.php                             24-Jun-2024 06:06                1316
funchand.requirements.php                          24-Jun-2024 06:06                1361
funchand.resources.php                             24-Jun-2024 06:06                1324
funchand.setup.php                                 24-Jun-2024 06:06                1686
funcref.php                                        24-Jun-2024 06:06               15161
function.abs.php                                   24-Jun-2024 06:05                5702
function.acos.php                                  24-Jun-2024 06:05                3552
function.acosh.php                                 24-Jun-2024 06:05                3319
function.addcslashes.php                           24-Jun-2024 06:06                8142
function.addslashes.php                            24-Jun-2024 06:06                6339
function.apache-child-terminate.php                24-Jun-2024 06:06                3457
function.apache-get-modules.php                    24-Jun-2024 06:06                3494
function.apache-get-version.php                    24-Jun-2024 06:06                3991
function.apache-getenv.php                         24-Jun-2024 06:06                5318
function.apache-lookup-uri.php                     24-Jun-2024 06:06                5995
function.apache-note.php                           24-Jun-2024 06:06                7404
function.apache-request-headers.php                24-Jun-2024 06:06                5865
function.apache-response-headers.php               24-Jun-2024 06:06                4524
function.apache-setenv.php                         24-Jun-2024 06:06                5850
function.apcu-add.php                              24-Jun-2024 06:05                8713
function.apcu-cache-info.php                       24-Jun-2024 06:05                6884
function.apcu-cas.php                              24-Jun-2024 06:05                8872
function.apcu-clear-cache.php                      24-Jun-2024 06:05                2677
function.apcu-dec.php                              24-Jun-2024 06:05                8355
function.apcu-delete.php                           24-Jun-2024 06:05                6224
function.apcu-enabled.php                          24-Jun-2024 06:05                2447
function.apcu-entry.php                            24-Jun-2024 06:05                8663
function.apcu-exists.php                           24-Jun-2024 06:05                7066
function.apcu-fetch.php                            24-Jun-2024 06:05                5913
function.apcu-inc.php                              24-Jun-2024 06:05                8349
function.apcu-key-info.php                         24-Jun-2024 06:05                5053
function.apcu-sma-info.php                         24-Jun-2024 06:05                4750
function.apcu-store.php                            24-Jun-2024 06:05                7546
function.array-change-key-case.php                 24-Jun-2024 06:06                5484
function.array-chunk.php                           24-Jun-2024 06:06                7803
function.array-column.php                          24-Jun-2024 06:06               17143
function.array-combine.php                         24-Jun-2024 06:06                7670
function.array-count-values.php                    24-Jun-2024 06:06                5969
function.array-diff-assoc.php                      24-Jun-2024 06:06               11548
function.array-diff-key.php                        24-Jun-2024 06:06               13294
function.array-diff-uassoc.php                     24-Jun-2024 06:06               12412
function.array-diff-ukey.php                       24-Jun-2024 06:06               12712
function.array-diff.php                            24-Jun-2024 06:06               12503
function.array-fill-keys.php                       24-Jun-2024 06:06                5413
function.array-fill.php                            24-Jun-2024 06:06                9204
function.array-filter.php                          24-Jun-2024 06:06               16895
function.array-flip.php                            24-Jun-2024 06:06                7357
function.array-intersect-assoc.php                 24-Jun-2024 06:06                9171
function.array-intersect-key.php                   24-Jun-2024 06:06               10575
function.array-intersect-uassoc.php                24-Jun-2024 06:06                9366
function.array-intersect-ukey.php                  24-Jun-2024 06:06               12411
function.array-intersect.php                       24-Jun-2024 06:06                7144
function.array-is-list.php                         24-Jun-2024 06:06                7205
function.array-key-exists.php                      24-Jun-2024 06:06               10174
function.array-key-first.php                       24-Jun-2024 06:06                7240
function.array-key-last.php                        24-Jun-2024 06:06                3452
function.array-keys.php                            24-Jun-2024 06:06                8539
function.array-map.php                             24-Jun-2024 06:06               27826
function.array-merge-recursive.php                 24-Jun-2024 06:06                7074
function.array-merge.php                           24-Jun-2024 06:06               12617
function.array-multisort.php                       24-Jun-2024 06:06               24000
function.array-pad.php                             24-Jun-2024 06:06                7643
function.array-pop.php                             24-Jun-2024 06:06                5826
function.array-product.php                         24-Jun-2024 06:06                5854
function.array-push.php                            24-Jun-2024 06:06                7225
function.array-rand.php                            24-Jun-2024 06:06                9701
function.array-reduce.php                          24-Jun-2024 06:06               10119
function.array-replace-recursive.php               24-Jun-2024 06:06               11430
function.array-replace.php                         24-Jun-2024 06:06                6977
function.array-reverse.php                         24-Jun-2024 06:06                6250
function.array-search.php                          24-Jun-2024 06:06                8623
function.array-shift.php                           24-Jun-2024 06:06                5905
function.array-slice.php                           24-Jun-2024 06:06               14029
function.array-splice.php                          24-Jun-2024 06:06               17996
function.array-sum.php                             24-Jun-2024 06:06                6518
function.array-udiff-assoc.php                     24-Jun-2024 06:06               18408
function.array-udiff-uassoc.php                    24-Jun-2024 06:06               19805
function.array-udiff.php                           24-Jun-2024 06:06               30789
function.array-uintersect-assoc.php                24-Jun-2024 06:06               12178
function.array-uintersect-uassoc.php               24-Jun-2024 06:06               12519
function.array-uintersect.php                      24-Jun-2024 06:06               11719
function.array-unique.php                          24-Jun-2024 06:06                9892
function.array-unshift.php                         24-Jun-2024 06:06               11192
function.array-values.php                          24-Jun-2024 06:06                4629
function.array-walk-recursive.php                  24-Jun-2024 06:06                7800
function.array-walk.php                            24-Jun-2024 06:06               14040
function.array.php                                 24-Jun-2024 06:06               11755
function.arsort.php                                24-Jun-2024 06:06                9590
function.asin.php                                  24-Jun-2024 06:05                3553
function.asinh.php                                 24-Jun-2024 06:05                3310
function.asort.php                                 24-Jun-2024 06:06                9581
function.assert-options.php                        24-Jun-2024 06:05               14186
function.assert.php                                24-Jun-2024 06:05               22873
function.atan.php                                  24-Jun-2024 06:05                3561
function.atan2.php                                 24-Jun-2024 06:05                3501
function.atanh.php                                 24-Jun-2024 06:05                3344
function.autoload.php                              24-Jun-2024 06:06                3285
function.base-convert.php                          24-Jun-2024 06:05                6841
function.base64-decode.php                         24-Jun-2024 06:05                5284
function.base64-encode.php                         24-Jun-2024 06:05                4784
function.basename.php                              24-Jun-2024 06:05                7733
function.bcadd.php                                 24-Jun-2024 06:05                5951
function.bccomp.php                                24-Jun-2024 06:05                5830
function.bcdiv.php                                 24-Jun-2024 06:05                5538
function.bcmod.php                                 24-Jun-2024 06:05                7614
function.bcmul.php                                 24-Jun-2024 06:05                7350
function.bcpow.php                                 24-Jun-2024 06:05                7372
function.bcpowmod.php                              24-Jun-2024 06:05                7579
function.bcscale.php                               24-Jun-2024 06:05                5628
function.bcsqrt.php                                24-Jun-2024 06:05                6372
function.bcsub.php                                 24-Jun-2024 06:05                5944
function.bin2hex.php                               24-Jun-2024 06:06                4598
function.bind-textdomain-codeset.php               24-Jun-2024 06:05                4727
function.bindec.php                                24-Jun-2024 06:05               15069
function.bindtextdomain.php                        24-Jun-2024 06:05                5649
function.boolval.php                               24-Jun-2024 06:06               10448
function.bzclose.php                               24-Jun-2024 06:05                3180
function.bzcompress.php                            24-Jun-2024 06:05                5265
function.bzdecompress.php                          24-Jun-2024 06:05                6750
function.bzerrno.php                               24-Jun-2024 06:05                3222
function.bzerror.php                               24-Jun-2024 06:05                4436
function.bzerrstr.php                              24-Jun-2024 06:05                3237
function.bzflush.php                               24-Jun-2024 06:05                3502
function.bzopen.php                                24-Jun-2024 06:05                5332
function.bzread.php                                24-Jun-2024 06:05                6694
function.bzwrite.php                               24-Jun-2024 06:05                6502
function.cal-days-in-month.php                     24-Jun-2024 06:05                4731
function.cal-from-jd.php                           24-Jun-2024 06:05                7400
function.cal-info.php                              24-Jun-2024 06:05                6267
function.cal-to-jd.php                             24-Jun-2024 06:05                6337
function.call-user-func-array.php                  24-Jun-2024 06:06               17695
function.call-user-func.php                        24-Jun-2024 06:06               14461
function.ceil.php                                  24-Jun-2024 06:05                5313
function.chdir.php                                 24-Jun-2024 06:05                5693
function.checkdate.php                             24-Jun-2024 06:05                5658
function.checkdnsrr.php                            24-Jun-2024 06:05                5224
function.chgrp.php                                 24-Jun-2024 06:05                6872
function.chmod.php                                 24-Jun-2024 06:05                9103
function.chop.php                                  24-Jun-2024 06:06                2078
function.chown.php                                 24-Jun-2024 06:05                6955
function.chr.php                                   24-Jun-2024 06:06                9129
function.chroot.php                                24-Jun-2024 06:05                4872
function.chunk-split.php                           24-Jun-2024 06:06                5374
function.class-alias.php                           24-Jun-2024 06:06                9235
function.class-exists.php                          24-Jun-2024 06:06                7246
function.class-implements.php                      24-Jun-2024 06:05                7447
function.class-parents.php                         24-Jun-2024 06:05                7130
function.class-uses.php                            24-Jun-2024 06:05                6412
function.clearstatcache.php                        24-Jun-2024 06:05               11161
function.cli-get-process-title.php                 24-Jun-2024 06:05                4553
function.cli-set-process-title.php                 24-Jun-2024 06:05                5618
function.closedir.php                              24-Jun-2024 06:05                4979
function.closelog.php                              24-Jun-2024 06:05                2913
function.com-create-guid.php                       24-Jun-2024 06:06                2919
function.com-event-sink.php                        24-Jun-2024 06:06               10480
function.com-get-active-object.php                 24-Jun-2024 06:06                5739
function.com-load-typelib.php                      24-Jun-2024 06:06                5263
function.com-message-pump.php                      24-Jun-2024 06:06                4114
function.com-print-typeinfo.php                    24-Jun-2024 06:06                5198
function.commonmark-parse.php                      24-Jun-2024 06:06                4258
function.commonmark-render-html.php                24-Jun-2024 06:06                4752
function.commonmark-render-latex.php               24-Jun-2024 06:06                5076
function.commonmark-render-man.php                 24-Jun-2024 06:06                5058
function.commonmark-render-xml.php                 24-Jun-2024 06:06                4709
function.commonmark-render.php                     24-Jun-2024 06:06                5004
function.compact.php                               24-Jun-2024 06:06                8430
function.connection-aborted.php                    24-Jun-2024 06:05                3144
function.connection-status.php                     24-Jun-2024 06:05                3317
function.constant.php                              24-Jun-2024 06:05                9334
function.convert-cyr-string.php                    24-Jun-2024 06:06                5218
function.convert-uudecode.php                      24-Jun-2024 06:06                4609
function.convert-uuencode.php                      24-Jun-2024 06:06                5504
function.copy.php                                  24-Jun-2024 06:05                6217
function.cos.php                                   24-Jun-2024 06:05                4033
function.cosh.php                                  24-Jun-2024 06:05                3266
function.count-chars.php                           24-Jun-2024 06:06                7448
function.count.php                                 24-Jun-2024 06:06               16663
function.crc32.php                                 24-Jun-2024 06:06                7331
function.create-function.php                       24-Jun-2024 06:06               31498
function.crypt.php                                 24-Jun-2024 06:06               13465
function.ctype-alnum.php                           24-Jun-2024 06:06                7049
function.ctype-alpha.php                           24-Jun-2024 06:06                7355
function.ctype-cntrl.php                           24-Jun-2024 06:06                7020
function.ctype-digit.php                           24-Jun-2024 06:06                9317
function.ctype-graph.php                           24-Jun-2024 06:06                7723
function.ctype-lower.php                           24-Jun-2024 06:06                7080
function.ctype-print.php                           24-Jun-2024 06:06                7799
function.ctype-punct.php                           24-Jun-2024 06:06                7085
function.ctype-space.php                           24-Jun-2024 06:06                7864
function.ctype-upper.php                           24-Jun-2024 06:06                7105
function.ctype-xdigit.php                          24-Jun-2024 06:06                6934
function.cubrid-affected-rows.php                  24-Jun-2024 06:05                9434
function.cubrid-bind.php                           24-Jun-2024 06:05               20765
function.cubrid-client-encoding.php                24-Jun-2024 06:05                5314
function.cubrid-close-prepare.php                  24-Jun-2024 06:05                6306
function.cubrid-close-request.php                  24-Jun-2024 06:05                6317
function.cubrid-close.php                          24-Jun-2024 06:05                6437
function.cubrid-col-get.php                        24-Jun-2024 06:05                8603
function.cubrid-col-size.php                       24-Jun-2024 06:05                8715
function.cubrid-column-names.php                   24-Jun-2024 06:05                8548
function.cubrid-column-types.php                   24-Jun-2024 06:05                8528
function.cubrid-commit.php                         24-Jun-2024 06:05               15372
function.cubrid-connect-with-url.php               24-Jun-2024 06:05               15153
function.cubrid-connect.php                        24-Jun-2024 06:05               12362
function.cubrid-current-oid.php                    24-Jun-2024 06:05                6029
function.cubrid-data-seek.php                      24-Jun-2024 06:05                7498
function.cubrid-db-name.php                        24-Jun-2024 06:05                6586
function.cubrid-disconnect.php                     24-Jun-2024 06:05                7181
function.cubrid-drop.php                           24-Jun-2024 06:05               11467
function.cubrid-errno.php                          24-Jun-2024 06:05                6843
function.cubrid-error-code-facility.php            24-Jun-2024 06:05                5867
function.cubrid-error-code.php                     24-Jun-2024 06:05                5777
function.cubrid-error-msg.php                      24-Jun-2024 06:05                5227
function.cubrid-error.php                          24-Jun-2024 06:05                6403
function.cubrid-execute.php                        24-Jun-2024 06:05               14420
function.cubrid-fetch-array.php                    24-Jun-2024 06:05                9844
function.cubrid-fetch-assoc.php                    24-Jun-2024 06:05                9078
function.cubrid-fetch-field.php                    24-Jun-2024 06:05               14110
function.cubrid-fetch-lengths.php                  24-Jun-2024 06:05                6160
function.cubrid-fetch-object.php                   24-Jun-2024 06:05               12023
function.cubrid-fetch-row.php                      24-Jun-2024 06:05                9002
function.cubrid-fetch.php                          24-Jun-2024 06:05                9988
function.cubrid-field-flags.php                    24-Jun-2024 06:05                7818
function.cubrid-field-len.php                      24-Jun-2024 06:05                8327
function.cubrid-field-name.php                     24-Jun-2024 06:05                7233
function.cubrid-field-seek.php                     24-Jun-2024 06:05               10985
function.cubrid-field-table.php                    24-Jun-2024 06:05                7438
function.cubrid-field-type.php                     24-Jun-2024 06:05                7500
function.cubrid-free-result.php                    24-Jun-2024 06:05                5980
function.cubrid-get-autocommit.php                 24-Jun-2024 06:05                3852
function.cubrid-get-charset.php                    24-Jun-2024 06:05                5041
function.cubrid-get-class-name.php                 24-Jun-2024 06:05                6371
function.cubrid-get-client-info.php                24-Jun-2024 06:05                8175
function.cubrid-get-db-parameter.php               24-Jun-2024 06:05               14332
function.cubrid-get-query-timeout.php              24-Jun-2024 06:05                6757
function.cubrid-get-server-info.php                24-Jun-2024 06:05                8466
function.cubrid-get.php                            24-Jun-2024 06:05                9898
function.cubrid-insert-id.php                      24-Jun-2024 06:05                7190
function.cubrid-is-instance.php                    24-Jun-2024 06:05                7222
function.cubrid-list-dbs.php                       24-Jun-2024 06:05                4580
function.cubrid-load-from-glo.php                  24-Jun-2024 06:05                6926
function.cubrid-lob-close.php                      24-Jun-2024 06:05                7300
function.cubrid-lob-export.php                     24-Jun-2024 06:05                7879
function.cubrid-lob-get.php                        24-Jun-2024 06:05                7676
function.cubrid-lob-send.php                       24-Jun-2024 06:05                7054
function.cubrid-lob-size.php                       24-Jun-2024 06:05                5883
function.cubrid-lob2-bind.php                      24-Jun-2024 06:05                9764
function.cubrid-lob2-close.php                     24-Jun-2024 06:05                3455
function.cubrid-lob2-export.php                    24-Jun-2024 06:05                8757
function.cubrid-lob2-import.php                    24-Jun-2024 06:05                8626
function.cubrid-lob2-new.php                       24-Jun-2024 06:05                3973
function.cubrid-lob2-read.php                      24-Jun-2024 06:05               13736
function.cubrid-lob2-seek.php                      24-Jun-2024 06:05               11288
function.cubrid-lob2-seek64.php                    24-Jun-2024 06:05               12708
function.cubrid-lob2-size.php                      24-Jun-2024 06:05                4354
function.cubrid-lob2-size64.php                    24-Jun-2024 06:05                4534
function.cubrid-lob2-tell.php                      24-Jun-2024 06:05                4373
function.cubrid-lob2-tell64.php                    24-Jun-2024 06:05                4571
function.cubrid-lob2-write.php                     24-Jun-2024 06:05               14050
function.cubrid-lock-read.php                      24-Jun-2024 06:05                9188
function.cubrid-lock-write.php                     24-Jun-2024 06:05                9576
function.cubrid-move-cursor.php                    24-Jun-2024 06:05                9560
function.cubrid-new-glo.php                        24-Jun-2024 06:05                6977
function.cubrid-next-result.php                    24-Jun-2024 06:05               16347
function.cubrid-num-cols.php                       24-Jun-2024 06:05                6019
function.cubrid-num-fields.php                     24-Jun-2024 06:05                5727
function.cubrid-num-rows.php                       24-Jun-2024 06:05                7203
function.cubrid-pconnect-with-url.php              24-Jun-2024 06:05               14480
function.cubrid-pconnect.php                       24-Jun-2024 06:05               12143
function.cubrid-ping.php                           24-Jun-2024 06:05                6119
function.cubrid-prepare.php                        24-Jun-2024 06:05               10298
function.cubrid-put.php                            24-Jun-2024 06:05               11409
function.cubrid-query.php                          24-Jun-2024 06:05               14757
function.cubrid-real-escape-string.php             24-Jun-2024 06:05                8248
function.cubrid-result.php                         24-Jun-2024 06:05                7458
function.cubrid-rollback.php                       24-Jun-2024 06:05               14667
function.cubrid-save-to-glo.php                    24-Jun-2024 06:05                6839
function.cubrid-schema.php                         24-Jun-2024 06:05               20506
function.cubrid-send-glo.php                       24-Jun-2024 06:05                6306
function.cubrid-seq-drop.php                       24-Jun-2024 06:05                9837
function.cubrid-seq-insert.php                     24-Jun-2024 06:05               10343
function.cubrid-seq-put.php                        24-Jun-2024 06:05               10270
function.cubrid-set-add.php                        24-Jun-2024 06:05                9609
function.cubrid-set-autocommit.php                 24-Jun-2024 06:05                4218
function.cubrid-set-db-parameter.php               24-Jun-2024 06:05                8224
function.cubrid-set-drop.php                       24-Jun-2024 06:05                9586
function.cubrid-set-query-timeout.php              24-Jun-2024 06:05                3606
function.cubrid-unbuffered-query.php               24-Jun-2024 06:05                7047
function.cubrid-version.php                        24-Jun-2024 06:05                8729
function.curl-close.php                            24-Jun-2024 06:05                6087
function.curl-copy-handle.php                      24-Jun-2024 06:05                6455
function.curl-errno.php                            24-Jun-2024 06:05                6117
function.curl-error.php                            24-Jun-2024 06:05                6022
function.curl-escape.php                           24-Jun-2024 06:05                7589
function.curl-exec.php                             24-Jun-2024 06:05                7434
function.curl-getinfo.php                          24-Jun-2024 06:05               41948
function.curl-init.php                             24-Jun-2024 06:05                7276
function.curl-multi-add-handle.php                 24-Jun-2024 06:05               10386
function.curl-multi-close.php                      24-Jun-2024 06:05                9626
function.curl-multi-errno.php                      24-Jun-2024 06:05                3995
function.curl-multi-exec.php                       24-Jun-2024 06:05               10452
function.curl-multi-getcontent.php                 24-Jun-2024 06:05                4490
function.curl-multi-info-read.php                  24-Jun-2024 06:05               12317
function.curl-multi-init.php                       24-Jun-2024 06:05                8805
function.curl-multi-remove-handle.php              24-Jun-2024 06:05                5596
function.curl-multi-select.php                     24-Jun-2024 06:05                4450
function.curl-multi-setopt.php                     24-Jun-2024 06:05               13382
function.curl-multi-strerror.php                   24-Jun-2024 06:05                7214
function.curl-pause.php                            24-Jun-2024 06:05                3966
function.curl-reset.php                            24-Jun-2024 06:05                6531
function.curl-setopt-array.php                     24-Jun-2024 06:05                7797
function.curl-setopt.php                           24-Jun-2024 06:05              173524
function.curl-share-close.php                      24-Jun-2024 06:05                8203
function.curl-share-errno.php                      24-Jun-2024 06:05                4021
function.curl-share-init.php                       24-Jun-2024 06:05                7828
function.curl-share-setopt.php                     24-Jun-2024 06:05               10507
function.curl-share-strerror.php                   24-Jun-2024 06:05                3540
function.curl-strerror.php                         24-Jun-2024 06:05                6348
function.curl-unescape.php                         24-Jun-2024 06:05                8017
function.curl-version.php                          24-Jun-2024 06:05                6953
function.curl_upkeep.php                           24-Jun-2024 06:05                7033
function.current.php                               24-Jun-2024 06:06               11452
function.date-add.php                              24-Jun-2024 06:05                1776
function.date-create-from-format.php               24-Jun-2024 06:05                1951
function.date-create-immutable-from-format.php     24-Jun-2024 06:05                2063
function.date-create-immutable.php                 24-Jun-2024 06:05                4320
function.date-create.php                           24-Jun-2024 06:05                4481
function.date-date-set.php                         24-Jun-2024 06:05                1835
function.date-default-timezone-get.php             24-Jun-2024 06:05                7115
function.date-default-timezone-set.php             24-Jun-2024 06:05                5830
function.date-diff.php                             24-Jun-2024 06:05                1795
function.date-format.php                           24-Jun-2024 06:05                1803
function.date-get-last-errors.php                  24-Jun-2024 06:05                1968
function.date-interval-create-from-date-string.php 24-Jun-2024 06:05                2079
function.date-interval-format.php                  24-Jun-2024 06:05                1930
function.date-isodate-set.php                      24-Jun-2024 06:05                1858
function.date-modify.php                           24-Jun-2024 06:05                1807
function.date-offset-get.php                       24-Jun-2024 06:05                1851
function.date-parse-from-format.php                24-Jun-2024 06:05               14027
function.date-parse.php                            24-Jun-2024 06:05               19842
function.date-sub.php                              24-Jun-2024 06:05                2381
function.date-sun-info.php                         24-Jun-2024 06:05               15869
function.date-sunrise.php                          24-Jun-2024 06:05               14456
function.date-sunset.php                           24-Jun-2024 06:05               14467
function.date-time-set.php                         24-Jun-2024 06:05                1821
function.date-timestamp-get.php                    24-Jun-2024 06:05                1880
function.date-timestamp-set.php                    24-Jun-2024 06:05                1888
function.date-timezone-get.php                     24-Jun-2024 06:05                1877
function.date-timezone-set.php                     24-Jun-2024 06:05                1849
function.date.php                                  24-Jun-2024 06:05               21873
function.db2-autocommit.php                        24-Jun-2024 06:05               11115
function.db2-bind-param.php                        24-Jun-2024 06:05               22874
function.db2-client-info.php                       24-Jun-2024 06:05               11667
function.db2-close.php                             24-Jun-2024 06:05                5687
function.db2-column-privileges.php                 24-Jun-2024 06:05                9188
function.db2-columns.php                           24-Jun-2024 06:05               11237
function.db2-commit.php                            24-Jun-2024 06:05                3762
function.db2-conn-error.php                        24-Jun-2024 06:05                6968
function.db2-conn-errormsg.php                     24-Jun-2024 06:05                6760
function.db2-connect.php                           24-Jun-2024 06:05               39956
function.db2-cursor-type.php                       24-Jun-2024 06:05                3358
function.db2-escape-string.php                     24-Jun-2024 06:05                7605
function.db2-exec.php                              24-Jun-2024 06:05               26291
function.db2-execute.php                           24-Jun-2024 06:05               25659
function.db2-fetch-array.php                       24-Jun-2024 06:05               11311
function.db2-fetch-assoc.php                       24-Jun-2024 06:05               11327
function.db2-fetch-both.php                        24-Jun-2024 06:05               11860
function.db2-fetch-object.php                      24-Jun-2024 06:05                9043
function.db2-fetch-row.php                         24-Jun-2024 06:05               16324
function.db2-field-display-size.php                24-Jun-2024 06:05                5152
function.db2-field-name.php                        24-Jun-2024 06:05                5040
function.db2-field-num.php                         24-Jun-2024 06:05                5048
function.db2-field-precision.php                   24-Jun-2024 06:05                5080
function.db2-field-scale.php                       24-Jun-2024 06:05                5042
function.db2-field-type.php                        24-Jun-2024 06:05                5045
function.db2-field-width.php                       24-Jun-2024 06:05                5250
function.db2-foreign-keys.php                      24-Jun-2024 06:05                9093
function.db2-free-result.php                       24-Jun-2024 06:05                3420
function.db2-free-stmt.php                         24-Jun-2024 06:05                3408
function.db2-get-option.php                        24-Jun-2024 06:05               24110
function.db2-last-insert-id.php                    24-Jun-2024 06:05                8200
function.db2-lob-read.php                          24-Jun-2024 06:05               16412
function.db2-next-result.php                       24-Jun-2024 06:05                8854
function.db2-num-fields.php                        24-Jun-2024 06:05                7199
function.db2-num-rows.php                          24-Jun-2024 06:05                4769
function.db2-pclose.php                            24-Jun-2024 06:05                5892
function.db2-pconnect.php                          24-Jun-2024 06:05               34850
function.db2-prepare.php                           24-Jun-2024 06:05               10608
function.db2-primary-keys.php                      24-Jun-2024 06:05                7727
function.db2-procedure-columns.php                 24-Jun-2024 06:05               12195
function.db2-procedures.php                        24-Jun-2024 06:05                8056
function.db2-result.php                            24-Jun-2024 06:05                8002
function.db2-rollback.php                          24-Jun-2024 06:05                9339
function.db2-server-info.php                       24-Jun-2024 06:05               22513
function.db2-set-option.php                        24-Jun-2024 06:05               67317
function.db2-special-columns.php                   24-Jun-2024 06:05               10308
function.db2-statistics.php                        24-Jun-2024 06:05               12579
function.db2-stmt-error.php                        24-Jun-2024 06:05                4657
function.db2-stmt-errormsg.php                     24-Jun-2024 06:05                4288
function.db2-table-privileges.php                  24-Jun-2024 06:05                8617
function.db2-tables.php                            24-Jun-2024 06:05                8947
function.dba-close.php                             24-Jun-2024 06:05                3236
function.dba-delete.php                            24-Jun-2024 06:05                4166
function.dba-exists.php                            24-Jun-2024 06:05                4197
function.dba-fetch.php                             24-Jun-2024 06:05                7153
function.dba-firstkey.php                          24-Jun-2024 06:05                3682
function.dba-handlers.php                          24-Jun-2024 06:05                5552
function.dba-insert.php                            24-Jun-2024 06:05                4804
function.dba-key-split.php                         24-Jun-2024 06:05                3986
function.dba-list.php                              24-Jun-2024 06:05                2269
function.dba-nextkey.php                           24-Jun-2024 06:05                3604
function.dba-open.php                              24-Jun-2024 06:05               13867
function.dba-optimize.php                          24-Jun-2024 06:05                3250
function.dba-popen.php                             24-Jun-2024 06:05                9197
function.dba-replace.php                           24-Jun-2024 06:05                4632
function.dba-sync.php                              24-Jun-2024 06:05                3270
function.dbase-add-record.php                      24-Jun-2024 06:05                7072
function.dbase-close.php                           24-Jun-2024 06:05                5361
function.dbase-create.php                          24-Jun-2024 06:05                8431
function.dbase-delete-record.php                   24-Jun-2024 06:05                5112
function.dbase-get-header-info.php                 24-Jun-2024 06:05                7193
function.dbase-get-record-with-names.php           24-Jun-2024 06:05                8944
function.dbase-get-record.php                      24-Jun-2024 06:05                5891
function.dbase-numfields.php                       24-Jun-2024 06:05                6093
function.dbase-numrecords.php                      24-Jun-2024 06:05                7026
function.dbase-open.php                            24-Jun-2024 06:05                6780
function.dbase-pack.php                            24-Jun-2024 06:05                6489
function.dbase-replace-record.php                  24-Jun-2024 06:05                9617
function.dcgettext.php                             24-Jun-2024 06:05                3564
function.dcngettext.php                            24-Jun-2024 06:05                4216
function.debug-backtrace.php                       24-Jun-2024 06:05               12175
function.debug-print-backtrace.php                 24-Jun-2024 06:05                6776
function.debug-zval-dump.php                       24-Jun-2024 06:06                9981
function.decbin.php                                24-Jun-2024 06:05                8865
function.dechex.php                                24-Jun-2024 06:05                7267
function.decoct.php                                24-Jun-2024 06:05                4910
function.define.php                                24-Jun-2024 06:05               12246
function.defined.php                               24-Jun-2024 06:05                8041
function.deflate-add.php                           24-Jun-2024 06:05                6106
function.deflate-init.php                          24-Jun-2024 06:05                8152
function.deg2rad.php                               24-Jun-2024 06:05                4078
function.delete.php                                24-Jun-2024 06:05                2504
function.dgettext.php                              24-Jun-2024 06:05                3310
function.die.php                                   24-Jun-2024 06:05                1626
function.dio-close.php                             24-Jun-2024 06:05                4113
function.dio-fcntl.php                             24-Jun-2024 06:05                9864
function.dio-open.php                              24-Jun-2024 06:05                8674
function.dio-read.php                              24-Jun-2024 06:05                3586
function.dio-seek.php                              24-Jun-2024 06:05                7611
function.dio-stat.php                              24-Jun-2024 06:05                4423
function.dio-tcsetattr.php                         24-Jun-2024 06:05                7024
function.dio-truncate.php                          24-Jun-2024 06:05                3853
function.dio-write.php                             24-Jun-2024 06:05                3945
function.dir.php                                   24-Jun-2024 06:05                7398
function.dirname.php                               24-Jun-2024 06:05                9656
function.disk-free-space.php                       24-Jun-2024 06:05                5636
function.disk-total-space.php                      24-Jun-2024 06:05                5184
function.diskfreespace.php                         24-Jun-2024 06:05                1834
function.dl.php                                    24-Jun-2024 06:05               10095
function.dngettext.php                             24-Jun-2024 06:05                3980
function.dns-check-record.php                      24-Jun-2024 06:05                1789
function.dns-get-mx.php                            24-Jun-2024 06:05                1761
function.dns-get-record.php                        24-Jun-2024 06:05               23734
function.dom-import-simplexml.php                  24-Jun-2024 06:06                7115
function.doubleval.php                             24-Jun-2024 06:06                1775
function.each.php                                  24-Jun-2024 06:06               11533
function.easter-date.php                           24-Jun-2024 06:05               14385
function.easter-days.php                           24-Jun-2024 06:05                7491
function.echo.php                                  24-Jun-2024 06:06               17696
function.eio-busy.php                              24-Jun-2024 06:05                4997
function.eio-cancel.php                            24-Jun-2024 06:05                7627
function.eio-chmod.php                             24-Jun-2024 06:05                6288
function.eio-chown.php                             24-Jun-2024 06:05                6490
function.eio-close.php                             24-Jun-2024 06:05                5718
function.eio-custom.php                            24-Jun-2024 06:05               10379
function.eio-dup2.php                              24-Jun-2024 06:05                5768
function.eio-event-loop.php                        24-Jun-2024 06:05                5809
function.eio-fallocate.php                         24-Jun-2024 06:05                7623
function.eio-fchmod.php                            24-Jun-2024 06:05                6245
function.eio-fchown.php                            24-Jun-2024 06:05                6547
function.eio-fdatasync.php                         24-Jun-2024 06:05                5632
function.eio-fstat.php                             24-Jun-2024 06:05               11620
function.eio-fstatvfs.php                          24-Jun-2024 06:05                5760
function.eio-fsync.php                             24-Jun-2024 06:05                5734
function.eio-ftruncate.php                         24-Jun-2024 06:05                6263
function.eio-futime.php                            24-Jun-2024 06:05                6569
function.eio-get-event-stream.php                  24-Jun-2024 06:05                8086
function.eio-get-last-error.php                    24-Jun-2024 06:05                3125
function.eio-grp-add.php                           24-Jun-2024 06:05               11478
function.eio-grp-cancel.php                        24-Jun-2024 06:05                3161
function.eio-grp-limit.php                         24-Jun-2024 06:05                3075
function.eio-grp.php                               24-Jun-2024 06:05               11779
function.eio-init.php                              24-Jun-2024 06:05                2623
function.eio-link.php                              24-Jun-2024 06:05               12634
function.eio-lstat.php                             24-Jun-2024 06:05               10007
function.eio-mkdir.php                             24-Jun-2024 06:05                9306
function.eio-mknod.php                             24-Jun-2024 06:05               11595
function.eio-nop.php                               24-Jun-2024 06:05                5391
function.eio-npending.php                          24-Jun-2024 06:05                3037
function.eio-nready.php                            24-Jun-2024 06:05                2785
function.eio-nreqs.php                             24-Jun-2024 06:05                5573
function.eio-nthreads.php                          24-Jun-2024 06:05                3459
function.eio-open.php                              24-Jun-2024 06:05               11588
function.eio-poll.php                              24-Jun-2024 06:05                5701
function.eio-read.php                              24-Jun-2024 06:05               12604
function.eio-readahead.php                         24-Jun-2024 06:05                6301
function.eio-readdir.php                           24-Jun-2024 06:05               18330
function.eio-readlink.php                          24-Jun-2024 06:05               12317
function.eio-realpath.php                          24-Jun-2024 06:05                5376
function.eio-rename.php                            24-Jun-2024 06:05                9391
function.eio-rmdir.php                             24-Jun-2024 06:05                8337
function.eio-seek.php                              24-Jun-2024 06:05                7111
function.eio-sendfile.php                          24-Jun-2024 06:05                6626
function.eio-set-max-idle.php                      24-Jun-2024 06:05                3164
function.eio-set-max-parallel.php                  24-Jun-2024 06:05                3213
function.eio-set-max-poll-reqs.php                 24-Jun-2024 06:05                2531
function.eio-set-max-poll-time.php                 24-Jun-2024 06:05                2601
function.eio-set-min-parallel.php                  24-Jun-2024 06:05                3204
function.eio-stat.php                              24-Jun-2024 06:05                9984
function.eio-statvfs.php                           24-Jun-2024 06:05                8465
function.eio-symlink.php                           24-Jun-2024 06:05               10951
function.eio-sync-file-range.php                   24-Jun-2024 06:05                7406
function.eio-sync.php                              24-Jun-2024 06:05                2921
function.eio-syncfs.php                            24-Jun-2024 06:05                5315
function.eio-truncate.php                          24-Jun-2024 06:05                6240
function.eio-unlink.php                            24-Jun-2024 06:05                5421
function.eio-utime.php                             24-Jun-2024 06:05                6278
function.eio-write.php                             24-Jun-2024 06:05                6996
function.empty.php                                 24-Jun-2024 06:06                9585
function.enchant-broker-describe.php               24-Jun-2024 06:05                6122
function.enchant-broker-dict-exists.php            24-Jun-2024 06:05                5794
function.enchant-broker-free-dict.php              24-Jun-2024 06:05                4828
function.enchant-broker-free.php                   24-Jun-2024 06:05                4407
function.enchant-broker-get-dict-path.php          24-Jun-2024 06:05                5364
function.enchant-broker-get-error.php              24-Jun-2024 06:05                3732
function.enchant-broker-init.php                   24-Jun-2024 06:05                3547
function.enchant-broker-list-dicts.php             24-Jun-2024 06:05                6988
function.enchant-broker-request-dict.php           24-Jun-2024 06:05                7111
function.enchant-broker-request-pwl-dict.php       24-Jun-2024 06:05                5422
function.enchant-broker-set-dict-path.php          24-Jun-2024 06:05                5653
function.enchant-broker-set-ordering.php           24-Jun-2024 06:05                4863
function.enchant-dict-add-to-personal.php          24-Jun-2024 06:05                2235
function.enchant-dict-add-to-session.php           24-Jun-2024 06:05                4494
function.enchant-dict-add.php                      24-Jun-2024 06:05                6447
function.enchant-dict-check.php                    24-Jun-2024 06:05                4310
function.enchant-dict-describe.php                 24-Jun-2024 06:05                6594
function.enchant-dict-get-error.php                24-Jun-2024 06:05                3932
function.enchant-dict-is-added.php                 24-Jun-2024 06:05                4541
function.enchant-dict-is-in-session.php            24-Jun-2024 06:05                2221
function.enchant-dict-quick-check.php              24-Jun-2024 06:05                8357
function.enchant-dict-store-replacement.php        24-Jun-2024 06:05                4771
function.enchant-dict-suggest.php                  24-Jun-2024 06:05                7513
function.end.php                                   24-Jun-2024 06:06                6841
function.enum-exists.php                           24-Jun-2024 06:06                5497
function.error-clear-last.php                      24-Jun-2024 06:05                4680
function.error-get-last.php                        24-Jun-2024 06:05                4906
function.error-log.php                             24-Jun-2024 06:05               10983
function.error-reporting.php                       24-Jun-2024 06:05                9413
function.escapeshellarg.php                        24-Jun-2024 06:05                5467
function.escapeshellcmd.php                        24-Jun-2024 06:05                7707
function.eval.php                                  24-Jun-2024 06:05                9489
function.exec.php                                  24-Jun-2024 06:05               10847
function.exif-imagetype.php                        24-Jun-2024 06:05                9982
function.exif-read-data.php                        24-Jun-2024 06:05               21994
function.exif-tagname.php                          24-Jun-2024 06:05                4839
function.exif-thumbnail.php                        24-Jun-2024 06:05                9037
function.exit.php                                  24-Jun-2024 06:05                9382
function.exp.php                                   24-Jun-2024 06:05                4374
function.expect-expectl.php                        24-Jun-2024 06:05               11148
function.expect-popen.php                          24-Jun-2024 06:05                4681
function.explode.php                               24-Jun-2024 06:06               15657
function.expm1.php                                 24-Jun-2024 06:05                3562
function.extension-loaded.php                      24-Jun-2024 06:05                5751
function.extract.php                               24-Jun-2024 06:06               14441
function.ezmlm-hash.php                            24-Jun-2024 06:05                4624
function.fann-cascadetrain-on-data.php             24-Jun-2024 06:05                6855
function.fann-cascadetrain-on-file.php             24-Jun-2024 06:05                5713
function.fann-clear-scaling-params.php             24-Jun-2024 06:05                2844
function.fann-copy.php                             24-Jun-2024 06:05                3375
function.fann-create-from-file.php                 24-Jun-2024 06:05                3383
function.fann-create-shortcut-array.php            24-Jun-2024 06:05                4195
function.fann-create-shortcut.php                  24-Jun-2024 06:05                5215
function.fann-create-sparse-array.php              24-Jun-2024 06:05                4834
function.fann-create-sparse.php                    24-Jun-2024 06:05                5592
function.fann-create-standard-array.php            24-Jun-2024 06:05                4508
function.fann-create-standard.php                  24-Jun-2024 06:05                5283
function.fann-create-train-from-callback.php       24-Jun-2024 06:05                9208
function.fann-create-train.php                     24-Jun-2024 06:05                4723
function.fann-descale-input.php                    24-Jun-2024 06:05                3904
function.fann-descale-output.php                   24-Jun-2024 06:05                3920
function.fann-descale-train.php                    24-Jun-2024 06:05                3944
function.fann-destroy-train.php                    24-Jun-2024 06:05                2808
function.fann-destroy.php                          24-Jun-2024 06:05                2831
function.fann-duplicate-train-data.php             24-Jun-2024 06:05                3065
function.fann-get-activation-function.php          24-Jun-2024 06:05                5361
function.fann-get-activation-steepness.php         24-Jun-2024 06:05                5774
function.fann-get-bias-array.php                   24-Jun-2024 06:05                2701
function.fann-get-bit-fail-limit.php               24-Jun-2024 06:05                3921
function.fann-get-bit-fail.php                     24-Jun-2024 06:05                5009
function.fann-get-cascade-activation-functions-..> 24-Jun-2024 06:05                3958
function.fann-get-cascade-activation-functions.php 24-Jun-2024 06:05                4774
function.fann-get-cascade-activation-steepnesse..> 24-Jun-2024 06:05                4014
function.fann-get-cascade-activation-steepnesse..> 24-Jun-2024 06:05                4165
function.fann-get-cascade-candidate-change-frac..> 24-Jun-2024 06:05                5271
function.fann-get-cascade-candidate-limit.php      24-Jun-2024 06:05                3661
function.fann-get-cascade-candidate-stagnation-..> 24-Jun-2024 06:05                4397
function.fann-get-cascade-max-cand-epochs.php      24-Jun-2024 06:05                3543
function.fann-get-cascade-max-out-epochs.php       24-Jun-2024 06:05                3464
function.fann-get-cascade-min-cand-epochs.php      24-Jun-2024 06:05                3870
function.fann-get-cascade-min-out-epochs.php       24-Jun-2024 06:05                3827
function.fann-get-cascade-num-candidate-groups.php 24-Jun-2024 06:05                3941
function.fann-get-cascade-num-candidates.php       24-Jun-2024 06:05                6075
function.fann-get-cascade-output-change-fractio..> 24-Jun-2024 06:05                5199
function.fann-get-cascade-output-stagnation-epo..> 24-Jun-2024 06:05                4340
function.fann-get-cascade-weight-multiplier.php    24-Jun-2024 06:05                3619
function.fann-get-connection-array.php             24-Jun-2024 06:05                2728
function.fann-get-connection-rate.php              24-Jun-2024 06:05                2851
function.fann-get-errno.php                        24-Jun-2024 06:05                3336
function.fann-get-errstr.php                       24-Jun-2024 06:05                3341
function.fann-get-layer-array.php                  24-Jun-2024 06:05                2802
function.fann-get-learning-momentum.php            24-Jun-2024 06:05                4017
function.fann-get-learning-rate.php                24-Jun-2024 06:05                3938
function.fann-get-mse.php                          24-Jun-2024 06:05                3324
function.fann-get-network-type.php                 24-Jun-2024 06:05                2821
function.fann-get-num-input.php                    24-Jun-2024 06:05                2708
function.fann-get-num-layers.php                   24-Jun-2024 06:05                2763
function.fann-get-num-output.php                   24-Jun-2024 06:05                2727
function.fann-get-quickprop-decay.php              24-Jun-2024 06:05                3476
function.fann-get-quickprop-mu.php                 24-Jun-2024 06:05                3369
function.fann-get-rprop-decrease-factor.php        24-Jun-2024 06:05                3430
function.fann-get-rprop-delta-max.php              24-Jun-2024 06:05                3492
function.fann-get-rprop-delta-min.php              24-Jun-2024 06:05                3303
function.fann-get-rprop-delta-zero.php             24-Jun-2024 06:05                3676
function.fann-get-rprop-increase-factor.php        24-Jun-2024 06:05                3455
function.fann-get-sarprop-step-error-shift.php     24-Jun-2024 06:05                3787
function.fann-get-sarprop-step-error-threshold-..> 24-Jun-2024 06:05                3939
function.fann-get-sarprop-temperature.php          24-Jun-2024 06:05                3701
function.fann-get-sarprop-weight-decay-shift.php   24-Jun-2024 06:05                3768
function.fann-get-total-connections.php            24-Jun-2024 06:05                2900
function.fann-get-total-neurons.php                24-Jun-2024 06:05                2947
function.fann-get-train-error-function.php         24-Jun-2024 06:05                3708
function.fann-get-train-stop-function.php          24-Jun-2024 06:05                3694
function.fann-get-training-algorithm.php           24-Jun-2024 06:05                3928
function.fann-init-weights.php                     24-Jun-2024 06:05                4595
function.fann-length-train-data.php                24-Jun-2024 06:05                3034
function.fann-merge-train-data.php                 24-Jun-2024 06:05                3418
function.fann-num-input-train-data.php             24-Jun-2024 06:05                3671
function.fann-num-output-train-data.php            24-Jun-2024 06:05                3669
function.fann-print-error.php                      24-Jun-2024 06:05                3092
function.fann-randomize-weights.php                24-Jun-2024 06:05                4094
function.fann-read-train-from-file.php             24-Jun-2024 06:05                5118
function.fann-reset-errno.php                      24-Jun-2024 06:05                3268
function.fann-reset-errstr.php                     24-Jun-2024 06:05                3249
function.fann-reset-mse.php                        24-Jun-2024 06:05                3581
function.fann-run.php                              24-Jun-2024 06:05                3017
function.fann-save-train.php                       24-Jun-2024 06:05                3655
function.fann-save.php                             24-Jun-2024 06:05                4457
function.fann-scale-input-train-data.php           24-Jun-2024 06:05                4282
function.fann-scale-input.php                      24-Jun-2024 06:05                3918
function.fann-scale-output-train-data.php          24-Jun-2024 06:05                4310
function.fann-scale-output.php                     24-Jun-2024 06:05                3922
function.fann-scale-train-data.php                 24-Jun-2024 06:05                4280
function.fann-scale-train.php                      24-Jun-2024 06:05                3962
function.fann-set-activation-function-hidden.php   24-Jun-2024 06:05                4613
function.fann-set-activation-function-layer.php    24-Jun-2024 06:05                5127
function.fann-set-activation-function-output.php   24-Jun-2024 06:05                4629
function.fann-set-activation-function.php          24-Jun-2024 06:05                6604
function.fann-set-activation-steepness-hidden.php  24-Jun-2024 06:05                4899
function.fann-set-activation-steepness-layer.php   24-Jun-2024 06:05                5364
function.fann-set-activation-steepness-output.php  24-Jun-2024 06:05                4880
function.fann-set-activation-steepness.php         24-Jun-2024 06:05                6260
function.fann-set-bit-fail-limit.php               24-Jun-2024 06:05                3602
function.fann-set-callback.php                     24-Jun-2024 06:05                5775
function.fann-set-cascade-activation-functions.php 24-Jun-2024 06:05                4258
function.fann-set-cascade-activation-steepnesse..> 24-Jun-2024 06:05                4471
function.fann-set-cascade-candidate-change-frac..> 24-Jun-2024 06:05                3953
function.fann-set-cascade-candidate-limit.php      24-Jun-2024 06:05                3760
function.fann-set-cascade-candidate-stagnation-..> 24-Jun-2024 06:05                4015
function.fann-set-cascade-max-cand-epochs.php      24-Jun-2024 06:05                3761
function.fann-set-cascade-max-out-epochs.php       24-Jun-2024 06:05                3712
function.fann-set-cascade-min-cand-epochs.php      24-Jun-2024 06:05                4093
function.fann-set-cascade-min-out-epochs.php       24-Jun-2024 06:05                4075
function.fann-set-cascade-num-candidate-groups.php 24-Jun-2024 06:05                3846
function.fann-set-cascade-output-change-fractio..> 24-Jun-2024 06:05                3910
function.fann-set-cascade-output-stagnation-epo..> 24-Jun-2024 06:05                3976
function.fann-set-cascade-weight-multiplier.php    24-Jun-2024 06:05                3745
function.fann-set-error-log.php                    24-Jun-2024 06:05                3113
function.fann-set-input-scaling-params.php         24-Jun-2024 06:05                4722
function.fann-set-learning-momentum.php            24-Jun-2024 06:05                3986
function.fann-set-learning-rate.php                24-Jun-2024 06:05                3912
function.fann-set-output-scaling-params.php        24-Jun-2024 06:05                4742
function.fann-set-quickprop-decay.php              24-Jun-2024 06:05                3673
function.fann-set-quickprop-mu.php                 24-Jun-2024 06:05                3528
function.fann-set-rprop-decrease-factor.php        24-Jun-2024 06:05                3730
function.fann-set-rprop-delta-max.php              24-Jun-2024 06:05                3842
function.fann-set-rprop-delta-min.php              24-Jun-2024 06:05                3648
function.fann-set-rprop-delta-zero.php             24-Jun-2024 06:05                4030
function.fann-set-rprop-increase-factor.php        24-Jun-2024 06:05                3756
function.fann-set-sarprop-step-error-shift.php     24-Jun-2024 06:05                4143
function.fann-set-sarprop-step-error-threshold-..> 24-Jun-2024 06:05                4337
function.fann-set-sarprop-temperature.php          24-Jun-2024 06:05                4054
function.fann-set-sarprop-weight-decay-shift.php   24-Jun-2024 06:05                4137
function.fann-set-scaling-params.php               24-Jun-2024 06:05                5759
function.fann-set-train-error-function.php         24-Jun-2024 06:05                3942
function.fann-set-train-stop-function.php          24-Jun-2024 06:05                3930
function.fann-set-training-algorithm.php           24-Jun-2024 06:05                3878
function.fann-set-weight-array.php                 24-Jun-2024 06:05                3386
function.fann-set-weight.php                       24-Jun-2024 06:05                3834
function.fann-shuffle-train-data.php               24-Jun-2024 06:05                3008
function.fann-subset-train-data.php                24-Jun-2024 06:05                4432
function.fann-test-data.php                        24-Jun-2024 06:05                4340
function.fann-test.php                             24-Jun-2024 06:05                4622
function.fann-train-epoch.php                      24-Jun-2024 06:05                4714
function.fann-train-on-data.php                    24-Jun-2024 06:05                6669
function.fann-train-on-file.php                    24-Jun-2024 06:05                6586
function.fann-train.php                            24-Jun-2024 06:05                4713
function.fastcgi-finish-request.php                24-Jun-2024 06:06                2669
function.fbird-add-user.php                        24-Jun-2024 06:05                2405
function.fbird-affected-rows.php                   24-Jun-2024 06:05                2403
function.fbird-backup.php                          24-Jun-2024 06:05                1812
function.fbird-blob-add.php                        24-Jun-2024 06:05                2725
function.fbird-blob-cancel.php                     24-Jun-2024 06:05                3761
function.fbird-blob-close.php                      24-Jun-2024 06:05                2756
function.fbird-blob-create.php                     24-Jun-2024 06:05                2756
function.fbird-blob-echo.php                       24-Jun-2024 06:05                2559
function.fbird-blob-get.php                        24-Jun-2024 06:05                2552
function.fbird-blob-import.php                     24-Jun-2024 06:05                2752
function.fbird-blob-info.php                       24-Jun-2024 06:05                1844
function.fbird-blob-open.php                       24-Jun-2024 06:05                2549
function.fbird-close.php                           24-Jun-2024 06:05                2326
function.fbird-commit-ret.php                      24-Jun-2024 06:05                1837
function.fbird-commit.php                          24-Jun-2024 06:05                1805
function.fbird-connect.php                         24-Jun-2024 06:05                2332
function.fbird-db-info.php                         24-Jun-2024 06:05                1818
function.fbird-delete-user.php                     24-Jun-2024 06:05                2400
function.fbird-drop-db.php                         24-Jun-2024 06:05                2348
function.fbird-errcode.php                         24-Jun-2024 06:05                2162
function.fbird-errmsg.php                          24-Jun-2024 06:05                2155
function.fbird-execute.php                         24-Jun-2024 06:05                2167
function.fbird-fetch-assoc.php                     24-Jun-2024 06:05                2416
function.fbird-fetch-object.php                    24-Jun-2024 06:05                2427
function.fbird-fetch-row.php                       24-Jun-2024 06:05                2404
function.fbird-field-info.php                      24-Jun-2024 06:05                2237
function.fbird-free-event-handler.php              24-Jun-2024 06:05                2341
function.fbird-free-query.php                      24-Jun-2024 06:05                1873
function.fbird-free-result.php                     24-Jun-2024 06:05                1858
function.fbird-gen-id.php                          24-Jun-2024 06:05                1815
function.fbird-maintain-db.php                     24-Jun-2024 06:05                1860
function.fbird-modify-user.php                     24-Jun-2024 06:05                2416
function.fbird-name-result.php                     24-Jun-2024 06:05                2399
function.fbird-num-fields.php                      24-Jun-2024 06:05                2226
function.fbird-num-params.php                      24-Jun-2024 06:05                2394
function.fbird-param-info.php                      24-Jun-2024 06:05                2399
function.fbird-pconnect.php                        24-Jun-2024 06:05                2349
function.fbird-prepare.php                         24-Jun-2024 06:05                1808
function.fbird-query.php                           24-Jun-2024 06:05                2683
function.fbird-restore.php                         24-Jun-2024 06:05                1815
function.fbird-rollback-ret.php                    24-Jun-2024 06:05                1867
function.fbird-rollback.php                        24-Jun-2024 06:05                1839
function.fbird-server-info.php                     24-Jun-2024 06:05                1870
function.fbird-service-attach.php                  24-Jun-2024 06:05                1909
function.fbird-service-detach.php                  24-Jun-2024 06:05                1921
function.fbird-set-event-handler.php               24-Jun-2024 06:05                2509
function.fbird-trans.php                           24-Jun-2024 06:05                1814
function.fbird-wait-event.php                      24-Jun-2024 06:05                2434
function.fclose.php                                24-Jun-2024 06:05                4491
function.fdatasync.php                             24-Jun-2024 06:05                6130
function.fdf-add-doc-javascript.php                24-Jun-2024 06:05                5590
function.fdf-add-template.php                      24-Jun-2024 06:05                2942
function.fdf-close.php                             24-Jun-2024 06:05                3116
function.fdf-create.php                            24-Jun-2024 06:05                5631
function.fdf-enum-values.php                       24-Jun-2024 06:05                2515
function.fdf-errno.php                             24-Jun-2024 06:05                2797
function.fdf-error.php                             24-Jun-2024 06:05                3237
function.fdf-get-ap.php                            24-Jun-2024 06:05                4455
function.fdf-get-attachment.php                    24-Jun-2024 06:05                6127
function.fdf-get-encoding.php                      24-Jun-2024 06:05                3419
function.fdf-get-file.php                          24-Jun-2024 06:05                3239
function.fdf-get-flags.php                         24-Jun-2024 06:05                2435
function.fdf-get-opt.php                           24-Jun-2024 06:05                2474
function.fdf-get-status.php                        24-Jun-2024 06:05                3258
function.fdf-get-value.php                         24-Jun-2024 06:05                4570
function.fdf-get-version.php                       24-Jun-2024 06:05                3618
function.fdf-header.php                            24-Jun-2024 06:05                2368
function.fdf-next-field-name.php                   24-Jun-2024 06:05                5424
function.fdf-open-string.php                       24-Jun-2024 06:05                4880
function.fdf-open.php                              24-Jun-2024 06:05                5891
function.fdf-remove-item.php                       24-Jun-2024 06:05                2448
function.fdf-save-string.php                       24-Jun-2024 06:05                5649
function.fdf-save.php                              24-Jun-2024 06:05                4127
function.fdf-set-ap.php                            24-Jun-2024 06:05                4682
function.fdf-set-encoding.php                      24-Jun-2024 06:05                3810
function.fdf-set-file.php                          24-Jun-2024 06:05                6758
function.fdf-set-flags.php                         24-Jun-2024 06:05                4433
function.fdf-set-javascript-action.php             24-Jun-2024 06:05                4630
function.fdf-set-on-import-javascript.php          24-Jun-2024 06:05                3225
function.fdf-set-opt.php                           24-Jun-2024 06:05                4716
function.fdf-set-status.php                        24-Jun-2024 06:05                3846
function.fdf-set-submit-form-action.php            24-Jun-2024 06:05                4929
function.fdf-set-target-frame.php                  24-Jun-2024 06:05                3846
function.fdf-set-value.php                         24-Jun-2024 06:05                5283
function.fdf-set-version.php                       24-Jun-2024 06:05                4070
function.fdiv.php                                  24-Jun-2024 06:05                6481
function.feof.php                                  24-Jun-2024 06:05                7789
function.fflush.php                                24-Jun-2024 06:05                5692
function.fgetc.php                                 24-Jun-2024 06:05                6617
function.fgetcsv.php                               24-Jun-2024 06:05               13148
function.fgets.php                                 24-Jun-2024 06:05                8595
function.fgetss.php                                24-Jun-2024 06:05                9483
function.file-exists.php                           24-Jun-2024 06:05                7213
function.file-get-contents.php                     24-Jun-2024 06:05               18649
function.file-put-contents.php                     24-Jun-2024 06:05               13461
function.file.php                                  24-Jun-2024 06:05               12116
function.fileatime.php                             24-Jun-2024 06:05                7053
function.filectime.php                             24-Jun-2024 06:05                7146
function.filegroup.php                             24-Jun-2024 06:05                5830
function.fileinode.php                             24-Jun-2024 06:05                5392
function.filemtime.php                             24-Jun-2024 06:05                6887
function.fileowner.php                             24-Jun-2024 06:05                5727
function.fileperms.php                             24-Jun-2024 06:05               16448
function.filesize.php                              24-Jun-2024 06:05                5849
function.filetype.php                              24-Jun-2024 06:05                6869
function.filter-has-var.php                        24-Jun-2024 06:06                3499
function.filter-id.php                             24-Jun-2024 06:06                3034
function.filter-input-array.php                    24-Jun-2024 06:06               13463
function.filter-input.php                          24-Jun-2024 06:06                8593
function.filter-list.php                           24-Jun-2024 06:06                3736
function.filter-var-array.php                      24-Jun-2024 06:06               12230
function.filter-var.php                            24-Jun-2024 06:06               14365
function.finfo-buffer.php                          24-Jun-2024 06:05                8584
function.finfo-close.php                           24-Jun-2024 06:05                3638
function.finfo-file.php                            24-Jun-2024 06:05                9211
function.finfo-open.php                            24-Jun-2024 06:05               10491
function.finfo-set-flags.php                       24-Jun-2024 06:05                4716
function.floatval.php                              24-Jun-2024 06:06                6981
function.flock.php                                 24-Jun-2024 06:05               13342
function.floor.php                                 24-Jun-2024 06:05                5094
function.flush.php                                 24-Jun-2024 06:05                4666
function.fmod.php                                  24-Jun-2024 06:05                5091
function.fnmatch.php                               24-Jun-2024 06:05               11393
function.fopen.php                                 24-Jun-2024 06:05               23326
function.forward-static-call-array.php             24-Jun-2024 06:06                9610
function.forward-static-call.php                   24-Jun-2024 06:06                8875
function.fpassthru.php                             24-Jun-2024 06:05                7343
function.fpm-get-status.php                        24-Jun-2024 06:06                2836
function.fprintf.php                               24-Jun-2024 06:06               23441
function.fputcsv.php                               24-Jun-2024 06:05               10605
function.fputs.php                                 24-Jun-2024 06:05                1717
function.fread.php                                 24-Jun-2024 06:05               14926
function.frenchtojd.php                            24-Jun-2024 06:05                4253
function.fscanf.php                                24-Jun-2024 06:05                9599
function.fseek.php                                 24-Jun-2024 06:05                8017
function.fsockopen.php                             24-Jun-2024 06:05               17161
function.fstat.php                                 24-Jun-2024 06:05                6206
function.fsync.php                                 24-Jun-2024 06:05                5863
function.ftell.php                                 24-Jun-2024 06:05                6264
function.ftok.php                                  24-Jun-2024 06:05                3695
function.ftp-alloc.php                             24-Jun-2024 06:05                8557
function.ftp-append.php                            24-Jun-2024 06:05                4671
function.ftp-cdup.php                              24-Jun-2024 06:05                6704
function.ftp-chdir.php                             24-Jun-2024 06:05                7579
function.ftp-chmod.php                             24-Jun-2024 06:05                7281
function.ftp-close.php                             24-Jun-2024 06:05                6161
function.ftp-connect.php                           24-Jun-2024 06:05                6643
function.ftp-delete.php                            24-Jun-2024 06:05                6377
function.ftp-exec.php                              24-Jun-2024 06:05                6930
function.ftp-fget.php                              24-Jun-2024 06:05               10119
function.ftp-fput.php                              24-Jun-2024 06:05                9531
function.ftp-get-option.php                        24-Jun-2024 06:05                6399
function.ftp-get.php                               24-Jun-2024 06:05                9425
function.ftp-login.php                             24-Jun-2024 06:05                6967
function.ftp-mdtm.php                              24-Jun-2024 06:05                7220
function.ftp-mkdir.php                             24-Jun-2024 06:05                7083
function.ftp-mlsd.php                              24-Jun-2024 06:05                9233
function.ftp-nb-continue.php                       24-Jun-2024 06:05                5627
function.ftp-nb-fget.php                           24-Jun-2024 06:05               10610
function.ftp-nb-fput.php                           24-Jun-2024 06:05               10396
function.ftp-nb-get.php                            24-Jun-2024 06:05               14330
function.ftp-nb-put.php                            24-Jun-2024 06:05               11714
function.ftp-nlist.php                             24-Jun-2024 06:05                6976
function.ftp-pasv.php                              24-Jun-2024 06:05                7389
function.ftp-put.php                               24-Jun-2024 06:05                9141
function.ftp-pwd.php                               24-Jun-2024 06:05                6131
function.ftp-quit.php                              24-Jun-2024 06:05                1732
function.ftp-raw.php                               24-Jun-2024 06:05                5795
function.ftp-rawlist.php                           24-Jun-2024 06:05                8283
function.ftp-rename.php                            24-Jun-2024 06:05                7371
function.ftp-rmdir.php                             24-Jun-2024 06:05                6627
function.ftp-set-option.php                        24-Jun-2024 06:05                7657
function.ftp-site.php                              24-Jun-2024 06:05                6803
function.ftp-size.php                              24-Jun-2024 06:05                6917
function.ftp-ssl-connect.php                       24-Jun-2024 06:05                8964
function.ftp-systype.php                           24-Jun-2024 06:05                5687
function.ftruncate.php                             24-Jun-2024 06:05                6651
function.func-get-arg.php                          24-Jun-2024 06:06               11431
function.func-get-args.php                         24-Jun-2024 06:06               11923
function.func-num-args.php                         24-Jun-2024 06:06                6045
function.function-exists.php                       24-Jun-2024 06:06                6226
function.fwrite.php                                24-Jun-2024 06:05               14772
function.gc-collect-cycles.php                     24-Jun-2024 06:05                2597
function.gc-disable.php                            24-Jun-2024 06:05                2632
function.gc-enable.php                             24-Jun-2024 06:05                2605
function.gc-enabled.php                            24-Jun-2024 06:05                3454
function.gc-mem-caches.php                         24-Jun-2024 06:05                2537
function.gc-status.php                             24-Jun-2024 06:05                8780
function.gd-info.php                               24-Jun-2024 06:05                9284
function.geoip-asnum-by-name.php                   24-Jun-2024 06:05                4285
function.geoip-continent-code-by-name.php          24-Jun-2024 06:05                5783
function.geoip-country-code-by-name.php            24-Jun-2024 06:05                5504
function.geoip-country-code3-by-name.php           24-Jun-2024 06:05                5069
function.geoip-country-name-by-name.php            24-Jun-2024 06:05                5033
function.geoip-database-info.php                   24-Jun-2024 06:05                4356
function.geoip-db-avail.php                        24-Jun-2024 06:05                4572
function.geoip-db-filename.php                     24-Jun-2024 06:05                4232
function.geoip-db-get-all-info.php                 24-Jun-2024 06:05                6814
function.geoip-domain-by-name.php                  24-Jun-2024 06:05                4507
function.geoip-id-by-name.php                      24-Jun-2024 06:05                5579
function.geoip-isp-by-name.php                     24-Jun-2024 06:05                4511
function.geoip-netspeedcell-by-name.php            24-Jun-2024 06:05                5249
function.geoip-org-by-name.php                     24-Jun-2024 06:05                4530
function.geoip-record-by-name.php                  24-Jun-2024 06:05                7864
function.geoip-region-by-name.php                  24-Jun-2024 06:05                5191
function.geoip-region-name-by-code.php             24-Jun-2024 06:05                7246
function.geoip-setup-custom-directory.php          24-Jun-2024 06:05                4275
function.geoip-time-zone-by-country-and-region.php 24-Jun-2024 06:05                7456
function.get-browser.php                           24-Jun-2024 06:05                8851
function.get-called-class.php                      24-Jun-2024 06:06                6229
function.get-cfg-var.php                           24-Jun-2024 06:05                3930
function.get-class-methods.php                     24-Jun-2024 06:06                7011
function.get-class-vars.php                        24-Jun-2024 06:06                9754
function.get-class.php                             24-Jun-2024 06:06               12846
function.get-current-user.php                      24-Jun-2024 06:05                4443
function.get-debug-type.php                        24-Jun-2024 06:06                9692
function.get-declared-classes.php                  24-Jun-2024 06:06                5405
function.get-declared-interfaces.php               24-Jun-2024 06:06                4364
function.get-declared-traits.php                   24-Jun-2024 06:06                2902
function.get-defined-constants.php                 24-Jun-2024 06:05                7594
function.get-defined-functions.php                 24-Jun-2024 06:06                7235
function.get-defined-vars.php                      24-Jun-2024 06:06                6378
function.get-extension-funcs.php                   24-Jun-2024 06:05                5686
function.get-headers.php                           24-Jun-2024 06:05                9435
function.get-html-translation-table.php            24-Jun-2024 06:06               14283
function.get-include-path.php                      24-Jun-2024 06:05                4503
function.get-included-files.php                    24-Jun-2024 06:05                6009
function.get-loaded-extensions.php                 24-Jun-2024 06:05                5673
function.get-magic-quotes-gpc.php                  24-Jun-2024 06:05                4252
function.get-magic-quotes-runtime.php              24-Jun-2024 06:05                3767
function.get-mangled-object-vars.php               24-Jun-2024 06:06                8340
function.get-meta-tags.php                         24-Jun-2024 06:05                7923
function.get-object-vars.php                       24-Jun-2024 06:06                6207
function.get-parent-class.php                      24-Jun-2024 06:06                7746
function.get-required-files.php                    24-Jun-2024 06:05                1900
function.get-resource-id.php                       24-Jun-2024 06:06                5029
function.get-resource-type.php                     24-Jun-2024 06:06                5472
function.get-resources.php                         24-Jun-2024 06:05                8008
function.getallheaders.php                         24-Jun-2024 06:06                4791
function.getcwd.php                                24-Jun-2024 06:05                5446
function.getdate.php                               24-Jun-2024 06:05                9721
function.getenv.php                                24-Jun-2024 06:05                8827
function.gethostbyaddr.php                         24-Jun-2024 06:05                4553
function.gethostbyname.php                         24-Jun-2024 06:05                4674
function.gethostbynamel.php                        24-Jun-2024 06:05                5254
function.gethostname.php                           24-Jun-2024 06:05                4081
function.getimagesize.php                          24-Jun-2024 06:05               17475
function.getimagesizefromstring.php                24-Jun-2024 06:05                5762
function.getlastmod.php                            24-Jun-2024 06:05                5369
function.getmxrr.php                               24-Jun-2024 06:05                6127
function.getmygid.php                              24-Jun-2024 06:05                3545
function.getmyinode.php                            24-Jun-2024 06:05                3572
function.getmypid.php                              24-Jun-2024 06:05                3919
function.getmyuid.php                              24-Jun-2024 06:05                3527
function.getopt.php                                24-Jun-2024 06:05               15337
function.getprotobyname.php                        24-Jun-2024 06:05                4734
function.getprotobynumber.php                      24-Jun-2024 06:05                3360
function.getrandmax.php                            24-Jun-2024 06:05                3124
function.getrusage.php                             24-Jun-2024 06:05               11242
function.getservbyname.php                         24-Jun-2024 06:05                6514
function.getservbyport.php                         24-Jun-2024 06:05                3870
function.gettext.php                               24-Jun-2024 06:05                5877
function.gettimeofday.php                          24-Jun-2024 06:05                4990
function.gettype.php                               24-Jun-2024 06:06                9410
function.glob.php                                  24-Jun-2024 06:05               11034
function.gmdate.php                                24-Jun-2024 06:05                7821
function.gmmktime.php                              24-Jun-2024 06:05               11494
function.gmp-abs.php                               24-Jun-2024 06:05                4621
function.gmp-add.php                               24-Jun-2024 06:05                5012
function.gmp-and.php                               24-Jun-2024 06:05                5498
function.gmp-binomial.php                          24-Jun-2024 06:05                4171
function.gmp-clrbit.php                            24-Jun-2024 06:05                5522
function.gmp-cmp.php                               24-Jun-2024 06:05                5881
function.gmp-com.php                               24-Jun-2024 06:05                4093
function.gmp-div-q.php                             24-Jun-2024 06:05               10459
function.gmp-div-qr.php                            24-Jun-2024 06:05                7021
function.gmp-div-r.php                             24-Jun-2024 06:05                6404
function.gmp-div.php                               24-Jun-2024 06:05                1756
function.gmp-divexact.php                          24-Jun-2024 06:05                6132
function.gmp-export.php                            24-Jun-2024 06:05                5750
function.gmp-fact.php                              24-Jun-2024 06:05                4963
function.gmp-gcd.php                               24-Jun-2024 06:05                5387
function.gmp-gcdext.php                            24-Jun-2024 06:05                9636
function.gmp-hamdist.php                           24-Jun-2024 06:05                6825
function.gmp-import.php                            24-Jun-2024 06:05                6069
function.gmp-init.php                              24-Jun-2024 06:05                5683
function.gmp-intval.php                            24-Jun-2024 06:05                5512
function.gmp-invert.php                            24-Jun-2024 06:05                5604
function.gmp-jacobi.php                            24-Jun-2024 06:05                5919
function.gmp-kronecker.php                         24-Jun-2024 06:05                4264
function.gmp-lcm.php                               24-Jun-2024 06:05                4011
function.gmp-legendre.php                          24-Jun-2024 06:05                5938
function.gmp-mod.php                               24-Jun-2024 06:05                5181
function.gmp-mul.php                               24-Jun-2024 06:05                5234
function.gmp-neg.php                               24-Jun-2024 06:05                4562
function.gmp-nextprime.php                         24-Jun-2024 06:05                5256
function.gmp-or.php                                24-Jun-2024 06:05                5707
function.gmp-perfect-power.php                     24-Jun-2024 06:05                3510
function.gmp-perfect-square.php                    24-Jun-2024 06:05                5755
function.gmp-popcount.php                          24-Jun-2024 06:05                5070
function.gmp-pow.php                               24-Jun-2024 06:05                5936
function.gmp-powm.php                              24-Jun-2024 06:05                6276
function.gmp-prob-prime.php                        24-Jun-2024 06:05                6021
function.gmp-random-bits.php                       24-Jun-2024 06:05                6123
function.gmp-random-range.php                      24-Jun-2024 06:05                7488
function.gmp-random-seed.php                       24-Jun-2024 06:05                7694
function.gmp-random.php                            24-Jun-2024 06:05                6571
function.gmp-root.php                              24-Jun-2024 06:05                3349
function.gmp-rootrem.php                           24-Jun-2024 06:05                3515
function.gmp-scan0.php                             24-Jun-2024 06:05                5709
function.gmp-scan1.php                             24-Jun-2024 06:05                5721
function.gmp-setbit.php                            24-Jun-2024 06:05               11654
function.gmp-sign.php                              24-Jun-2024 06:05                5204
function.gmp-sqrt.php                              24-Jun-2024 06:05                5126
function.gmp-sqrtrem.php                           24-Jun-2024 06:05                6518
function.gmp-strval.php                            24-Jun-2024 06:05                4913
function.gmp-sub.php                               24-Jun-2024 06:05                5283
function.gmp-testbit.php                           24-Jun-2024 06:05                6161
function.gmp-xor.php                               24-Jun-2024 06:05                5713
function.gmstrftime.php                            24-Jun-2024 06:05                9248
function.gnupg-adddecryptkey.php                   24-Jun-2024 06:05                5448
function.gnupg-addencryptkey.php                   24-Jun-2024 06:05                4982
function.gnupg-addsignkey.php                      24-Jun-2024 06:05                5455
function.gnupg-cleardecryptkeys.php                24-Jun-2024 06:05                4516
function.gnupg-clearencryptkeys.php                24-Jun-2024 06:05                4521
function.gnupg-clearsignkeys.php                   24-Jun-2024 06:05                4463
function.gnupg-decrypt.php                         24-Jun-2024 06:05                6182
function.gnupg-decryptverify.php                   24-Jun-2024 06:05                7334
function.gnupg-deletekey.php                       24-Jun-2024 06:05                5259
function.gnupg-encrypt.php                         24-Jun-2024 06:05                6085
function.gnupg-encryptsign.php                     24-Jun-2024 06:05                6985
function.gnupg-export.php                          24-Jun-2024 06:05                5293
function.gnupg-getengineinfo.php                   24-Jun-2024 06:05                5640
function.gnupg-geterror.php                        24-Jun-2024 06:05                4436
function.gnupg-geterrorinfo.php                    24-Jun-2024 06:05                5743
function.gnupg-getprotocol.php                     24-Jun-2024 06:05                4524
function.gnupg-gettrustlist.php                    24-Jun-2024 06:05                5346
function.gnupg-import.php                          24-Jun-2024 06:05                5543
function.gnupg-init.php                            24-Jun-2024 06:05                7369
function.gnupg-keyinfo.php                         24-Jun-2024 06:05                5470
function.gnupg-listsignatures.php                  24-Jun-2024 06:05                5570
function.gnupg-setarmor.php                        24-Jun-2024 06:05                5732
function.gnupg-seterrormode.php                    24-Jun-2024 06:05                5789
function.gnupg-setsignmode.php                     24-Jun-2024 06:05                5867
function.gnupg-sign.php                            24-Jun-2024 06:05                6327
function.gnupg-verify.php                          24-Jun-2024 06:05                8575
function.grapheme-extract.php                      24-Jun-2024 06:05                9103
function.grapheme-stripos.php                      24-Jun-2024 06:05                8599
function.grapheme-stristr.php                      24-Jun-2024 06:05                8179
function.grapheme-strlen.php                       24-Jun-2024 06:05                5641
function.grapheme-strpos.php                       24-Jun-2024 06:05                8291
function.grapheme-strripos.php                     24-Jun-2024 06:05                8038
function.grapheme-strrpos.php                      24-Jun-2024 06:05                7707
function.grapheme-strstr.php                       24-Jun-2024 06:05                7831
function.grapheme-substr.php                       24-Jun-2024 06:05                8232
function.gregoriantojd.php                         24-Jun-2024 06:05                7961
function.gzclose.php                               24-Jun-2024 06:05                4460
function.gzcompress.php                            24-Jun-2024 06:05                6176
function.gzdecode.php                              24-Jun-2024 06:05                3879
function.gzdeflate.php                             24-Jun-2024 06:05                5826
function.gzencode.php                              24-Jun-2024 06:05                7208
function.gzeof.php                                 24-Jun-2024 06:05                4267
function.gzfile.php                                24-Jun-2024 06:05                4886
function.gzgetc.php                                24-Jun-2024 06:05                4839
function.gzgets.php                                24-Jun-2024 06:05                6329
function.gzgetss.php                               24-Jun-2024 06:05                6270
function.gzinflate.php                             24-Jun-2024 06:05                5555
function.gzopen.php                                24-Jun-2024 06:05                5884
function.gzpassthru.php                            24-Jun-2024 06:05                4887
function.gzputs.php                                24-Jun-2024 06:05                1702
function.gzread.php                                24-Jun-2024 06:05                6892
function.gzrewind.php                              24-Jun-2024 06:05                3442
function.gzseek.php                                24-Jun-2024 06:05                6642
function.gztell.php                                24-Jun-2024 06:05                3609
function.gzuncompress.php                          24-Jun-2024 06:05                5504
function.gzwrite.php                               24-Jun-2024 06:05                6779
function.halt-compiler.php                         24-Jun-2024 06:05                5224
function.hash-algos.php                            24-Jun-2024 06:05                5861
function.hash-copy.php                             24-Jun-2024 06:05                5564
function.hash-equals.php                           24-Jun-2024 06:05                7439
function.hash-file.php                             24-Jun-2024 06:05                7629
function.hash-final.php                            24-Jun-2024 06:05                4903
function.hash-hkdf.php                             24-Jun-2024 06:05                9965
function.hash-hmac-algos.php                       24-Jun-2024 06:05                5357
function.hash-hmac-file.php                        24-Jun-2024 06:05                8453
function.hash-hmac.php                             24-Jun-2024 06:05                8037
function.hash-init.php                             24-Jun-2024 06:05               10686
function.hash-pbkdf2.php                           24-Jun-2024 06:05               12781
function.hash-update-file.php                      24-Jun-2024 06:05                5873
function.hash-update-stream.php                    24-Jun-2024 06:05                7450
function.hash-update.php                           24-Jun-2024 06:05                4470
function.hash.php                                  24-Jun-2024 06:05                7402
function.header-register-callback.php              24-Jun-2024 06:05                6932
function.header-remove.php                         24-Jun-2024 06:05                7012
function.header.php                                24-Jun-2024 06:05               19490
function.headers-list.php                          24-Jun-2024 06:05                6152
function.headers-sent.php                          24-Jun-2024 06:05                8287
function.hebrev.php                                24-Jun-2024 06:06                3427
function.hebrevc.php                               24-Jun-2024 06:06                3850
function.hex2bin.php                               24-Jun-2024 06:06                5156
function.hexdec.php                                24-Jun-2024 06:05                6606
function.highlight-file.php                        24-Jun-2024 06:05                6248
function.highlight-string.php                      24-Jun-2024 06:05                7059
function.hrtime.php                                24-Jun-2024 06:05                5353
function.html-entity-decode.php                    24-Jun-2024 06:06               14937
function.htmlentities.php                          24-Jun-2024 06:06               18139
function.htmlspecialchars-decode.php               24-Jun-2024 06:06                9553
function.htmlspecialchars.php                      24-Jun-2024 06:06               23092
function.http-build-query.php                      24-Jun-2024 06:05               20125
function.http-response-code.php                    24-Jun-2024 06:05                7117
function.hypot.php                                 24-Jun-2024 06:05                3123
function.ibase-add-user.php                        24-Jun-2024 06:05                5259
function.ibase-affected-rows.php                   24-Jun-2024 06:05                3519
function.ibase-backup.php                          24-Jun-2024 06:05               10544
function.ibase-blob-add.php                        24-Jun-2024 06:05                4064
function.ibase-blob-cancel.php                     24-Jun-2024 06:05                3749
function.ibase-blob-close.php                      24-Jun-2024 06:05                4015
function.ibase-blob-create.php                     24-Jun-2024 06:05                4102
function.ibase-blob-echo.php                       24-Jun-2024 06:05                4311
function.ibase-blob-get.php                        24-Jun-2024 06:05                6686
function.ibase-blob-import.php                     24-Jun-2024 06:05                8065
function.ibase-blob-info.php                       24-Jun-2024 06:05                3581
function.ibase-blob-open.php                       24-Jun-2024 06:05                4541
function.ibase-close.php                           24-Jun-2024 06:05                3858
function.ibase-commit-ret.php                      24-Jun-2024 06:05                3363
function.ibase-commit.php                          24-Jun-2024 06:05                3164
function.ibase-connect.php                         24-Jun-2024 06:05               10718
function.ibase-db-info.php                         24-Jun-2024 06:05                2771
function.ibase-delete-user.php                     24-Jun-2024 06:05                3694
function.ibase-drop-db.php                         24-Jun-2024 06:05                3756
function.ibase-errcode.php                         24-Jun-2024 06:05                2729
function.ibase-errmsg.php                          24-Jun-2024 06:05                2722
function.ibase-execute.php                         24-Jun-2024 06:05                7091
function.ibase-fetch-assoc.php                     24-Jun-2024 06:05                4764
function.ibase-fetch-object.php                    24-Jun-2024 06:05                6692
function.ibase-fetch-row.php                       24-Jun-2024 06:05                4581
function.ibase-field-info.php                      24-Jun-2024 06:05                7094
function.ibase-free-event-handler.php              24-Jun-2024 06:05                3620
function.ibase-free-query.php                      24-Jun-2024 06:05                2899
function.ibase-free-result.php                     24-Jun-2024 06:05                3014
function.ibase-gen-id.php                          24-Jun-2024 06:05                2888
function.ibase-maintain-db.php                     24-Jun-2024 06:05                3207
function.ibase-modify-user.php                     24-Jun-2024 06:05                5291
function.ibase-name-result.php                     24-Jun-2024 06:05                5936
function.ibase-num-fields.php                      24-Jun-2024 06:05                6554
function.ibase-num-params.php                      24-Jun-2024 06:05                3565
function.ibase-param-info.php                      24-Jun-2024 06:05                3812
function.ibase-pconnect.php                        24-Jun-2024 06:05                7972
function.ibase-prepare.php                         24-Jun-2024 06:05                4779
function.ibase-query.php                           24-Jun-2024 06:05                7413
function.ibase-restore.php                         24-Jun-2024 06:05               10811
function.ibase-rollback-ret.php                    24-Jun-2024 06:05                3404
function.ibase-rollback.php                        24-Jun-2024 06:05                3209
function.ibase-server-info.php                     24-Jun-2024 06:05                9872
function.ibase-service-attach.php                  24-Jun-2024 06:05               11075
function.ibase-service-detach.php                  24-Jun-2024 06:05                6190
function.ibase-set-event-handler.php               24-Jun-2024 06:05                7920
function.ibase-trans.php                           24-Jun-2024 06:05                5925
function.ibase-wait-event.php                      24-Jun-2024 06:05                4409
function.iconv-get-encoding.php                    24-Jun-2024 06:05                5876
function.iconv-mime-decode-headers.php             24-Jun-2024 06:05               10733
function.iconv-mime-decode.php                     24-Jun-2024 06:05                8617
function.iconv-mime-encode.php                     24-Jun-2024 06:05               12275
function.iconv-set-encoding.php                    24-Jun-2024 06:05                5159
function.iconv-strlen.php                          24-Jun-2024 06:05                5241
function.iconv-strpos.php                          24-Jun-2024 06:05                7701
function.iconv-strrpos.php                         24-Jun-2024 06:05                6906
function.iconv-substr.php                          24-Jun-2024 06:05                8631
function.iconv.php                                 24-Jun-2024 06:05                9215
function.idate.php                                 24-Jun-2024 06:05               11507
function.idn-to-ascii.php                          24-Jun-2024 06:05                8105
function.idn-to-utf8.php                           24-Jun-2024 06:05                8105
function.igbinary-serialize.php                    24-Jun-2024 06:05               10011
function.igbinary-unserialize.php                  24-Jun-2024 06:05                9969
function.ignore-user-abort.php                     24-Jun-2024 06:05                7748
function.image-type-to-extension.php               24-Jun-2024 06:05                5545
function.image-type-to-mime-type.php               24-Jun-2024 06:05                9218
function.image2wbmp.php                            24-Jun-2024 06:05                6729
function.imageaffine.php                           24-Jun-2024 06:05                5011
function.imageaffinematrixconcat.php               24-Jun-2024 06:05                6770
function.imageaffinematrixget.php                  24-Jun-2024 06:05                6834
function.imagealphablending.php                    24-Jun-2024 06:05                7938
function.imageantialias.php                        24-Jun-2024 06:05               11244
function.imagearc.php                              24-Jun-2024 06:05               13935
function.imageavif.php                             24-Jun-2024 06:05                6300
function.imagebmp.php                              24-Jun-2024 06:05                8438
function.imagechar.php                             24-Jun-2024 06:05               10353
function.imagecharup.php                           24-Jun-2024 06:05               10204
function.imagecolorallocate.php                    24-Jun-2024 06:05               10325
function.imagecolorallocatealpha.php               24-Jun-2024 06:05               18490
function.imagecolorat.php                          24-Jun-2024 06:05               10467
function.imagecolorclosest.php                     24-Jun-2024 06:05               12475
function.imagecolorclosestalpha.php                24-Jun-2024 06:05               12921
function.imagecolorclosesthwb.php                  24-Jun-2024 06:05                6841
function.imagecolordeallocate.php                  24-Jun-2024 06:05                6069
function.imagecolorexact.php                       24-Jun-2024 06:05                8682
function.imagecolorexactalpha.php                  24-Jun-2024 06:05                9612
function.imagecolormatch.php                       24-Jun-2024 06:05                8698
function.imagecolorresolve.php                     24-Jun-2024 06:05                7877
function.imagecolorresolvealpha.php                24-Jun-2024 06:05                8602
function.imagecolorset.php                         24-Jun-2024 06:05                9094
function.imagecolorsforindex.php                   24-Jun-2024 06:05                7575
function.imagecolorstotal.php                      24-Jun-2024 06:05                6028
function.imagecolortransparent.php                 24-Jun-2024 06:05                9339
function.imageconvolution.php                      24-Jun-2024 06:05               12093
function.imagecopy.php                             24-Jun-2024 06:05                9605
function.imagecopymerge.php                        24-Jun-2024 06:05                9886
function.imagecopymergegray.php                    24-Jun-2024 06:05               10393
function.imagecopyresampled.php                    24-Jun-2024 06:05               19549
function.imagecopyresized.php                      24-Jun-2024 06:05               14453
function.imagecreate.php                           24-Jun-2024 06:05                8545
function.imagecreatefromavif.php                   24-Jun-2024 06:05                2990
function.imagecreatefrombmp.php                    24-Jun-2024 06:05                5787
function.imagecreatefromgd.php                     24-Jun-2024 06:05                6430
function.imagecreatefromgd2.php                    24-Jun-2024 06:05                6682
function.imagecreatefromgd2part.php                24-Jun-2024 06:05                9302
function.imagecreatefromgif.php                    24-Jun-2024 06:05                9966
function.imagecreatefromjpeg.php                   24-Jun-2024 06:05                9660
function.imagecreatefrompng.php                    24-Jun-2024 06:05                9585
function.imagecreatefromstring.php                 24-Jun-2024 06:05                8315
function.imagecreatefromtga.php                    24-Jun-2024 06:05                3663
function.imagecreatefromwbmp.php                   24-Jun-2024 06:05                9603
function.imagecreatefromwebp.php                   24-Jun-2024 06:05                5946
function.imagecreatefromxbm.php                    24-Jun-2024 06:05                5782
function.imagecreatefromxpm.php                    24-Jun-2024 06:05                6462
function.imagecreatetruecolor.php                  24-Jun-2024 06:05                7385
function.imagecrop.php                             24-Jun-2024 06:05                8078
function.imagecropauto.php                         24-Jun-2024 06:05               11071
function.imagedashedline.php                       24-Jun-2024 06:05               12963
function.imagedestroy.php                          24-Jun-2024 06:05                5321
function.imageellipse.php                          24-Jun-2024 06:05               10317
function.imagefill.php                             24-Jun-2024 06:05                7897
function.imagefilledarc.php                        24-Jun-2024 06:05               19254
function.imagefilledellipse.php                    24-Jun-2024 06:05               10072
function.imagefilledpolygon.php                    24-Jun-2024 06:05               12384
function.imagefilledrectangle.php                  24-Jun-2024 06:05                8687
function.imagefilltoborder.php                     24-Jun-2024 06:05               11554
function.imagefilter.php                           24-Jun-2024 06:05               34654
function.imageflip.php                             24-Jun-2024 06:05               10079
function.imagefontheight.php                       24-Jun-2024 06:05                6672
function.imagefontwidth.php                        24-Jun-2024 06:05                6668
function.imageftbbox.php                           24-Jun-2024 06:05               14459
function.imagefttext.php                           24-Jun-2024 06:05               16324
function.imagegammacorrect.php                     24-Jun-2024 06:05                6207
function.imagegd.php                               24-Jun-2024 06:05               11075
function.imagegd2.php                              24-Jun-2024 06:05               12020
function.imagegetclip.php                          24-Jun-2024 06:05                6266
function.imagegetinterpolation.php                 24-Jun-2024 06:05                3943
function.imagegif.php                              24-Jun-2024 06:05               17020
function.imagegrabscreen.php                       24-Jun-2024 06:05                4931
function.imagegrabwindow.php                       24-Jun-2024 06:05               10141
function.imageinterlace.php                        24-Jun-2024 06:05                7415
function.imageistruecolor.php                      24-Jun-2024 06:05                7681
function.imagejpeg.php                             24-Jun-2024 06:05               15380
function.imagelayereffect.php                      24-Jun-2024 06:05               12321
function.imageline.php                             24-Jun-2024 06:05               15796
function.imageloadfont.php                         24-Jun-2024 06:05                9639
function.imageopenpolygon.php                      24-Jun-2024 06:05               10772
function.imagepalettecopy.php                      24-Jun-2024 06:05                7551
function.imagepalettetotruecolor.php               24-Jun-2024 06:05               10089
function.imagepng.php                              24-Jun-2024 06:05                9360
function.imagepolygon.php                          24-Jun-2024 06:05               11037
function.imagerectangle.php                        24-Jun-2024 06:05               10864
function.imageresolution.php                       24-Jun-2024 06:05                8139
function.imagerotate.php                           24-Jun-2024 06:05                9499
function.imagesavealpha.php                        24-Jun-2024 06:05                7984
function.imagescale.php                            24-Jun-2024 06:05                7187
function.imagesetbrush.php                         24-Jun-2024 06:05                9643
function.imagesetclip.php                          24-Jun-2024 06:05                5466
function.imagesetinterpolation.php                 24-Jun-2024 06:05               11857
function.imagesetpixel.php                         24-Jun-2024 06:05               11696
function.imagesetstyle.php                         24-Jun-2024 06:05               12593
function.imagesetthickness.php                     24-Jun-2024 06:05                8624
function.imagesettile.php                          24-Jun-2024 06:05                8652
function.imagestring.php                           24-Jun-2024 06:05               10535
function.imagestringup.php                         24-Jun-2024 06:05                9715
function.imagesx.php                               24-Jun-2024 06:05                5256
function.imagesy.php                               24-Jun-2024 06:05                5270
function.imagetruecolortopalette.php               24-Jun-2024 06:05                7181
function.imagettfbbox.php                          24-Jun-2024 06:05               19764
function.imagettftext.php                          24-Jun-2024 06:05               18519
function.imagetypes.php                            24-Jun-2024 06:05                5228
function.imagewbmp.php                             24-Jun-2024 06:05               15586
function.imagewebp.php                             24-Jun-2024 06:05                7790
function.imagexbm.php                              24-Jun-2024 06:05               12267
function.imap-8bit.php                             24-Jun-2024 06:05                3217
function.imap-alerts.php                           24-Jun-2024 06:05                3303
function.imap-append.php                           24-Jun-2024 06:05                9742
function.imap-base64.php                           24-Jun-2024 06:05                3559
function.imap-binary.php                           24-Jun-2024 06:05                3168
function.imap-body.php                             24-Jun-2024 06:05                5704
function.imap-bodystruct.php                       24-Jun-2024 06:05                4805
function.imap-check.php                            24-Jun-2024 06:05                6135
function.imap-clearflag-full.php                   24-Jun-2024 06:05                6557
function.imap-close.php                            24-Jun-2024 06:05                5070
function.imap-create.php                           24-Jun-2024 06:05                1800
function.imap-createmailbox.php                    24-Jun-2024 06:05               13955
function.imap-delete.php                           24-Jun-2024 06:05               10597
function.imap-deletemailbox.php                    24-Jun-2024 06:05                5055
function.imap-errors.php                           24-Jun-2024 06:05                3490
function.imap-expunge.php                          24-Jun-2024 06:05                3701
function.imap-fetch-overview.php                   24-Jun-2024 06:05               11402
function.imap-fetchbody.php                        24-Jun-2024 06:05                6304
function.imap-fetchheader.php                      24-Jun-2024 06:05                5955
function.imap-fetchmime.php                        24-Jun-2024 06:05                6493
function.imap-fetchstructure.php                   24-Jun-2024 06:05                9807
function.imap-fetchtext.php                        24-Jun-2024 06:05                1781
function.imap-gc.php                               24-Jun-2024 06:05                5947
function.imap-get-quota.php                        24-Jun-2024 06:05               12309
function.imap-get-quotaroot.php                    24-Jun-2024 06:05                9256
function.imap-getacl.php                           24-Jun-2024 06:05                6005
function.imap-getmailboxes.php                     24-Jun-2024 06:05               12414
function.imap-getsubscribed.php                    24-Jun-2024 06:05                8137
function.imap-header.php                           24-Jun-2024 06:05                1996
function.imap-headerinfo.php                       24-Jun-2024 06:05               11864
function.imap-headers.php                          24-Jun-2024 06:05                3584
function.imap-is-open.php                          24-Jun-2024 06:05                4264
function.imap-last-error.php                       24-Jun-2024 06:05                3219
function.imap-list.php                             24-Jun-2024 06:05                8927
function.imap-listmailbox.php                      24-Jun-2024 06:05                1786
function.imap-listscan.php                         24-Jun-2024 06:05                7205
function.imap-listsubscribed.php                   24-Jun-2024 06:05                1807
function.imap-lsub.php                             24-Jun-2024 06:05                6241
function.imap-mail-compose.php                     24-Jun-2024 06:05               16617
function.imap-mail-copy.php                        24-Jun-2024 06:05                6383
function.imap-mail-move.php                        24-Jun-2024 06:05                6763
function.imap-mail.php                             24-Jun-2024 06:05                7458
function.imap-mailboxmsginfo.php                   24-Jun-2024 06:05                9366
function.imap-mime-header-decode.php               24-Jun-2024 06:05                6533
function.imap-msgno.php                            24-Jun-2024 06:05                4273
function.imap-mutf7-to-utf8.php                    24-Jun-2024 06:05                3390
function.imap-num-msg.php                          24-Jun-2024 06:05                4130
function.imap-num-recent.php                       24-Jun-2024 06:05                3937
function.imap-open.php                             24-Jun-2024 06:05               21843
function.imap-ping.php                             24-Jun-2024 06:05                5011
function.imap-qprint.php                           24-Jun-2024 06:05                3214
function.imap-rename.php                           24-Jun-2024 06:05                1803
function.imap-renamemailbox.php                    24-Jun-2024 06:05                5717
function.imap-reopen.php                           24-Jun-2024 06:05                8890
function.imap-rfc822-parse-adrlist.php             24-Jun-2024 06:05                7923
function.imap-rfc822-parse-headers.php             24-Jun-2024 06:05                3766
function.imap-rfc822-write-address.php             24-Jun-2024 06:05                5459
function.imap-savebody.php                         24-Jun-2024 06:05                6698
function.imap-scan.php                             24-Jun-2024 06:05                1768
function.imap-scanmailbox.php                      24-Jun-2024 06:05                1798
function.imap-search.php                           24-Jun-2024 06:05               13660
function.imap-set-quota.php                        24-Jun-2024 06:05                6854
function.imap-setacl.php                           24-Jun-2024 06:05                5611
function.imap-setflag-full.php                     24-Jun-2024 06:05                8732
function.imap-sort.php                             24-Jun-2024 06:05                8640
function.imap-status.php                           24-Jun-2024 06:05               10854
function.imap-subscribe.php                        24-Jun-2024 06:05                4563
function.imap-thread.php                           24-Jun-2024 06:05                7989
function.imap-timeout.php                          24-Jun-2024 06:05                4826
function.imap-uid.php                              24-Jun-2024 06:05                4683
function.imap-undelete.php                         24-Jun-2024 06:05                5076
function.imap-unsubscribe.php                      24-Jun-2024 06:05                4640
function.imap-utf7-decode.php                      24-Jun-2024 06:05                3796
function.imap-utf7-encode.php                      24-Jun-2024 06:05                3313
function.imap-utf8-to-mutf7.php                    24-Jun-2024 06:05                3393
function.imap-utf8.php                             24-Jun-2024 06:05                4303
function.implode.php                               24-Jun-2024 06:06                7864
function.in-array.php                              24-Jun-2024 06:06               11923
function.include-once.php                          24-Jun-2024 06:05                2370
function.include.php                               24-Jun-2024 06:05               20130
function.inet-ntop.php                             24-Jun-2024 06:05                6361
function.inet-pton.php                             24-Jun-2024 06:05                4923
function.inflate-add.php                           24-Jun-2024 06:05                6511
function.inflate-get-read-len.php                  24-Jun-2024 06:05                3546
function.inflate-get-status.php                    24-Jun-2024 06:05                3327
function.inflate-init.php                          24-Jun-2024 06:05                7327
function.ini-alter.php                             24-Jun-2024 06:05                1758
function.ini-get-all.php                           24-Jun-2024 06:05               10378
function.ini-get.php                               24-Jun-2024 06:05               10566
function.ini-parse-quantity.php                    24-Jun-2024 06:05                7655
function.ini-restore.php                           24-Jun-2024 06:05                6438
function.ini-set.php                               24-Jun-2024 06:05                6829
function.inotify-add-watch.php                     24-Jun-2024 06:05                4510
function.inotify-init.php                          24-Jun-2024 06:05                9013
function.inotify-queue-len.php                     24-Jun-2024 06:05                3917
function.inotify-read.php                          24-Jun-2024 06:05                4515
function.inotify-rm-watch.php                      24-Jun-2024 06:05                3737
function.intdiv.php                                24-Jun-2024 06:05                7667
function.interface-exists.php                      24-Jun-2024 06:06                5558
function.intl-error-name.php                       24-Jun-2024 06:05                5202
function.intl-get-error-code.php                   24-Jun-2024 06:05                4771
function.intl-get-error-message.php                24-Jun-2024 06:05                4755
function.intl-is-failure.php                       24-Jun-2024 06:05                5667
function.intval.php                                24-Jun-2024 06:06               14013
function.ip2long.php                               24-Jun-2024 06:05                9281
function.iptcembed.php                             24-Jun-2024 06:05               11885
function.iptcparse.php                             24-Jun-2024 06:05                4737
function.is-a.php                                  24-Jun-2024 06:06                6996
function.is-array.php                              24-Jun-2024 06:06                5840
function.is-bool.php                               24-Jun-2024 06:06                5757
function.is-callable.php                           24-Jun-2024 06:06               11243
function.is-countable.php                          24-Jun-2024 06:06                6537
function.is-dir.php                                24-Jun-2024 06:05                6815
function.is-double.php                             24-Jun-2024 06:06                1779
function.is-executable.php                         24-Jun-2024 06:05                6593
function.is-file.php                               24-Jun-2024 06:05                6172
function.is-finite.php                             24-Jun-2024 06:05                6303
function.is-float.php                              24-Jun-2024 06:06                6801
function.is-infinite.php                           24-Jun-2024 06:05                5468
function.is-int.php                                24-Jun-2024 06:06                6800
function.is-integer.php                            24-Jun-2024 06:06                1768
function.is-iterable.php                           24-Jun-2024 06:06                5941
function.is-link.php                               24-Jun-2024 06:05                5856
function.is-long.php                               24-Jun-2024 06:06                1753
function.is-nan.php                                24-Jun-2024 06:05                6614
function.is-null.php                               24-Jun-2024 06:06                6271
function.is-numeric.php                            24-Jun-2024 06:06               12259
function.is-object.php                             24-Jun-2024 06:06                7374
function.is-readable.php                           24-Jun-2024 06:05                6406
function.is-real.php                               24-Jun-2024 06:06                1961
function.is-resource.php                           24-Jun-2024 06:06                5267
function.is-scalar.php                             24-Jun-2024 06:06                8522
function.is-soap-fault.php                         24-Jun-2024 06:06                8278
function.is-string.php                             24-Jun-2024 06:06                6844
function.is-subclass-of.php                        24-Jun-2024 06:06               12594
function.is-tainted.php                            24-Jun-2024 06:05                2426
function.is-uploaded-file.php                      24-Jun-2024 06:05                6964
function.is-writable.php                           24-Jun-2024 06:05                6074
function.is-writeable.php                          24-Jun-2024 06:05                1796
function.isset.php                                 24-Jun-2024 06:06               16519
function.iterator-apply.php                        24-Jun-2024 06:05                6890
function.iterator-count.php                        24-Jun-2024 06:05                8794
function.iterator-to-array.php                     24-Jun-2024 06:05                8112
function.jddayofweek.php                           24-Jun-2024 06:05                3946
function.jdmonthname.php                           24-Jun-2024 06:05                5140
function.jdtofrench.php                            24-Jun-2024 06:05                3312
function.jdtogregorian.php                         24-Jun-2024 06:05                3316
function.jdtojewish.php                            24-Jun-2024 06:05                7689
function.jdtojulian.php                            24-Jun-2024 06:05                3350
function.jdtounix.php                              24-Jun-2024 06:05                4562
function.jewishtojd.php                            24-Jun-2024 06:05                4770
function.join.php                                  24-Jun-2024 06:06                1708
function.jpeg2wbmp.php                             24-Jun-2024 06:05                6814
function.json-decode.php                           24-Jun-2024 06:05               20645
function.json-encode.php                           24-Jun-2024 06:05               31614
function.json-last-error-msg.php                   24-Jun-2024 06:05                3194
function.json-last-error.php                       24-Jun-2024 06:05               14312
function.json-validate.php                         24-Jun-2024 06:05                8947
function.juliantojd.php                            24-Jun-2024 06:05                4741
function.key-exists.php                            24-Jun-2024 06:06                1774
function.key.php                                   24-Jun-2024 06:06                8186
function.krsort.php                                24-Jun-2024 06:06                9104
function.ksort.php                                 24-Jun-2024 06:06               11106
function.lcfirst.php                               24-Jun-2024 06:06                5989
function.lcg-value.php                             24-Jun-2024 06:05                5365
function.lchgrp.php                                24-Jun-2024 06:05                6248
function.lchown.php                                24-Jun-2024 06:05                6068
function.ldap-8859-to-t61.php                      24-Jun-2024 06:05                3479
function.ldap-add-ext.php                          24-Jun-2024 06:05                5953
function.ldap-add.php                              24-Jun-2024 06:05               10682
function.ldap-bind-ext.php                         24-Jun-2024 06:05                6246
function.ldap-bind.php                             24-Jun-2024 06:05               10042
function.ldap-close.php                            24-Jun-2024 06:05                1753
function.ldap-compare.php                          24-Jun-2024 06:05               10651
function.ldap-connect-wallet.php                   24-Jun-2024 06:05                4554
function.ldap-connect.php                          24-Jun-2024 06:05               10015
function.ldap-control-paged-result-response.php    24-Jun-2024 06:05                6040
function.ldap-control-paged-result.php             24-Jun-2024 06:05               14763
function.ldap-count-entries.php                    24-Jun-2024 06:05                5918
function.ldap-count-references.php                 24-Jun-2024 06:05                4908
function.ldap-delete-ext.php                       24-Jun-2024 06:05                5474
function.ldap-delete.php                           24-Jun-2024 06:05                5497
function.ldap-dn2ufn.php                           24-Jun-2024 06:05                2806
function.ldap-err2str.php                          24-Jun-2024 06:05                4823
function.ldap-errno.php                            24-Jun-2024 06:05                7726
function.ldap-error.php                            24-Jun-2024 06:05                4693
function.ldap-escape.php                           24-Jun-2024 06:05                6504
function.ldap-exop-passwd.php                      24-Jun-2024 06:05               10881
function.ldap-exop-refresh.php                     24-Jun-2024 06:05                5319
function.ldap-exop-sync.php                        24-Jun-2024 06:05                5712
function.ldap-exop-whoami.php                      24-Jun-2024 06:05                4080
function.ldap-exop.php                             24-Jun-2024 06:05               12945
function.ldap-explode-dn.php                       24-Jun-2024 06:05                3742
function.ldap-first-attribute.php                  24-Jun-2024 06:05                5680
function.ldap-first-entry.php                      24-Jun-2024 06:05                5995
function.ldap-first-reference.php                  24-Jun-2024 06:05                2425
function.ldap-free-result.php                      24-Jun-2024 06:05                4271
function.ldap-get-attributes.php                   24-Jun-2024 06:05                8478
function.ldap-get-dn.php                           24-Jun-2024 06:05                4458
function.ldap-get-entries.php                      24-Jun-2024 06:05                6437
function.ldap-get-option.php                       24-Jun-2024 06:05               16964
function.ldap-get-values-len.php                   24-Jun-2024 06:05                5720
function.ldap-get-values.php                       24-Jun-2024 06:05                9040
function.ldap-list.php                             24-Jun-2024 06:05               15836
function.ldap-mod-add.php                          24-Jun-2024 06:05                6990
function.ldap-mod-del.php                          24-Jun-2024 06:05                6508
function.ldap-mod-replace.php                      24-Jun-2024 06:05                6953
function.ldap-mod_add-ext.php                      24-Jun-2024 06:05                5931
function.ldap-mod_del-ext.php                      24-Jun-2024 06:05                5929
function.ldap-mod_replace-ext.php                  24-Jun-2024 06:05                6032
function.ldap-modify-batch.php                     24-Jun-2024 06:05               19268
function.ldap-modify.php                           24-Jun-2024 06:05                2161
function.ldap-next-attribute.php                   24-Jun-2024 06:05                5438
function.ldap-next-entry.php                       24-Jun-2024 06:05                6047
function.ldap-next-reference.php                   24-Jun-2024 06:05                2355
function.ldap-parse-exop.php                       24-Jun-2024 06:05                6188
function.ldap-parse-reference.php                  24-Jun-2024 06:05                2491
function.ldap-parse-result.php                     24-Jun-2024 06:05               10164
function.ldap-read.php                             24-Jun-2024 06:05               13188
function.ldap-rename-ext.php                       24-Jun-2024 06:05                6291
function.ldap-rename.php                           24-Jun-2024 06:05                7446
function.ldap-sasl-bind.php                        24-Jun-2024 06:05                7310
function.ldap-search.php                           24-Jun-2024 06:05               16093
function.ldap-set-option.php                       24-Jun-2024 06:05               19644
function.ldap-set-rebind-proc.php                  24-Jun-2024 06:05                3359
function.ldap-sort.php                             24-Jun-2024 06:05                7410
function.ldap-start-tls.php                        24-Jun-2024 06:05                2102
function.ldap-t61-to-8859.php                      24-Jun-2024 06:05                2252
function.ldap-unbind.php                           24-Jun-2024 06:05                3994
function.levenshtein.php                           24-Jun-2024 06:06               12454
function.libxml-clear-errors.php                   24-Jun-2024 06:06                2958
function.libxml-disable-entity-loader.php          24-Jun-2024 06:06                5196
function.libxml-get-errors.php                     24-Jun-2024 06:06               10807
function.libxml-get-external-entity-loader.php     24-Jun-2024 06:06                3587
function.libxml-get-last-error.php                 24-Jun-2024 06:06                3296
function.libxml-set-external-entity-loader.php     24-Jun-2024 06:06               10726
function.libxml-set-streams-context.php            24-Jun-2024 06:06                5177
function.libxml-use-internal-errors.php            24-Jun-2024 06:06                6871
function.link.php                                  24-Jun-2024 06:05                6060
function.linkinfo.php                              24-Jun-2024 06:05                4748
function.list.php                                  24-Jun-2024 06:06               17135
function.localeconv.php                            24-Jun-2024 06:06                9581
function.localtime.php                             24-Jun-2024 06:05                9297
function.log.php                                   24-Jun-2024 06:05                4096
function.log10.php                                 24-Jun-2024 06:05                2769
function.log1p.php                                 24-Jun-2024 06:05                3581
function.long2ip.php                               24-Jun-2024 06:05                4529
function.lstat.php                                 24-Jun-2024 06:05                6681
function.ltrim.php                                 24-Jun-2024 06:06                9728
function.lzf-compress.php                          24-Jun-2024 06:05                3057
function.lzf-decompress.php                        24-Jun-2024 06:05                3143
function.lzf-optimized-for.php                     24-Jun-2024 06:05                2322
function.mail.php                                  24-Jun-2024 06:05               26515
function.mailparse-determine-best-xfer-encoding..> 24-Jun-2024 06:05                4430
function.mailparse-msg-create.php                  24-Jun-2024 06:05                3494
function.mailparse-msg-extract-part-file.php       24-Jun-2024 06:05                5542
function.mailparse-msg-extract-part.php            24-Jun-2024 06:05                4266
function.mailparse-msg-extract-whole-part-file.php 24-Jun-2024 06:05                4265
function.mailparse-msg-free.php                    24-Jun-2024 06:05                3728
function.mailparse-msg-get-part-data.php           24-Jun-2024 06:05                2655
function.mailparse-msg-get-part.php                24-Jun-2024 06:05                2951
function.mailparse-msg-get-structure.php           24-Jun-2024 06:05                2668
function.mailparse-msg-parse-file.php              24-Jun-2024 06:05                4404
function.mailparse-msg-parse.php                   24-Jun-2024 06:05                3660
function.mailparse-rfc822-parse-addresses.php      24-Jun-2024 06:05                5847
function.mailparse-stream-encode.php               24-Jun-2024 06:05                6076
function.mailparse-uudecode-all.php                24-Jun-2024 06:05                7113
function.max.php                                   24-Jun-2024 06:05               12438
function.mb-check-encoding.php                     24-Jun-2024 06:05                5720
function.mb-chr.php                                24-Jun-2024 06:05                7315
function.mb-convert-case.php                       24-Jun-2024 06:05               12198
function.mb-convert-encoding.php                   24-Jun-2024 06:05               12258
function.mb-convert-kana.php                       24-Jun-2024 06:05               10422
function.mb-convert-variables.php                  24-Jun-2024 06:05                6920
function.mb-decode-mimeheader.php                  24-Jun-2024 06:05                3403
function.mb-decode-numericentity.php               24-Jun-2024 06:05               34279
function.mb-detect-encoding.php                    24-Jun-2024 06:05               16965
function.mb-detect-order.php                       24-Jun-2024 06:05                9371
function.mb-encode-mimeheader.php                  24-Jun-2024 06:05               10146
function.mb-encode-numericentity.php               24-Jun-2024 06:05               13040
function.mb-encoding-aliases.php                   24-Jun-2024 06:05                6572
function.mb-ereg-match.php                         24-Jun-2024 06:05                5830
function.mb-ereg-replace-callback.php              24-Jun-2024 06:05               12824
function.mb-ereg-replace.php                       24-Jun-2024 06:05                7516
function.mb-ereg-search-getpos.php                 24-Jun-2024 06:05                4136
function.mb-ereg-search-getregs.php                24-Jun-2024 06:05                4584
function.mb-ereg-search-init.php                   24-Jun-2024 06:05                6361
function.mb-ereg-search-pos.php                    24-Jun-2024 06:05                6289
function.mb-ereg-search-regs.php                   24-Jun-2024 06:05                6041
function.mb-ereg-search-setpos.php                 24-Jun-2024 06:05                4783
function.mb-ereg-search.php                        24-Jun-2024 06:05                5952
function.mb-ereg.php                               24-Jun-2024 06:05                6864
function.mb-eregi-replace.php                      24-Jun-2024 06:05                7399
function.mb-eregi.php                              24-Jun-2024 06:05                6909
function.mb-get-info.php                           24-Jun-2024 06:05                6534
function.mb-http-input.php                         24-Jun-2024 06:05                5331
function.mb-http-output.php                        24-Jun-2024 06:05                5273
function.mb-internal-encoding.php                  24-Jun-2024 06:05                7440
function.mb-language.php                           24-Jun-2024 06:05                6719
function.mb-list-encodings.php                     24-Jun-2024 06:05                5203
function.mb-ord.php                                24-Jun-2024 06:05                7092
function.mb-output-handler.php                     24-Jun-2024 06:05                5425
function.mb-parse-str.php                          24-Jun-2024 06:05                4918
function.mb-preferred-mime-name.php                24-Jun-2024 06:05                4704
function.mb-regex-encoding.php                     24-Jun-2024 06:05                4847
function.mb-regex-set-options.php                  24-Jun-2024 06:05                9022
function.mb-scrub.php                              24-Jun-2024 06:05                4320
function.mb-send-mail.php                          24-Jun-2024 06:05               10417
function.mb-split.php                              24-Jun-2024 06:05                4998
function.mb-str-pad.php                            24-Jun-2024 06:05                8811
function.mb-str-split.php                          24-Jun-2024 06:05                5585
function.mb-strcut.php                             24-Jun-2024 06:05                7772
function.mb-strimwidth.php                         24-Jun-2024 06:05                8381
function.mb-stripos.php                            24-Jun-2024 06:05                6755
function.mb-stristr.php                            24-Jun-2024 06:05                7008
function.mb-strlen.php                             24-Jun-2024 06:05                5427
function.mb-strpos.php                             24-Jun-2024 06:05                6861
function.mb-strrchr.php                            24-Jun-2024 06:05                6845
function.mb-strrichr.php                           24-Jun-2024 06:05                6965
function.mb-strripos.php                           24-Jun-2024 06:05                6630
function.mb-strrpos.php                            24-Jun-2024 06:05                7181
function.mb-strstr.php                             24-Jun-2024 06:05                6782
function.mb-strtolower.php                         24-Jun-2024 06:05                7421
function.mb-strtoupper.php                         24-Jun-2024 06:05                7422
function.mb-strwidth.php                           24-Jun-2024 06:05                9430
function.mb-substitute-character.php               24-Jun-2024 06:05                7633
function.mb-substr-count.php                       24-Jun-2024 06:05                6338
function.mb-substr.php                             24-Jun-2024 06:05                6850
function.mcrypt-create-iv.php                      24-Jun-2024 06:05                7039
function.mcrypt-decrypt.php                        24-Jun-2024 06:05                5998
function.mcrypt-enc-get-algorithms-name.php        24-Jun-2024 06:05                5409
function.mcrypt-enc-get-block-size.php             24-Jun-2024 06:05                3091
function.mcrypt-enc-get-iv-size.php                24-Jun-2024 06:05                3216
function.mcrypt-enc-get-key-size.php               24-Jun-2024 06:05                3095
function.mcrypt-enc-get-modes-name.php             24-Jun-2024 06:05                5311
function.mcrypt-enc-get-supported-key-sizes.php    24-Jun-2024 06:05                5093
function.mcrypt-enc-is-block-algorithm-mode.php    24-Jun-2024 06:05                3665
function.mcrypt-enc-is-block-algorithm.php         24-Jun-2024 06:05                3386
function.mcrypt-enc-is-block-mode.php              24-Jun-2024 06:05                3493
function.mcrypt-enc-self-test.php                  24-Jun-2024 06:05                3177
function.mcrypt-encrypt.php                        24-Jun-2024 06:05               13960
function.mcrypt-generic-deinit.php                 24-Jun-2024 06:05                4122
function.mcrypt-generic-init.php                   24-Jun-2024 06:05                5320
function.mcrypt-generic.php                        24-Jun-2024 06:05                5958
function.mcrypt-get-block-size.php                 24-Jun-2024 06:05                6748
function.mcrypt-get-cipher-name.php                24-Jun-2024 06:05                5126
function.mcrypt-get-iv-size.php                    24-Jun-2024 06:05                6563
function.mcrypt-get-key-size.php                   24-Jun-2024 06:05                6903
function.mcrypt-list-algorithms.php                24-Jun-2024 06:05                4868
function.mcrypt-list-modes.php                     24-Jun-2024 06:05                4735
function.mcrypt-module-close.php                   24-Jun-2024 06:05                3558
function.mcrypt-module-get-algo-block-size.php     24-Jun-2024 06:05                3607
function.mcrypt-module-get-algo-key-size.php       24-Jun-2024 06:05                3674
function.mcrypt-module-get-supported-key-sizes.php 24-Jun-2024 06:05                4746
function.mcrypt-module-is-block-algorithm-mode.php 24-Jun-2024 06:05                4600
function.mcrypt-module-is-block-algorithm.php      24-Jun-2024 06:05                4141
function.mcrypt-module-is-block-mode.php           24-Jun-2024 06:05                4629
function.mcrypt-module-open.php                    24-Jun-2024 06:05               14157
function.mcrypt-module-self-test.php               24-Jun-2024 06:05                5145
function.md5-file.php                              24-Jun-2024 06:06                5303
function.md5.php                                   24-Jun-2024 06:06                6067
function.mdecrypt-generic.php                      24-Jun-2024 06:05               10945
function.memcache-debug.php                        24-Jun-2024 06:05                3811
function.memory-get-peak-usage.php                 24-Jun-2024 06:05                3782
function.memory-get-usage.php                      24-Jun-2024 06:05                5653
function.memory-reset-peak-usage.php               24-Jun-2024 06:05                5061
function.metaphone.php                             24-Jun-2024 06:06                8345
function.method-exists.php                         24-Jun-2024 06:06                6780
function.mhash-count.php                           24-Jun-2024 06:05                4759
function.mhash-get-block-size.php                  24-Jun-2024 06:05                4671
function.mhash-get-hash-name.php                   24-Jun-2024 06:05                4604
function.mhash-keygen-s2k.php                      24-Jun-2024 06:05                5899
function.mhash.php                                 24-Jun-2024 06:05                5001
function.microtime.php                             24-Jun-2024 06:05                8332
function.mime-content-type.php                     24-Jun-2024 06:05                5259
function.min.php                                   24-Jun-2024 06:05               12998
function.mkdir.php                                 24-Jun-2024 06:05               10083
function.mktime.php                                24-Jun-2024 06:05               19199
function.money-format.php                          24-Jun-2024 06:06               18898
function.mongodb.bson-fromjson.php                 24-Jun-2024 06:05                5937
function.mongodb.bson-fromphp.php                  24-Jun-2024 06:05                6264
function.mongodb.bson-tocanonicalextendedjson.php  24-Jun-2024 06:05               13993
function.mongodb.bson-tojson.php                   24-Jun-2024 06:05               15065
function.mongodb.bson-tophp.php                    24-Jun-2024 06:05                9285
function.mongodb.bson-torelaxedextendedjson.php    24-Jun-2024 06:05               13690
function.mongodb.driver.monitoring.addsubscribe..> 24-Jun-2024 06:05                5167
function.mongodb.driver.monitoring.removesubscr..> 24-Jun-2024 06:05                5009
function.move-uploaded-file.php                    24-Jun-2024 06:05                8754
function.mqseries-back.php                         24-Jun-2024 06:05                6548
function.mqseries-begin.php                        24-Jun-2024 06:05                7498
function.mqseries-close.php                        24-Jun-2024 06:05                6719
function.mqseries-cmit.php                         24-Jun-2024 06:05                6463
function.mqseries-conn.php                         24-Jun-2024 06:05                6044
function.mqseries-connx.php                        24-Jun-2024 06:05               12758
function.mqseries-disc.php                         24-Jun-2024 06:05                5746
function.mqseries-get.php                          24-Jun-2024 06:05               12364
function.mqseries-inq.php                          24-Jun-2024 06:05                9422
function.mqseries-open.php                         24-Jun-2024 06:05                7355
function.mqseries-put.php                          24-Jun-2024 06:05               12643
function.mqseries-put1.php                         24-Jun-2024 06:05                6376
function.mqseries-set.php                          24-Jun-2024 06:05                6302
function.mqseries-strerror.php                     24-Jun-2024 06:05                4322
function.msg-get-queue.php                         24-Jun-2024 06:05                5720
function.msg-queue-exists.php                      24-Jun-2024 06:05                3480
function.msg-receive.php                           24-Jun-2024 06:05               11522
function.msg-remove-queue.php                      24-Jun-2024 06:05                4687
function.msg-send.php                              24-Jun-2024 06:05                9646
function.msg-set-queue.php                         24-Jun-2024 06:05                5345
function.msg-stat-queue.php                        24-Jun-2024 06:05                6717
function.mt-getrandmax.php                         24-Jun-2024 06:05                3445
function.mt-rand.php                               24-Jun-2024 06:05               10718
function.mt-srand.php                              24-Jun-2024 06:05                8877
function.mysql-affected-rows.php                   24-Jun-2024 06:05               12204
function.mysql-client-encoding.php                 24-Jun-2024 06:05                6263
function.mysql-close.php                           24-Jun-2024 06:05                7519
function.mysql-connect.php                         24-Jun-2024 06:05               17190
function.mysql-create-db.php                       24-Jun-2024 06:05                8566
function.mysql-data-seek.php                       24-Jun-2024 06:05               12097
function.mysql-db-name.php                         24-Jun-2024 06:05                7901
function.mysql-db-query.php                        24-Jun-2024 06:05               10015
function.mysql-drop-db.php                         24-Jun-2024 06:05                7859
function.mysql-errno.php                           24-Jun-2024 06:05                8234
function.mysql-error.php                           24-Jun-2024 06:05                8209
function.mysql-escape-string.php                   24-Jun-2024 06:05                6635
function.mysql-fetch-array.php                     24-Jun-2024 06:05               15733
function.mysql-fetch-assoc.php                     24-Jun-2024 06:05               11562
function.mysql-fetch-field.php                     24-Jun-2024 06:05               13053
function.mysql-fetch-lengths.php                   24-Jun-2024 06:05                7714
function.mysql-fetch-object.php                    24-Jun-2024 06:05               12028
function.mysql-fetch-row.php                       24-Jun-2024 06:05                7841
function.mysql-field-flags.php                     24-Jun-2024 06:05                8666
function.mysql-field-len.php                       24-Jun-2024 06:05                7102
function.mysql-field-name.php                      24-Jun-2024 06:05                9199
function.mysql-field-seek.php                      24-Jun-2024 06:05                5199
function.mysql-field-table.php                     24-Jun-2024 06:05                7727
function.mysql-field-type.php                      24-Jun-2024 06:05               11747
function.mysql-free-result.php                     24-Jun-2024 06:05                7830
function.mysql-get-client-info.php                 24-Jun-2024 06:05                5286
function.mysql-get-host-info.php                   24-Jun-2024 06:05                7147
function.mysql-get-proto-info.php                  24-Jun-2024 06:05                6738
function.mysql-get-server-info.php                 24-Jun-2024 06:05                7230
function.mysql-info.php                            24-Jun-2024 06:05                6504
function.mysql-insert-id.php                       24-Jun-2024 06:05                8377
function.mysql-list-dbs.php                        24-Jun-2024 06:05                8898
function.mysql-list-fields.php                     24-Jun-2024 06:05                9034
function.mysql-list-processes.php                  24-Jun-2024 06:05                7676
function.mysql-list-tables.php                     24-Jun-2024 06:05                9671
function.mysql-num-fields.php                      24-Jun-2024 06:05                6688
function.mysql-num-rows.php                        24-Jun-2024 06:05                8212
function.mysql-pconnect.php                        24-Jun-2024 06:05                8407
function.mysql-ping.php                            24-Jun-2024 06:05                7974
function.mysql-query.php                           24-Jun-2024 06:05               13870
function.mysql-real-escape-string.php              24-Jun-2024 06:05               15296
function.mysql-result.php                          24-Jun-2024 06:05                9655
function.mysql-select-db.php                       24-Jun-2024 06:05                7765
function.mysql-set-charset.php                     24-Jun-2024 06:05                5938
function.mysql-stat.php                            24-Jun-2024 06:05                9370
function.mysql-tablename.php                       24-Jun-2024 06:05                8180
function.mysql-thread-id.php                       24-Jun-2024 06:05                6691
function.mysql-unbuffered-query.php                24-Jun-2024 06:05                7200
function.mysql-xdevapi-expression.php              24-Jun-2024 06:05                4882
function.mysql-xdevapi-getsession.php              24-Jun-2024 06:05               13129
function.mysqli-connect.php                        24-Jun-2024 06:05                2442
function.mysqli-escape-string.php                  24-Jun-2024 06:05                2003
function.mysqli-execute.php                        24-Jun-2024 06:05                2574
function.mysqli-get-client-stats.php               24-Jun-2024 06:05                8507
function.mysqli-get-links-stats.php                24-Jun-2024 06:05                3485
function.mysqli-report.php                         24-Jun-2024 06:05                1804
function.mysqli-set-opt.php                        24-Jun-2024 06:05                1919
function.natcasesort.php                           24-Jun-2024 06:06                8010
function.natsort.php                               24-Jun-2024 06:06               11272
function.net-get-interfaces.php                    24-Jun-2024 06:05                4809
function.next.php                                  24-Jun-2024 06:06                9924
function.ngettext.php                              24-Jun-2024 06:05                5869
function.nl-langinfo.php                           24-Jun-2024 06:06               18388
function.nl2br.php                                 24-Jun-2024 06:06                6991
function.number-format.php                         24-Jun-2024 06:06                8825
function.oauth-get-sbs.php                         24-Jun-2024 06:06                3238
function.oauth-urlencode.php                       24-Jun-2024 06:06                2686
function.ob-clean.php                              24-Jun-2024 06:05                4684
function.ob-end-clean.php                          24-Jun-2024 06:05                5875
function.ob-end-flush.php                          24-Jun-2024 06:05                5743
function.ob-flush.php                              24-Jun-2024 06:05                4806
function.ob-get-clean.php                          24-Jun-2024 06:05                6938
function.ob-get-contents.php                       24-Jun-2024 06:05                4864
function.ob-get-flush.php                          24-Jun-2024 06:05                6734
function.ob-get-length.php                         24-Jun-2024 06:05                4829
function.ob-get-level.php                          24-Jun-2024 06:05                3715
function.ob-get-status.php                         24-Jun-2024 06:05               10156
function.ob-gzhandler.php                          24-Jun-2024 06:05                6080
function.ob-iconv-handler.php                      24-Jun-2024 06:05                5350
function.ob-implicit-flush.php                     24-Jun-2024 06:05                5324
function.ob-list-handlers.php                      24-Jun-2024 06:05               13949
function.ob-start.php                              24-Jun-2024 06:05               16128
function.ob-tidyhandler.php                        24-Jun-2024 06:05                4471
function.oci-bind-array-by-name.php                24-Jun-2024 06:05               13983
function.oci-bind-by-name.php                      24-Jun-2024 06:05               79376
function.oci-cancel.php                            24-Jun-2024 06:05                2762
function.oci-client-version.php                    24-Jun-2024 06:05                4070
function.oci-close.php                             24-Jun-2024 06:05               18635
function.oci-commit.php                            24-Jun-2024 06:05               11076
function.oci-connect.php                           24-Jun-2024 06:05               35797
function.oci-define-by-name.php                    24-Jun-2024 06:05               24037
function.oci-error.php                             24-Jun-2024 06:05               11976
function.oci-execute.php                           24-Jun-2024 06:05               21438
function.oci-fetch-all.php                         24-Jun-2024 06:05               24830
function.oci-fetch-array.php                       24-Jun-2024 06:05               64577
function.oci-fetch-assoc.php                       24-Jun-2024 06:05                8962
function.oci-fetch-object.php                      24-Jun-2024 06:05               18355
function.oci-fetch-row.php                         24-Jun-2024 06:05                8903
function.oci-fetch.php                             24-Jun-2024 06:05               13601
function.oci-field-is-null.php                     24-Jun-2024 06:05                7949
function.oci-field-name.php                        24-Jun-2024 06:05                9872
function.oci-field-precision.php                   24-Jun-2024 06:05                8730
function.oci-field-scale.php                       24-Jun-2024 06:05                8708
function.oci-field-size.php                        24-Jun-2024 06:05               10324
function.oci-field-type-raw.php                    24-Jun-2024 06:05                7985
function.oci-field-type.php                        24-Jun-2024 06:05               10726
function.oci-free-descriptor.php                   24-Jun-2024 06:05                3591
function.oci-free-statement.php                    24-Jun-2024 06:05                3042
function.oci-get-implicit-resultset.php            24-Jun-2024 06:05               28276
function.oci-internal-debug.php                    24-Jun-2024 06:05                3130
function.oci-lob-copy.php                          24-Jun-2024 06:05                4666
function.oci-lob-is-equal.php                      24-Jun-2024 06:05                3341
function.oci-new-collection.php                    24-Jun-2024 06:05                5181
function.oci-new-connect.php                       24-Jun-2024 06:05               17055
function.oci-new-cursor.php                        24-Jun-2024 06:05                7822
function.oci-new-descriptor.php                    24-Jun-2024 06:05               18312
function.oci-num-fields.php                        24-Jun-2024 06:05                6986
function.oci-num-rows.php                          24-Jun-2024 06:05                7998
function.oci-parse.php                             24-Jun-2024 06:05               12640
function.oci-password-change.php                   24-Jun-2024 06:05               13613
function.oci-pconnect.php                          24-Jun-2024 06:05               15453
function.oci-register-taf-callback.php             24-Jun-2024 06:05                5852
function.oci-result.php                            24-Jun-2024 06:05                8707
function.oci-rollback.php                          24-Jun-2024 06:05               14401
function.oci-server-version.php                    24-Jun-2024 06:05                4831
function.oci-set-action.php                        24-Jun-2024 06:05                8628
function.oci-set-call-timout.php                   24-Jun-2024 06:05                6039
function.oci-set-client-identifier.php             24-Jun-2024 06:05                8289
function.oci-set-client-info.php                   24-Jun-2024 06:05                8550
function.oci-set-db-operation.php                  24-Jun-2024 06:05                7960
function.oci-set-edition.php                       24-Jun-2024 06:05                9810
function.oci-set-module-name.php                   24-Jun-2024 06:05                8744
function.oci-set-prefetch-lob.php                  24-Jun-2024 06:05                8951
function.oci-set-prefetch.php                      24-Jun-2024 06:05               20810
function.oci-statement-type.php                    24-Jun-2024 06:05                7123
function.oci-unregister-taf-callback.php           24-Jun-2024 06:05                3703
function.ocibindbyname.php                         24-Jun-2024 06:05                2022
function.ocicancel.php                             24-Jun-2024 06:05                1964
function.ocicloselob.php                           24-Jun-2024 06:05                1963
function.ocicollappend.php                         24-Jun-2024 06:05                2028
function.ocicollassign.php                         24-Jun-2024 06:05                2033
function.ocicollassignelem.php                     24-Jun-2024 06:05                2078
function.ocicollgetelem.php                        24-Jun-2024 06:05                2045
function.ocicollmax.php                            24-Jun-2024 06:05                1997
function.ocicollsize.php                           24-Jun-2024 06:05                2000
function.ocicolltrim.php                           24-Jun-2024 06:05                2010
function.ocicolumnisnull.php                       24-Jun-2024 06:05                2034
function.ocicolumnname.php                         24-Jun-2024 06:05                2026
function.ocicolumnprecision.php                    24-Jun-2024 06:05                2069
function.ocicolumnscale.php                        24-Jun-2024 06:05                2033
function.ocicolumnsize.php                         24-Jun-2024 06:05                2014
function.ocicolumntype.php                         24-Jun-2024 06:05                2018
function.ocicolumntyperaw.php                      24-Jun-2024 06:05                2041
function.ocicommit.php                             24-Jun-2024 06:05                1978
function.ocidefinebyname.php                       24-Jun-2024 06:05                2024
function.ocierror.php                              24-Jun-2024 06:05                1955
function.ociexecute.php                            24-Jun-2024 06:05                1959
function.ocifetch.php                              24-Jun-2024 06:05                1949
function.ocifetchinto.php                          24-Jun-2024 06:05                2685
function.ocifetchstatement.php                     24-Jun-2024 06:05                2042
function.ocifreecollection.php                     24-Jun-2024 06:05                2060
function.ocifreecursor.php                         24-Jun-2024 06:05                2032
function.ocifreedesc.php                           24-Jun-2024 06:05                1976
function.ocifreestatement.php                      24-Jun-2024 06:05                2051
function.ociinternaldebug.php                      24-Jun-2024 06:05                2065
function.ociloadlob.php                            24-Jun-2024 06:05                1961
function.ocilogoff.php                             24-Jun-2024 06:05                1948
function.ocilogon.php                              24-Jun-2024 06:05                1963
function.ocinewcollection.php                      24-Jun-2024 06:05                2049
function.ocinewcursor.php                          24-Jun-2024 06:05                2017
function.ocinewdescriptor.php                      24-Jun-2024 06:05                2039
function.ocinlogon.php                             24-Jun-2024 06:05                1988
function.ocinumcols.php                            24-Jun-2024 06:05                1973
function.ociparse.php                              24-Jun-2024 06:05                1943
function.ociplogon.php                             24-Jun-2024 06:05                1958
function.ociresult.php                             24-Jun-2024 06:05                1956
function.ocirollback.php                           24-Jun-2024 06:05                1978
function.ocirowcount.php                           24-Jun-2024 06:05                1980
function.ocisavelob.php                            24-Jun-2024 06:05                1961
function.ocisavelobfile.php                        24-Jun-2024 06:05                1999
function.ociserverversion.php                      24-Jun-2024 06:05                2053
function.ocisetprefetch.php                        24-Jun-2024 06:05                2039
function.ocistatementtype.php                      24-Jun-2024 06:05                2059
function.ociwritelobtofile.php                     24-Jun-2024 06:05                2040
function.ociwritetemporarylob.php                  24-Jun-2024 06:05                2063
function.octdec.php                                24-Jun-2024 06:05                6011
function.odbc-autocommit.php                       24-Jun-2024 06:05                5561
function.odbc-binmode.php                          24-Jun-2024 06:05                7345
function.odbc-close-all.php                        24-Jun-2024 06:05                2643
function.odbc-close.php                            24-Jun-2024 06:05                2974
function.odbc-columnprivileges.php                 24-Jun-2024 06:05                8947
function.odbc-columns.php                          24-Jun-2024 06:05               11935
function.odbc-commit.php                           24-Jun-2024 06:05                2809
function.odbc-connect.php                          24-Jun-2024 06:05                8914
function.odbc-connection-string-is-quoted.php      24-Jun-2024 06:05                3756
function.odbc-connection-string-quote.php          24-Jun-2024 06:05                5834
function.odbc-connection-string-should-quote.php   24-Jun-2024 06:05                4020
function.odbc-cursor.php                           24-Jun-2024 06:05                2796
function.odbc-data-source.php                      24-Jun-2024 06:05                6326
function.odbc-do.php                               24-Jun-2024 06:05                1733
function.odbc-error.php                            24-Jun-2024 06:05                4267
function.odbc-errormsg.php                         24-Jun-2024 06:05                4320
function.odbc-exec.php                             24-Jun-2024 06:05                4174
function.odbc-execute.php                          24-Jun-2024 06:05                7252
function.odbc-fetch-array.php                      24-Jun-2024 06:05                4526
function.odbc-fetch-into.php                       24-Jun-2024 06:05                5316
function.odbc-fetch-object.php                     24-Jun-2024 06:05                4549
function.odbc-fetch-row.php                        24-Jun-2024 06:05                5043
function.odbc-field-len.php                        24-Jun-2024 06:05                3597
function.odbc-field-name.php                       24-Jun-2024 06:05                3167
function.odbc-field-num.php                        24-Jun-2024 06:05                3184
function.odbc-field-precision.php                  24-Jun-2024 06:05                2291
function.odbc-field-scale.php                      24-Jun-2024 06:05                3198
function.odbc-field-type.php                       24-Jun-2024 06:05                3170
function.odbc-foreignkeys.php                      24-Jun-2024 06:05                9213
function.odbc-free-result.php                      24-Jun-2024 06:05                3516
function.odbc-gettypeinfo.php                      24-Jun-2024 06:05                4670
function.odbc-longreadlen.php                      24-Jun-2024 06:05                4009
function.odbc-next-result.php                      24-Jun-2024 06:05                9078
function.odbc-num-fields.php                       24-Jun-2024 06:05                2697
function.odbc-num-rows.php                         24-Jun-2024 06:05                3357
function.odbc-pconnect.php                         24-Jun-2024 06:05                4885
function.odbc-prepare.php                          24-Jun-2024 06:05                6580
function.odbc-primarykeys.php                      24-Jun-2024 06:05                8047
function.odbc-procedurecolumns.php                 24-Jun-2024 06:05               12162
function.odbc-procedures.php                       24-Jun-2024 06:05                9892
function.odbc-result-all.php                       24-Jun-2024 06:05                4333
function.odbc-result.php                           24-Jun-2024 06:05                5966
function.odbc-rollback.php                         24-Jun-2024 06:05                2828
function.odbc-setoption.php                        24-Jun-2024 06:05                7253
function.odbc-specialcolumns.php                   24-Jun-2024 06:05                8083
function.odbc-statistics.php                       24-Jun-2024 06:05               10169
function.odbc-tableprivileges.php                  24-Jun-2024 06:05                8497
function.odbc-tables.php                           24-Jun-2024 06:05               12815
function.opcache-compile-file.php                  24-Jun-2024 06:05                4011
function.opcache-get-configuration.php             24-Jun-2024 06:05                3388
function.opcache-get-status.php                    24-Jun-2024 06:05                3989
function.opcache-invalidate.php                    24-Jun-2024 06:05                4520
function.opcache-is-script-cached.php              24-Jun-2024 06:05                3585
function.opcache-reset.php                         24-Jun-2024 06:05                3548
function.openal-buffer-create.php                  24-Jun-2024 06:05                2944
function.openal-buffer-data.php                    24-Jun-2024 06:05                5061
function.openal-buffer-destroy.php                 24-Jun-2024 06:05                3256
function.openal-buffer-get.php                     24-Jun-2024 06:05                4049
function.openal-buffer-loadwav.php                 24-Jun-2024 06:05                3797
function.openal-context-create.php                 24-Jun-2024 06:05                3449
function.openal-context-current.php                24-Jun-2024 06:05                3311
function.openal-context-destroy.php                24-Jun-2024 06:05                3297
function.openal-context-process.php                24-Jun-2024 06:05                3685
function.openal-context-suspend.php                24-Jun-2024 06:05                3679
function.openal-device-close.php                   24-Jun-2024 06:05                3263
function.openal-device-open.php                    24-Jun-2024 06:05                3442
function.openal-listener-get.php                   24-Jun-2024 06:05                3485
function.openal-listener-set.php                   24-Jun-2024 06:05                3892
function.openal-source-create.php                  24-Jun-2024 06:05                3125
function.openal-source-destroy.php                 24-Jun-2024 06:05                3264
function.openal-source-get.php                     24-Jun-2024 06:05                5676
function.openal-source-pause.php                   24-Jun-2024 06:05                3565
function.openal-source-play.php                    24-Jun-2024 06:05                3564
function.openal-source-rewind.php                  24-Jun-2024 06:05                3574
function.openal-source-set.php                     24-Jun-2024 06:05                6423
function.openal-source-stop.php                    24-Jun-2024 06:05                3546
function.openal-stream.php                         24-Jun-2024 06:05                4507
function.opendir.php                               24-Jun-2024 06:05                8184
function.openlog.php                               24-Jun-2024 06:05               10429
function.openssl-cipher-iv-length.php              24-Jun-2024 06:05                4608
function.openssl-cipher-key-length.php             24-Jun-2024 06:05                4486
function.openssl-cms-decrypt.php                   24-Jun-2024 06:05                5784
function.openssl-cms-encrypt.php                   24-Jun-2024 06:05                6778
function.openssl-cms-read.php                      24-Jun-2024 06:05                3344
function.openssl-cms-sign.php                      24-Jun-2024 06:05                8432
function.openssl-cms-verify.php                    24-Jun-2024 06:05                7525
function.openssl-csr-export-to-file.php            24-Jun-2024 06:05                8668
function.openssl-csr-export.php                    24-Jun-2024 06:05                8595
function.openssl-csr-get-public-key.php            24-Jun-2024 06:05                8923
function.openssl-csr-get-subject.php               24-Jun-2024 06:05                9670
function.openssl-csr-new.php                       24-Jun-2024 06:05               22227
function.openssl-csr-sign.php                      24-Jun-2024 06:05               14131
function.openssl-decrypt.php                       24-Jun-2024 06:05                8178
function.openssl-dh-compute-key.php                24-Jun-2024 06:05               16552
function.openssl-digest.php                        24-Jun-2024 06:05                4709
function.openssl-encrypt.php                       24-Jun-2024 06:05               18479
function.openssl-error-string.php                  24-Jun-2024 06:05                3871
function.openssl-free-key.php                      24-Jun-2024 06:05                3842
function.openssl-get-cert-locations.php            24-Jun-2024 06:05                4121
function.openssl-get-cipher-methods.php            24-Jun-2024 06:05               14193
function.openssl-get-curve-names.php               24-Jun-2024 06:05                7237
function.openssl-get-md-methods.php                24-Jun-2024 06:05                7131
function.openssl-get-privatekey.php                24-Jun-2024 06:05                1955
function.openssl-get-publickey.php                 24-Jun-2024 06:05                1926
function.openssl-open.php                          24-Jun-2024 06:05               10496
function.openssl-pbkdf2.php                        24-Jun-2024 06:05                7698
function.openssl-pkcs12-export-to-file.php         24-Jun-2024 06:05                7797
function.openssl-pkcs12-export.php                 24-Jun-2024 06:05                7795
function.openssl-pkcs12-read.php                   24-Jun-2024 06:05                5808
function.openssl-pkcs7-decrypt.php                 24-Jun-2024 06:05                7978
function.openssl-pkcs7-encrypt.php                 24-Jun-2024 06:05               10886
function.openssl-pkcs7-read.php                    24-Jun-2024 06:05                7022
function.openssl-pkcs7-sign.php                    24-Jun-2024 06:05               12257
function.openssl-pkcs7-verify.php                  24-Jun-2024 06:05                8526
function.openssl-pkey-derive.php                   24-Jun-2024 06:05                8305
function.openssl-pkey-export-to-file.php           24-Jun-2024 06:05                6924
function.openssl-pkey-export.php                   24-Jun-2024 06:05                6787
function.openssl-pkey-free.php                     24-Jun-2024 06:05                4077
function.openssl-pkey-get-details.php              24-Jun-2024 06:05                9767
function.openssl-pkey-get-private.php              24-Jun-2024 06:05                6389
function.openssl-pkey-get-public.php               24-Jun-2024 06:05                5610
function.openssl-pkey-new.php                      24-Jun-2024 06:05                7170
function.openssl-private-decrypt.php               24-Jun-2024 06:05                7153
function.openssl-private-encrypt.php               24-Jun-2024 06:05                6846
function.openssl-public-decrypt.php                24-Jun-2024 06:05                6803
function.openssl-public-encrypt.php                24-Jun-2024 06:05                7140
function.openssl-random-pseudo-bytes.php           24-Jun-2024 06:05                9520
function.openssl-seal.php                          24-Jun-2024 06:05               11615
function.openssl-sign.php                          24-Jun-2024 06:05               12970
function.openssl-spki-export-challenge.php         24-Jun-2024 06:05                7730
function.openssl-spki-export.php                   24-Jun-2024 06:05                8519
function.openssl-spki-new.php                      24-Jun-2024 06:05                9394
function.openssl-spki-verify.php                   24-Jun-2024 06:05                7891
function.openssl-verify.php                        24-Jun-2024 06:05               13455
function.openssl-x509-check-private-key.php        24-Jun-2024 06:05                6051
function.openssl-x509-checkpurpose.php             24-Jun-2024 06:05                7574
function.openssl-x509-export-to-file.php           24-Jun-2024 06:05                5260
function.openssl-x509-export.php                   24-Jun-2024 06:05                5222
function.openssl-x509-fingerprint.php              24-Jun-2024 06:05                5517
function.openssl-x509-free.php                     24-Jun-2024 06:05                4102
function.openssl-x509-parse.php                    24-Jun-2024 06:05                4878
function.openssl-x509-read.php                     24-Jun-2024 06:05                4617
function.openssl-x509-verify.php                   24-Jun-2024 06:05               12599
function.ord.php                                   24-Jun-2024 06:06                7385
function.output-add-rewrite-var.php                24-Jun-2024 06:05                9567
function.output-reset-rewrite-vars.php             24-Jun-2024 06:05                6763
function.pack.php                                  24-Jun-2024 06:05               13311
function.parse-ini-file.php                        24-Jun-2024 06:05               21060
function.parse-ini-string.php                      24-Jun-2024 06:05                7814
function.parse-str.php                             24-Jun-2024 06:06               10212
function.parse-url.php                             24-Jun-2024 06:05               16946
function.passthru.php                              24-Jun-2024 06:05                7725
function.password-get-info.php                     24-Jun-2024 06:05                3653
function.password-hash.php                         24-Jun-2024 06:05               23390
function.password-needs-rehash.php                 24-Jun-2024 06:05                8301
function.password-verify.php                       24-Jun-2024 06:05                7052
function.pathinfo.php                              24-Jun-2024 06:05               14675
function.pclose.php                                24-Jun-2024 06:05                4989
function.pcntl-alarm.php                           24-Jun-2024 06:05                3035
function.pcntl-async-signals.php                   24-Jun-2024 06:05                4298
function.pcntl-errno.php                           24-Jun-2024 06:05                1818
function.pcntl-exec.php                            24-Jun-2024 06:05                3874
function.pcntl-fork.php                            24-Jun-2024 06:05                5087
function.pcntl-get-last-error.php                  24-Jun-2024 06:05                2827
function.pcntl-getpriority.php                     24-Jun-2024 06:05                5923
function.pcntl-rfork.php                           24-Jun-2024 06:05                7742
function.pcntl-setpriority.php                     24-Jun-2024 06:05                5798
function.pcntl-signal-dispatch.php                 24-Jun-2024 06:05                5733
function.pcntl-signal-get-handler.php              24-Jun-2024 06:05                6874
function.pcntl-signal.php                          24-Jun-2024 06:05               11386
function.pcntl-sigprocmask.php                     24-Jun-2024 06:05                6191
function.pcntl-sigtimedwait.php                    24-Jun-2024 06:05                5224
function.pcntl-sigwaitinfo.php                     24-Jun-2024 06:05                7595
function.pcntl-strerror.php                        24-Jun-2024 06:05                3029
function.pcntl-unshare.php                         24-Jun-2024 06:05                4689
function.pcntl-wait.php                            24-Jun-2024 06:05                8139
function.pcntl-waitpid.php                         24-Jun-2024 06:05                9586
function.pcntl-wexitstatus.php                     24-Jun-2024 06:05                3837
function.pcntl-wifexited.php                       24-Jun-2024 06:05                3559
function.pcntl-wifsignaled.php                     24-Jun-2024 06:05                3611
function.pcntl-wifstopped.php                      24-Jun-2024 06:05                3681
function.pcntl-wstopsig.php                        24-Jun-2024 06:05                3842
function.pcntl-wtermsig.php                        24-Jun-2024 06:05                4017
function.pfsockopen.php                            24-Jun-2024 06:05                5789
function.pg-affected-rows.php                      24-Jun-2024 06:05                7022
function.pg-cancel-query.php                       24-Jun-2024 06:05                7684
function.pg-client-encoding.php                    24-Jun-2024 06:05                7126
function.pg-close.php                              24-Jun-2024 06:05                7100
function.pg-connect-poll.php                       24-Jun-2024 06:05                4235
function.pg-connect.php                            24-Jun-2024 06:05               11441
function.pg-connection-busy.php                    24-Jun-2024 06:05                5968
function.pg-connection-reset.php                   24-Jun-2024 06:05                5939
function.pg-connection-status.php                  24-Jun-2024 06:05                5731
function.pg-consume-input.php                      24-Jun-2024 06:05                3793
function.pg-convert.php                            24-Jun-2024 06:05               10094
function.pg-copy-from.php                          24-Jun-2024 06:05                8305
function.pg-copy-to.php                            24-Jun-2024 06:05                7622
function.pg-dbname.php                             24-Jun-2024 06:05                5528
function.pg-delete.php                             24-Jun-2024 06:05               10163
function.pg-end-copy.php                           24-Jun-2024 06:05                7573
function.pg-escape-bytea.php                       24-Jun-2024 06:05                8124
function.pg-escape-identifier.php                  24-Jun-2024 06:05                8119
function.pg-escape-literal.php                     24-Jun-2024 06:05                8460
function.pg-escape-string.php                      24-Jun-2024 06:05                7920
function.pg-execute.php                            24-Jun-2024 06:05               10738
function.pg-fetch-all-columns.php                  24-Jun-2024 06:05                7274
function.pg-fetch-all.php                          24-Jun-2024 06:05                9502
function.pg-fetch-array.php                        24-Jun-2024 06:05               13166
function.pg-fetch-assoc.php                        24-Jun-2024 06:05                9740
function.pg-fetch-object.php                       24-Jun-2024 06:05               12170
function.pg-fetch-result.php                       24-Jun-2024 06:05                9628
function.pg-fetch-row.php                          24-Jun-2024 06:05               10196
function.pg-field-is-null.php                      24-Jun-2024 06:05                8720
function.pg-field-name.php                         24-Jun-2024 06:05                9198
function.pg-field-num.php                          24-Jun-2024 06:05                6717
function.pg-field-prtlen.php                       24-Jun-2024 06:05               11080
function.pg-field-size.php                         24-Jun-2024 06:05                9485
function.pg-field-table.php                        24-Jun-2024 06:05                8866
function.pg-field-type-oid.php                     24-Jun-2024 06:05                7606
function.pg-field-type.php                         24-Jun-2024 06:05                7381
function.pg-flush.php                              24-Jun-2024 06:05                3824
function.pg-free-result.php                        24-Jun-2024 06:05                7587
function.pg-get-notify.php                         24-Jun-2024 06:05                7778
function.pg-get-pid.php                            24-Jun-2024 06:05                5272
function.pg-get-result.php                         24-Jun-2024 06:05                8908
function.pg-host.php                               24-Jun-2024 06:05                6536
function.pg-insert.php                             24-Jun-2024 06:05               12107
function.pg-last-error.php                         24-Jun-2024 06:05                7684
function.pg-last-notice.php                        24-Jun-2024 06:05                8669
function.pg-last-oid.php                           24-Jun-2024 06:05                7812
function.pg-lo-close.php                           24-Jun-2024 06:05                7292
function.pg-lo-create.php                          24-Jun-2024 06:05                8847
function.pg-lo-export.php                          24-Jun-2024 06:05                8394
function.pg-lo-import.php                          24-Jun-2024 06:05                7687
function.pg-lo-open.php                            24-Jun-2024 06:05                9216
function.pg-lo-read-all.php                        24-Jun-2024 06:05                6525
function.pg-lo-read.php                            24-Jun-2024 06:05                7296
function.pg-lo-seek.php                            24-Jun-2024 06:05                8139
function.pg-lo-tell.php                            24-Jun-2024 06:05                7091
function.pg-lo-truncate.php                        24-Jun-2024 06:05                6794
function.pg-lo-unlink.php                          24-Jun-2024 06:05                7362
function.pg-lo-write.php                           24-Jun-2024 06:05                8407
function.pg-meta-data.php                          24-Jun-2024 06:05                7728
function.pg-num-fields.php                         24-Jun-2024 06:05                6139
function.pg-num-rows.php                           24-Jun-2024 06:05                6124
function.pg-options.php                            24-Jun-2024 06:05                5863
function.pg-parameter-status.php                   24-Jun-2024 06:05                8819
function.pg-pconnect.php                           24-Jun-2024 06:05               10055
function.pg-ping.php                               24-Jun-2024 06:05                6325
function.pg-port.php                               24-Jun-2024 06:05                6048
function.pg-prepare.php                            24-Jun-2024 06:05               10722
function.pg-put-line.php                           24-Jun-2024 06:05                8976
function.pg-query-params.php                       24-Jun-2024 06:05               11108
function.pg-query.php                              24-Jun-2024 06:05               12693
function.pg-result-error-field.php                 24-Jun-2024 06:05                9937
function.pg-result-error.php                       24-Jun-2024 06:05                8383
function.pg-result-seek.php                        24-Jun-2024 06:05                7531
function.pg-result-status.php                      24-Jun-2024 06:05                8936
function.pg-select.php                             24-Jun-2024 06:05               12633
function.pg-send-execute.php                       24-Jun-2024 06:05               10822
function.pg-send-prepare.php                       24-Jun-2024 06:05               11227
function.pg-send-query-params.php                  24-Jun-2024 06:05                8316
function.pg-send-query.php                         24-Jun-2024 06:05               10238
function.pg-set-client-encoding.php                24-Jun-2024 06:05                9119
function.pg-set-error-context-visibility.php       24-Jun-2024 06:05                7206
function.pg-set-error-verbosity.php                24-Jun-2024 06:05                9225
function.pg-socket.php                             24-Jun-2024 06:05                3952
function.pg-trace.php                              24-Jun-2024 06:05                9491
function.pg-transaction-status.php                 24-Jun-2024 06:05                6841
function.pg-tty.php                                24-Jun-2024 06:05                6373
function.pg-unescape-bytea.php                     24-Jun-2024 06:05                6565
function.pg-untrace.php                            24-Jun-2024 06:05                6997
function.pg-update.php                             24-Jun-2024 06:05               11118
function.pg-version.php                            24-Jun-2024 06:05                6772
function.php-ini-loaded-file.php                   24-Jun-2024 06:05                4689
function.php-ini-scanned-files.php                 24-Jun-2024 06:05                6334
function.php-sapi-name.php                         24-Jun-2024 06:05                6081
function.php-strip-whitespace.php                  24-Jun-2024 06:05                4889
function.php-uname.php                             24-Jun-2024 06:05                9121
function.phpcredits.php                            24-Jun-2024 06:05                8296
function.phpdbg-break-file.php                     24-Jun-2024 06:05                3972
function.phpdbg-break-function.php                 24-Jun-2024 06:05                3676
function.phpdbg-break-method.php                   24-Jun-2024 06:05                4015
function.phpdbg-break-next.php                     24-Jun-2024 06:05                3333
function.phpdbg-clear.php                          24-Jun-2024 06:05                3604
function.phpdbg-color.php                          24-Jun-2024 06:05                3716
function.phpdbg-end-oplog.php                      24-Jun-2024 06:05                2670
function.phpdbg-exec.php                           24-Jun-2024 06:05                3209
function.phpdbg-get-executable.php                 24-Jun-2024 06:05                2613
function.phpdbg-prompt.php                         24-Jun-2024 06:05                2892
function.phpdbg-start-oplog.php                    24-Jun-2024 06:05                2331
function.phpinfo.php                               24-Jun-2024 06:05                9407
function.phpversion.php                            24-Jun-2024 06:05               10887
function.pi.php                                    24-Jun-2024 06:05                3136
function.png2wbmp.php                              24-Jun-2024 06:05                6791
function.popen.php                                 24-Jun-2024 06:05                8663
function.pos.php                                   24-Jun-2024 06:06                1670
function.posix-access.php                          24-Jun-2024 06:05                6718
function.posix-ctermid.php                         24-Jun-2024 06:05                4542
function.posix-eaccess.php                         24-Jun-2024 06:05                7510
function.posix-errno.php                           24-Jun-2024 06:05                1824
function.posix-fpathconf.php                       24-Jun-2024 06:05                7004
function.posix-get-last-error.php                  24-Jun-2024 06:05                4235
function.posix-getcwd.php                          24-Jun-2024 06:05                4362
function.posix-getegid.php                         24-Jun-2024 06:05                5299
function.posix-geteuid.php                         24-Jun-2024 06:05                5290
function.posix-getgid.php                          24-Jun-2024 06:05                4730
function.posix-getgrgid.php                        24-Jun-2024 06:05                6572
function.posix-getgrnam.php                        24-Jun-2024 06:05                6524
function.posix-getgroups.php                       24-Jun-2024 06:05                4233
function.posix-getlogin.php                        24-Jun-2024 06:05                3696
function.posix-getpgid.php                         24-Jun-2024 06:05                4709
function.posix-getpgrp.php                         24-Jun-2024 06:05                2639
function.posix-getpid.php                          24-Jun-2024 06:05                3406
function.posix-getppid.php                         24-Jun-2024 06:05                3060
function.posix-getpwnam.php                        24-Jun-2024 06:05                6878
function.posix-getpwuid.php                        24-Jun-2024 06:05                6877
function.posix-getrlimit.php                       24-Jun-2024 06:05                8573
function.posix-getsid.php                          24-Jun-2024 06:05                4832
function.posix-getuid.php                          24-Jun-2024 06:05                3442
function.posix-initgroups.php                      24-Jun-2024 06:05                3358
function.posix-isatty.php                          24-Jun-2024 06:05                4590
function.posix-kill.php                            24-Jun-2024 06:05                3539
function.posix-mkfifo.php                          24-Jun-2024 06:05                3605
function.posix-mknod.php                           24-Jun-2024 06:05                7533
function.posix-pathconf.php                        24-Jun-2024 06:05                6356
function.posix-setegid.php                         24-Jun-2024 06:05                5190
function.posix-seteuid.php                         24-Jun-2024 06:05                3588
function.posix-setgid.php                          24-Jun-2024 06:05                5402
function.posix-setpgid.php                         24-Jun-2024 06:05                3460
function.posix-setrlimit.php                       24-Jun-2024 06:05                4713
function.posix-setsid.php                          24-Jun-2024 06:05                2565
function.posix-setuid.php                          24-Jun-2024 06:05                5550
function.posix-strerror.php                        24-Jun-2024 06:05                4878
function.posix-sysconf.php                         24-Jun-2024 06:05                4119
function.posix-times.php                           24-Jun-2024 06:05                4730
function.posix-ttyname.php                         24-Jun-2024 06:05                5430
function.posix-uname.php                           24-Jun-2024 06:05                4893
function.pow.php                                   24-Jun-2024 06:05                6923
function.preg-filter.php                           24-Jun-2024 06:06               10408
function.preg-grep.php                             24-Jun-2024 06:06                6101
function.preg-last-error-msg.php                   24-Jun-2024 06:06                4149
function.preg-last-error.php                       24-Jun-2024 06:06                5229
function.preg-match-all.php                        24-Jun-2024 06:06               25644
function.preg-match.php                            24-Jun-2024 06:06               23689
function.preg-quote.php                            24-Jun-2024 06:06                8636
function.preg-replace-callback-array.php           24-Jun-2024 06:06               10686
function.preg-replace-callback.php                 24-Jun-2024 06:06               17747
function.preg-replace.php                          24-Jun-2024 06:06               25065
function.preg-split.php                            24-Jun-2024 06:06               12852
function.prev.php                                  24-Jun-2024 06:06                9441
function.print-r.php                               24-Jun-2024 06:06                9578
function.print.php                                 24-Jun-2024 06:06               12974
function.printf.php                                24-Jun-2024 06:06               28793
function.proc-close.php                            24-Jun-2024 06:05                3809
function.proc-get-status.php                       24-Jun-2024 06:05                7050
function.proc-nice.php                             24-Jun-2024 06:05                7971
function.proc-open.php                             24-Jun-2024 06:05               23034
function.proc-terminate.php                        24-Jun-2024 06:05                4956
function.property-exists.php                       24-Jun-2024 06:06                8683
function.ps-add-bookmark.php                       24-Jun-2024 06:05                5174
function.ps-add-launchlink.php                     24-Jun-2024 06:05                5875
function.ps-add-locallink.php                      24-Jun-2024 06:05                6659
function.ps-add-note.php                           24-Jun-2024 06:05                7385
function.ps-add-pdflink.php                        24-Jun-2024 06:05                7032
function.ps-add-weblink.php                        24-Jun-2024 06:05                5961
function.ps-arc.php                                24-Jun-2024 06:05                5379
function.ps-arcn.php                               24-Jun-2024 06:05                5385
function.ps-begin-page.php                         24-Jun-2024 06:05                7040
function.ps-begin-pattern.php                      24-Jun-2024 06:05               13480
function.ps-begin-template.php                     24-Jun-2024 06:05               11470
function.ps-circle.php                             24-Jun-2024 06:05                4898
function.ps-clip.php                               24-Jun-2024 06:05                3177
function.ps-close-image.php                        24-Jun-2024 06:05                4066
function.ps-close.php                              24-Jun-2024 06:05                3815
function.ps-closepath-stroke.php                   24-Jun-2024 06:05                3250
function.ps-closepath.php                          24-Jun-2024 06:05                3411
function.ps-continue-text.php                      24-Jun-2024 06:05                4223
function.ps-curveto.php                            24-Jun-2024 06:05                5254
function.ps-delete.php                             24-Jun-2024 06:05                3694
function.ps-end-page.php                           24-Jun-2024 06:05                3420
function.ps-end-pattern.php                        24-Jun-2024 06:05                3351
function.ps-end-template.php                       24-Jun-2024 06:05                3358
function.ps-fill-stroke.php                        24-Jun-2024 06:05                3456
function.ps-fill.php                               24-Jun-2024 06:05                3389
function.ps-findfont.php                           24-Jun-2024 06:05                7266
function.ps-get-buffer.php                         24-Jun-2024 06:05                3308
function.ps-get-parameter.php                      24-Jun-2024 06:05                8034
function.ps-get-value.php                          24-Jun-2024 06:05                9549
function.ps-hyphenate.php                          24-Jun-2024 06:05                7423
function.ps-include-file.php                       24-Jun-2024 06:05                3259
function.ps-lineto.php                             24-Jun-2024 06:05                8386
function.ps-makespotcolor.php                      24-Jun-2024 06:05               10296
function.ps-moveto.php                             24-Jun-2024 06:05                3988
function.ps-new.php                                24-Jun-2024 06:05                3109
function.ps-open-file.php                          24-Jun-2024 06:05                3829
function.ps-open-image-file.php                    24-Jun-2024 06:05                5041
function.ps-open-image.php                         24-Jun-2024 06:05                7128
function.ps-open-memory-image.php                  24-Jun-2024 06:05                2936
function.ps-place-image.php                        24-Jun-2024 06:05                5389
function.ps-rect.php                               24-Jun-2024 06:05                5109
function.ps-restore.php                            24-Jun-2024 06:05                3533
function.ps-rotate.php                             24-Jun-2024 06:05               12257
function.ps-save.php                               24-Jun-2024 06:05                3280
function.ps-scale.php                              24-Jun-2024 06:05                3897
function.ps-set-border-color.php                   24-Jun-2024 06:05                5015
function.ps-set-border-dash.php                    24-Jun-2024 06:05                4603
function.ps-set-border-style.php                   24-Jun-2024 06:05                4667
function.ps-set-info.php                           24-Jun-2024 06:05                6139
function.ps-set-parameter.php                      24-Jun-2024 06:05                4077
function.ps-set-text-pos.php                       24-Jun-2024 06:05                9463
function.ps-set-value.php                          24-Jun-2024 06:05                4889
function.ps-setcolor.php                           24-Jun-2024 06:05                6090
function.ps-setdash.php                            24-Jun-2024 06:05                3784
function.ps-setflat.php                            24-Jun-2024 06:05                3246
function.ps-setfont.php                            24-Jun-2024 06:05                4202
function.ps-setgray.php                            24-Jun-2024 06:05                3457
function.ps-setlinecap.php                         24-Jun-2024 06:05                3983
function.ps-setlinejoin.php                        24-Jun-2024 06:05                4001
function.ps-setlinewidth.php                       24-Jun-2024 06:05                3865
function.ps-setmiterlimit.php                      24-Jun-2024 06:05                4285
function.ps-setoverprintmode.php                   24-Jun-2024 06:05                3283
function.ps-setpolydash.php                        24-Jun-2024 06:05                7882
function.ps-shading-pattern.php                    24-Jun-2024 06:05                4385
function.ps-shading.php                            24-Jun-2024 06:05                7320
function.ps-shfill.php                             24-Jun-2024 06:05                4106
function.ps-show-boxed.php                         24-Jun-2024 06:05               12869
function.ps-show-xy.php                            24-Jun-2024 06:05                4385
function.ps-show-xy2.php                           24-Jun-2024 06:05                3255
function.ps-show.php                               24-Jun-2024 06:05                5890
function.ps-show2.php                              24-Jun-2024 06:05                3450
function.ps-string-geometry.php                    24-Jun-2024 06:05                4988
function.ps-stringwidth.php                        24-Jun-2024 06:05                4465
function.ps-stroke.php                             24-Jun-2024 06:05                3586
function.ps-symbol-name.php                        24-Jun-2024 06:05                3993
function.ps-symbol-width.php                       24-Jun-2024 06:05                4537
function.ps-symbol.php                             24-Jun-2024 06:05                3852
function.ps-translate.php                          24-Jun-2024 06:05               14276
function.pspell-add-to-personal.php                24-Jun-2024 06:05                6553
function.pspell-add-to-session.php                 24-Jun-2024 06:05                4183
function.pspell-check.php                          24-Jun-2024 06:05                5112
function.pspell-clear-session.php                  24-Jun-2024 06:05                5953
function.pspell-config-create.php                  24-Jun-2024 06:05                8108
function.pspell-config-data-dir.php                24-Jun-2024 06:05                3486
function.pspell-config-dict-dir.php                24-Jun-2024 06:05                3485
function.pspell-config-ignore.php                  24-Jun-2024 06:05                5837
function.pspell-config-mode.php                    24-Jun-2024 06:05                6681
function.pspell-config-personal.php                24-Jun-2024 06:05                6624
function.pspell-config-repl.php                    24-Jun-2024 06:05                6927
function.pspell-config-runtogether.php             24-Jun-2024 06:05                6490
function.pspell-config-save-repl.php               24-Jun-2024 06:05                5416
function.pspell-new-config.php                     24-Jun-2024 06:05                6461
function.pspell-new-personal.php                   24-Jun-2024 06:05               11047
function.pspell-new.php                            24-Jun-2024 06:05                9580
function.pspell-save-wordlist.php                  24-Jun-2024 06:05                6146
function.pspell-store-replacement.php              24-Jun-2024 06:05                7821
function.pspell-suggest.php                        24-Jun-2024 06:05                5648
function.putenv.php                                24-Jun-2024 06:05                4176
function.quoted-printable-decode.php               24-Jun-2024 06:06                5246
function.quoted-printable-encode.php               24-Jun-2024 06:06                5171
function.quotemeta.php                             24-Jun-2024 06:06                5805
function.rad2deg.php                               24-Jun-2024 06:05                3671
function.radius-acct-open.php                      24-Jun-2024 06:05                3295
function.radius-add-server.php                     24-Jun-2024 06:05                7842
function.radius-auth-open.php                      24-Jun-2024 06:05                3293
function.radius-close.php                          24-Jun-2024 06:05                2727
function.radius-config.php                         24-Jun-2024 06:05                4146
function.radius-create-request.php                 24-Jun-2024 06:05                5393
function.radius-cvt-addr.php                       24-Jun-2024 06:05                6257
function.radius-cvt-int.php                        24-Jun-2024 06:05                5657
function.radius-cvt-string.php                     24-Jun-2024 06:05                5711
function.radius-demangle-mppe-key.php              24-Jun-2024 06:05                3289
function.radius-demangle.php                       24-Jun-2024 06:05                3020
function.radius-get-attr.php                       24-Jun-2024 06:05                6509
function.radius-get-tagged-attr-data.php           24-Jun-2024 06:05                6604
function.radius-get-tagged-attr-tag.php            24-Jun-2024 06:05                6657
function.radius-get-vendor-attr.php                24-Jun-2024 06:05                8252
function.radius-put-addr.php                       24-Jun-2024 06:05                5739
function.radius-put-attr.php                       24-Jun-2024 06:05                8974
function.radius-put-int.php                        24-Jun-2024 06:05                7711
function.radius-put-string.php                     24-Jun-2024 06:05                8091
function.radius-put-vendor-addr.php                24-Jun-2024 06:05                5693
function.radius-put-vendor-attr.php                24-Jun-2024 06:05                7958
function.radius-put-vendor-int.php                 24-Jun-2024 06:05                6471
function.radius-put-vendor-string.php              24-Jun-2024 06:05                6864
function.radius-request-authenticator.php          24-Jun-2024 06:05                3217
function.radius-salt-encrypt-attr.php              24-Jun-2024 06:05                4312
function.radius-send-request.php                   24-Jun-2024 06:05                4057
function.radius-server-secret.php                  24-Jun-2024 06:05                2748
function.radius-strerror.php                       24-Jun-2024 06:05                2666
function.rand.php                                  24-Jun-2024 06:05               10657
function.random-bytes.php                          24-Jun-2024 06:05                9939
function.random-int.php                            24-Jun-2024 06:05                9740
function.range.php                                 24-Jun-2024 06:06               17205
function.rar-wrapper-cache-stats.php               24-Jun-2024 06:05                2423
function.rawurldecode.php                          24-Jun-2024 06:05                4717
function.rawurlencode.php                          24-Jun-2024 06:05                6346
function.read-exif-data.php                        24-Jun-2024 06:05                2565
function.readdir.php                               24-Jun-2024 06:05               10619
function.readfile.php                              24-Jun-2024 06:05               10232
function.readgzfile.php                            24-Jun-2024 06:05                4670
function.readline-add-history.php                  24-Jun-2024 06:05                2916
function.readline-callback-handler-install.php     24-Jun-2024 06:05                9739
function.readline-callback-handler-remove.php      24-Jun-2024 06:05                4101
function.readline-callback-read-char.php           24-Jun-2024 06:05                4009
function.readline-clear-history.php                24-Jun-2024 06:05                2595
function.readline-completion-function.php          24-Jun-2024 06:05                3163
function.readline-info.php                         24-Jun-2024 06:05                5020
function.readline-list-history.php                 24-Jun-2024 06:05                2434
function.readline-on-new-line.php                  24-Jun-2024 06:05                2763
function.readline-read-history.php                 24-Jun-2024 06:05                3598
function.readline-redisplay.php                    24-Jun-2024 06:05                2319
function.readline-write-history.php                24-Jun-2024 06:05                3554
function.readline.php                              24-Jun-2024 06:05                5286
function.readlink.php                              24-Jun-2024 06:05                4666
function.realpath-cache-get.php                    24-Jun-2024 06:05                4353
function.realpath-cache-size.php                   24-Jun-2024 06:05                3841
function.realpath.php                              24-Jun-2024 06:05                8815
function.recode-file.php                           24-Jun-2024 06:05                5939
function.recode-string.php                         24-Jun-2024 06:05                5296
function.recode.php                                24-Jun-2024 06:05                1786
function.register-shutdown-function.php            24-Jun-2024 06:06                7635
function.register-tick-function.php                24-Jun-2024 06:06                5546
function.rename.php                                24-Jun-2024 06:05                6114
function.require-once.php                          24-Jun-2024 06:05                1849
function.require.php                               24-Jun-2024 06:05                2049
function.reset.php                                 24-Jun-2024 06:06                9971
function.restore-error-handler.php                 24-Jun-2024 06:05                5983
function.restore-exception-handler.php             24-Jun-2024 06:05                6814
function.restore-include-path.php                  24-Jun-2024 06:05                5343
function.return.php                                24-Jun-2024 06:05                4472
function.rewind.php                                24-Jun-2024 06:05                6526
function.rewinddir.php                             24-Jun-2024 06:05                3725
function.rmdir.php                                 24-Jun-2024 06:05                5330
function.rnp-backend-string.php                    24-Jun-2024 06:05                2305
function.rnp-backend-version.php                   24-Jun-2024 06:05                2226
function.rnp-decrypt.php                           24-Jun-2024 06:05                3266
function.rnp-dump-packets-to-json.php              24-Jun-2024 06:05                3180
function.rnp-dump-packets.php                      24-Jun-2024 06:05                3134
function.rnp-ffi-create.php                        24-Jun-2024 06:05                3229
function.rnp-ffi-destroy.php                       24-Jun-2024 06:05                2470
function.rnp-ffi-set-pass-provider.php             24-Jun-2024 06:05                6757
function.rnp-import-keys.php                       24-Jun-2024 06:05                3518
function.rnp-import-signatures.php                 24-Jun-2024 06:05                3508
function.rnp-key-export-autocrypt.php              24-Jun-2024 06:05                4569
function.rnp-key-export-revocation.php             24-Jun-2024 06:05                5219
function.rnp-key-export.php                        24-Jun-2024 06:05                3488
function.rnp-key-get-info.php                      24-Jun-2024 06:05                8006
function.rnp-key-remove.php                        24-Jun-2024 06:05                3628
function.rnp-key-revoke.php                        24-Jun-2024 06:05                4865
function.rnp-list-keys.php                         24-Jun-2024 06:05                3171
function.rnp-load-keys-from-path.php               24-Jun-2024 06:05                3880
function.rnp-load-keys.php                         24-Jun-2024 06:05                3836
function.rnp-locate-key.php                        24-Jun-2024 06:05                3591
function.rnp-op-encrypt.php                        24-Jun-2024 06:05                7958
function.rnp-op-generate-key.php                   24-Jun-2024 06:05                7577
function.rnp-op-sign-cleartext.php                 24-Jun-2024 06:05                5227
function.rnp-op-sign-detached.php                  24-Jun-2024 06:05                5106
function.rnp-op-sign.php                           24-Jun-2024 06:05                6187
function.rnp-op-verify-detached.php                24-Jun-2024 06:05                7116
function.rnp-op-verify.php                         24-Jun-2024 06:05                6855
function.rnp-save-keys-to-path.php                 24-Jun-2024 06:05                3894
function.rnp-save-keys.php                         24-Jun-2024 06:05                3867
function.rnp-supported-features.php                24-Jun-2024 06:05                2948
function.rnp-version-string-full.php               24-Jun-2024 06:05                2311
function.rnp-version-string.php                    24-Jun-2024 06:05                2208
function.round.php                                 24-Jun-2024 06:05               24390
function.rpmaddtag.php                             24-Jun-2024 06:05                3374
function.rpmdbinfo.php                             24-Jun-2024 06:05                5258
function.rpmdbsearch.php                           24-Jun-2024 06:05                6158
function.rpmgetsymlink.php                         24-Jun-2024 06:05                2997
function.rpminfo.php                               24-Jun-2024 06:05                5440
function.rpmvercmp.php                             24-Jun-2024 06:05                4937
function.rrd-create.php                            24-Jun-2024 06:05                2995
function.rrd-error.php                             24-Jun-2024 06:05                2138
function.rrd-fetch.php                             24-Jun-2024 06:05                2975
function.rrd-first.php                             24-Jun-2024 06:05                2952
function.rrd-graph.php                             24-Jun-2024 06:05                3204
function.rrd-info.php                              24-Jun-2024 06:05                2537
function.rrd-last.php                              24-Jun-2024 06:05                2488
function.rrd-lastupdate.php                        24-Jun-2024 06:05                2667
function.rrd-restore.php                           24-Jun-2024 06:05                3369
function.rrd-tune.php                              24-Jun-2024 06:05                3051
function.rrd-update.php                            24-Jun-2024 06:05                3124
function.rrd-version.php                           24-Jun-2024 06:05                2232
function.rrd-xport.php                             24-Jun-2024 06:05                2711
function.rrdc-disconnect.php                       24-Jun-2024 06:05                2587
function.rsort.php                                 24-Jun-2024 06:06                9424
function.rtrim.php                                 24-Jun-2024 06:06                9753
function.runkit7-constant-add.php                  24-Jun-2024 06:05                4476
function.runkit7-constant-redefine.php             24-Jun-2024 06:05                4350
function.runkit7-constant-remove.php               24-Jun-2024 06:05                3671
function.runkit7-function-add.php                  24-Jun-2024 06:05                9779
function.runkit7-function-copy.php                 24-Jun-2024 06:05                5525
function.runkit7-function-redefine.php             24-Jun-2024 06:05               10184
function.runkit7-function-remove.php               24-Jun-2024 06:05                4141
function.runkit7-function-rename.php               24-Jun-2024 06:05                4418
function.runkit7-import.php                        24-Jun-2024 06:05                3860
function.runkit7-method-add.php                    24-Jun-2024 06:05               11784
function.runkit7-method-copy.php                   24-Jun-2024 06:05                7084
function.runkit7-method-redefine.php               24-Jun-2024 06:05               12220
function.runkit7-method-remove.php                 24-Jun-2024 06:05                6469
function.runkit7-method-rename.php                 24-Jun-2024 06:05                6631
function.runkit7-object-id.php                     24-Jun-2024 06:05                3784
function.runkit7-superglobals.php                  24-Jun-2024 06:05                2667
function.runkit7-zval-inspect.php                  24-Jun-2024 06:05                5131
function.sapi-windows-cp-conv.php                  24-Jun-2024 06:05                5022
function.sapi-windows-cp-get.php                   24-Jun-2024 06:05                3600
function.sapi-windows-cp-is-utf8.php               24-Jun-2024 06:05                2868
function.sapi-windows-cp-set.php                   24-Jun-2024 06:05                3190
function.sapi-windows-generate-ctrl-event.php      24-Jun-2024 06:05                7916
function.sapi-windows-set-ctrl-handler.php         24-Jun-2024 06:05                7780
function.sapi-windows-vt100-support.php            24-Jun-2024 06:05               11437
function.scandir.php                               24-Jun-2024 06:05                9197
function.scoutapm-get-calls.php                    24-Jun-2024 06:05                4509
function.scoutapm-list-instrumented-functions.php  24-Jun-2024 06:05                3834
function.seaslog-get-author.php                    24-Jun-2024 06:05                3166
function.seaslog-get-version.php                   24-Jun-2024 06:05                3152
function.sem-acquire.php                           24-Jun-2024 06:05                5331
function.sem-get.php                               24-Jun-2024 06:05                7175
function.sem-release.php                           24-Jun-2024 06:05                4345
function.sem-remove.php                            24-Jun-2024 06:05                4311
function.serialize.php                             24-Jun-2024 06:06               10914
function.session-abort.php                         24-Jun-2024 06:06                4347
function.session-cache-expire.php                  24-Jun-2024 06:06                7716
function.session-cache-limiter.php                 24-Jun-2024 06:06                9138
function.session-commit.php                        24-Jun-2024 06:06                1883
function.session-create-id.php                     24-Jun-2024 06:06               10296
function.session-decode.php                        24-Jun-2024 06:06                3914
function.session-destroy.php                       24-Jun-2024 06:06                9163
function.session-encode.php                        24-Jun-2024 06:06                3997
function.session-gc.php                            24-Jun-2024 06:06                8252
function.session-get-cookie-params.php             24-Jun-2024 06:06                5601
function.session-id.php                            24-Jun-2024 06:06                6318
function.session-module-name.php                   24-Jun-2024 06:06                4489
function.session-name.php                          24-Jun-2024 06:06                7842
function.session-regenerate-id.php                 24-Jun-2024 06:06               16400
function.session-register-shutdown.php             24-Jun-2024 06:06                2824
function.session-reset.php                         24-Jun-2024 06:06                4439
function.session-save-path.php                     24-Jun-2024 06:06                4901
function.session-set-cookie-params.php             24-Jun-2024 06:06               11016
function.session-set-save-handler.php              24-Jun-2024 06:06               24248
function.session-start.php                         24-Jun-2024 06:06               14717
function.session-status.php                        24-Jun-2024 06:06                3400
function.session-unset.php                         24-Jun-2024 06:06                5010
function.session-write-close.php                   24-Jun-2024 06:06                4272
function.set-error-handler.php                     24-Jun-2024 06:05               26641
function.set-exception-handler.php                 24-Jun-2024 06:05                7258
function.set-file-buffer.php                       24-Jun-2024 06:05                1848
function.set-include-path.php                      24-Jun-2024 06:05                6369
function.set-time-limit.php                        24-Jun-2024 06:05                4721
function.setcookie.php                             24-Jun-2024 06:05               27294
function.setlocale.php                             24-Jun-2024 06:06               15158
function.setrawcookie.php                          24-Jun-2024 06:05                6393
function.settype.php                               24-Jun-2024 06:06                6477
function.sha1-file.php                             24-Jun-2024 06:06                5790
function.sha1.php                                  24-Jun-2024 06:06                5939
function.shell-exec.php                            24-Jun-2024 06:05                5882
function.shm-attach.php                            24-Jun-2024 06:05                6054
function.shm-detach.php                            24-Jun-2024 06:05                4572
function.shm-get-var.php                           24-Jun-2024 06:05                4400
function.shm-has-var.php                           24-Jun-2024 06:05                4423
function.shm-put-var.php                           24-Jun-2024 06:05                5477
function.shm-remove-var.php                        24-Jun-2024 06:05                4315
function.shm-remove.php                            24-Jun-2024 06:05                4042
function.shmop-close.php                           24-Jun-2024 06:05                5049
function.shmop-delete.php                          24-Jun-2024 06:05                4422
function.shmop-open.php                            24-Jun-2024 06:05                9646
function.shmop-read.php                            24-Jun-2024 06:05                6790
function.shmop-size.php                            24-Jun-2024 06:05                4443
function.shmop-write.php                           24-Jun-2024 06:05                6265
function.show-source.php                           24-Jun-2024 06:05                1806
function.shuffle.php                               24-Jun-2024 06:06                7226
function.simdjson-decode.php                       24-Jun-2024 06:05               17098
function.simdjson-is-valid.php                     24-Jun-2024 06:05               10524
function.simdjson-key-count.php                    24-Jun-2024 06:05                4838
function.simdjson-key-exists.php                   24-Jun-2024 06:05                4633
function.simdjson-key-value.php                    24-Jun-2024 06:05                7396
function.similar-text.php                          24-Jun-2024 06:06                7450
function.simplexml-import-dom.php                  24-Jun-2024 06:06                6448
function.simplexml-load-file.php                   24-Jun-2024 06:06               10368
function.simplexml-load-string.php                 24-Jun-2024 06:06               10055
function.sin.php                                   24-Jun-2024 06:05                4613
function.sinh.php                                  24-Jun-2024 06:05                3258
function.sizeof.php                                24-Jun-2024 06:06                1690
function.sleep.php                                 24-Jun-2024 06:05                7448
function.snmp-get-quick-print.php                  24-Jun-2024 06:05                3753
function.snmp-get-valueretrieval.php               24-Jun-2024 06:05                4498
function.snmp-read-mib.php                         24-Jun-2024 06:05                4924
function.snmp-set-enum-print.php                   24-Jun-2024 06:05                5423
function.snmp-set-oid-numeric-print.php            24-Jun-2024 06:05                2368
function.snmp-set-oid-output-format.php            24-Jun-2024 06:05                7853
function.snmp-set-quick-print.php                  24-Jun-2024 06:05                7273
function.snmp-set-valueretrieval.php               24-Jun-2024 06:05                9573
function.snmp2-get.php                             24-Jun-2024 06:05                5840
function.snmp2-getnext.php                         24-Jun-2024 06:05                6208
function.snmp2-real-walk.php                       24-Jun-2024 06:05                6647
function.snmp2-set.php                             24-Jun-2024 06:05               11140
function.snmp2-walk.php                            24-Jun-2024 06:05                7132
function.snmp3-get.php                             24-Jun-2024 06:05                8951
function.snmp3-getnext.php                         24-Jun-2024 06:05                9279
function.snmp3-real-walk.php                       24-Jun-2024 06:05                9964
function.snmp3-set.php                             24-Jun-2024 06:05               13915
function.snmp3-walk.php                            24-Jun-2024 06:05               10424
function.snmpget.php                               24-Jun-2024 06:05                5834
function.snmpgetnext.php                           24-Jun-2024 06:05                6083
function.snmprealwalk.php                          24-Jun-2024 06:05                6517
function.snmpset.php                               24-Jun-2024 06:05               11171
function.snmpwalk.php                              24-Jun-2024 06:05                7153
function.snmpwalkoid.php                           24-Jun-2024 06:05                7813
function.socket-accept.php                         24-Jun-2024 06:05                6934
function.socket-addrinfo-bind.php                  24-Jun-2024 06:05                5513
function.socket-addrinfo-connect.php               24-Jun-2024 06:05                5321
function.socket-addrinfo-explain.php               24-Jun-2024 06:05                4561
function.socket-addrinfo-lookup.php                24-Jun-2024 06:05                6123
function.socket-atmark.php                         24-Jun-2024 06:05                5038
function.socket-bind.php                           24-Jun-2024 06:05               11104
function.socket-clear-error.php                    24-Jun-2024 06:05                4756
function.socket-close.php                          24-Jun-2024 06:05                4673
function.socket-cmsg-space.php                     24-Jun-2024 06:05                3803
function.socket-connect.php                        24-Jun-2024 06:05                7844
function.socket-create-listen.php                  24-Jun-2024 06:05                7226
function.socket-create-pair.php                    24-Jun-2024 06:05               19869
function.socket-create.php                         24-Jun-2024 06:05               12690
function.socket-export-stream.php                  24-Jun-2024 06:05                3614
function.socket-get-option.php                     24-Jun-2024 06:05               32252
function.socket-get-status.php                     24-Jun-2024 06:05                1870
function.socket-getopt.php                         24-Jun-2024 06:05                1853
function.socket-getpeername.php                    24-Jun-2024 06:05                8466
function.socket-getsockname.php                    24-Jun-2024 06:05                7785
function.socket-import-stream.php                  24-Jun-2024 06:05                5231
function.socket-last-error.php                     24-Jun-2024 06:05                7394
function.socket-listen.php                         24-Jun-2024 06:05                7434
function.socket-read.php                           24-Jun-2024 06:05                8102
function.socket-recv.php                           24-Jun-2024 06:05               16686
function.socket-recvfrom.php                       24-Jun-2024 06:05               13934
function.socket-recvmsg.php                        24-Jun-2024 06:05                4520
function.socket-select.php                         24-Jun-2024 06:05               15743
function.socket-send.php                           24-Jun-2024 06:05                6971
function.socket-sendmsg.php                        24-Jun-2024 06:05                4648
function.socket-sendto.php                         24-Jun-2024 06:05               10235
function.socket-set-block.php                      24-Jun-2024 06:05                6271
function.socket-set-blocking.php                   24-Jun-2024 06:05                1890
function.socket-set-nonblock.php                   24-Jun-2024 06:05                6701
function.socket-set-option.php                     24-Jun-2024 06:05               11604
function.socket-set-timeout.php                    24-Jun-2024 06:05                1858
function.socket-setopt.php                         24-Jun-2024 06:05                1847
function.socket-shutdown.php                       24-Jun-2024 06:05                5092
function.socket-strerror.php                       24-Jun-2024 06:05                7232
function.socket-write.php                          24-Jun-2024 06:05                7460
function.socket-wsaprotocol-info-export.php        24-Jun-2024 06:05                5159
function.socket-wsaprotocol-info-import.php        24-Jun-2024 06:05                4508
function.socket-wsaprotocol-info-release.php       24-Jun-2024 06:05                3683
function.sodium-add.php                            24-Jun-2024 06:05                3307
function.sodium-base642bin.php                     24-Jun-2024 06:05                4756
function.sodium-bin2base64.php                     24-Jun-2024 06:05                4252
function.sodium-bin2hex.php                        24-Jun-2024 06:05                2910
function.sodium-compare.php                        24-Jun-2024 06:05                3482
function.sodium-crypto-aead-aes256gcm-decrypt.php  24-Jun-2024 06:05                4827
function.sodium-crypto-aead-aes256gcm-encrypt.php  24-Jun-2024 06:05                4633
function.sodium-crypto-aead-aes256gcm-is-availa..> 24-Jun-2024 06:05                2877
function.sodium-crypto-aead-aes256gcm-keygen.php   24-Jun-2024 06:05                2867
function.sodium-crypto-aead-chacha20poly1305-de..> 24-Jun-2024 06:05                4692
function.sodium-crypto-aead-chacha20poly1305-en..> 24-Jun-2024 06:05                4508
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-Jun-2024 06:05                4922
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-Jun-2024 06:05                4674
function.sodium-crypto-aead-chacha20poly1305-ie..> 24-Jun-2024 06:05                3061
function.sodium-crypto-aead-chacha20poly1305-ke..> 24-Jun-2024 06:05                2996
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-Jun-2024 06:05                5100
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-Jun-2024 06:05                4892
function.sodium-crypto-aead-xchacha20poly1305-i..> 24-Jun-2024 06:05                3037
function.sodium-crypto-auth-keygen.php             24-Jun-2024 06:05                2688
function.sodium-crypto-auth-verify.php             24-Jun-2024 06:05                4019
function.sodium-crypto-auth.php                    24-Jun-2024 06:05                3485
function.sodium-crypto-box-keypair-from-secretk..> 24-Jun-2024 06:05                3564
function.sodium-crypto-box-keypair.php             24-Jun-2024 06:05                2969
function.sodium-crypto-box-open.php                24-Jun-2024 06:05                4127
function.sodium-crypto-box-publickey-from-secre..> 24-Jun-2024 06:05                3395
function.sodium-crypto-box-publickey.php           24-Jun-2024 06:05                3108
function.sodium-crypto-box-seal-open.php           24-Jun-2024 06:05                6198
function.sodium-crypto-box-seal.php                24-Jun-2024 06:05                7325
function.sodium-crypto-box-secretkey.php           24-Jun-2024 06:05                3075
function.sodium-crypto-box-seed-keypair.php        24-Jun-2024 06:05                3134
function.sodium-crypto-box.php                     24-Jun-2024 06:05                4451
function.sodium-crypto-core-ristretto255-add.php   24-Jun-2024 06:05                6164
function.sodium-crypto-core-ristretto255-from-h..> 24-Jun-2024 06:05                5545
function.sodium-crypto-core-ristretto255-is-val..> 24-Jun-2024 06:05                5689
function.sodium-crypto-core-ristretto255-random..> 24-Jun-2024 06:05                5675
function.sodium-crypto-core-ristretto255-scalar..> 24-Jun-2024 06:05                6431
function.sodium-crypto-core-ristretto255-scalar..> 24-Jun-2024 06:05                3676
function.sodium-crypto-core-ristretto255-scalar..> 24-Jun-2024 06:05                5523
function.sodium-crypto-core-ristretto255-scalar..> 24-Jun-2024 06:05                3935
function.sodium-crypto-core-ristretto255-scalar..> 24-Jun-2024 06:05                5507
function.sodium-crypto-core-ristretto255-scalar..> 24-Jun-2024 06:05                5834
function.sodium-crypto-core-ristretto255-scalar..> 24-Jun-2024 06:05                3620
function.sodium-crypto-core-ristretto255-scalar..> 24-Jun-2024 06:05                6422
function.sodium-crypto-core-ristretto255-sub.php   24-Jun-2024 06:05                6201
function.sodium-crypto-generichash-final.php       24-Jun-2024 06:05                6950
function.sodium-crypto-generichash-init.php        24-Jun-2024 06:05                6996
function.sodium-crypto-generichash-keygen.php      24-Jun-2024 06:05                2498
function.sodium-crypto-generichash-update.php      24-Jun-2024 06:05                6631
function.sodium-crypto-generichash.php             24-Jun-2024 06:05                3890
function.sodium-crypto-kdf-derive-from-key.php     24-Jun-2024 06:05                4101
function.sodium-crypto-kdf-keygen.php              24-Jun-2024 06:05                2600
function.sodium-crypto-kx-client-session-keys.php  24-Jun-2024 06:05                3517
function.sodium-crypto-kx-keypair.php              24-Jun-2024 06:05                5068
function.sodium-crypto-kx-publickey.php            24-Jun-2024 06:05                2927
function.sodium-crypto-kx-secretkey.php            24-Jun-2024 06:05                2938
function.sodium-crypto-kx-seed-keypair.php         24-Jun-2024 06:05                2873
function.sodium-crypto-kx-server-session-keys.php  24-Jun-2024 06:05                3583
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-Jun-2024 06:05                3478
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-Jun-2024 06:05                3681
function.sodium-crypto-pwhash-scryptsalsa208sha..> 24-Jun-2024 06:05                6583
function.sodium-crypto-pwhash-str-needs-rehash.php 24-Jun-2024 06:05                4060
function.sodium-crypto-pwhash-str-verify.php       24-Jun-2024 06:05                4908
function.sodium-crypto-pwhash-str.php              24-Jun-2024 06:05                8747
function.sodium-crypto-pwhash.php                  24-Jun-2024 06:05               10568
function.sodium-crypto-scalarmult-base.php         24-Jun-2024 06:05                2098
function.sodium-crypto-scalarmult-ristretto255-..> 24-Jun-2024 06:05                3589
function.sodium-crypto-scalarmult-ristretto255.php 24-Jun-2024 06:05                3938
function.sodium-crypto-scalarmult.php              24-Jun-2024 06:05                3109
function.sodium-crypto-secretbox-keygen.php        24-Jun-2024 06:05                6332
function.sodium-crypto-secretbox-open.php          24-Jun-2024 06:05                8938
function.sodium-crypto-secretbox.php               24-Jun-2024 06:05                8944
function.sodium-crypto-secretstream-xchacha20po..> 24-Jun-2024 06:05               11077
function.sodium-crypto-secretstream-xchacha20po..> 24-Jun-2024 06:05               10411
function.sodium-crypto-secretstream-xchacha20po..> 24-Jun-2024 06:05                2764
function.sodium-crypto-secretstream-xchacha20po..> 24-Jun-2024 06:05                5867
function.sodium-crypto-secretstream-xchacha20po..> 24-Jun-2024 06:05                5975
function.sodium-crypto-secretstream-xchacha20po..> 24-Jun-2024 06:05                3021
function.sodium-crypto-shorthash-keygen.php        24-Jun-2024 06:05                2745
function.sodium-crypto-shorthash.php               24-Jun-2024 06:05                3318
function.sodium-crypto-sign-detached.php           24-Jun-2024 06:05                3311
function.sodium-crypto-sign-ed25519-pk-to-curve..> 24-Jun-2024 06:05                2998
function.sodium-crypto-sign-ed25519-sk-to-curve..> 24-Jun-2024 06:05                3151
function.sodium-crypto-sign-keypair-from-secret..> 24-Jun-2024 06:05                3390
function.sodium-crypto-sign-keypair.php            24-Jun-2024 06:05                2486
function.sodium-crypto-sign-open.php               24-Jun-2024 06:05                3396
function.sodium-crypto-sign-publickey-from-secr..> 24-Jun-2024 06:05                2953
function.sodium-crypto-sign-publickey.php          24-Jun-2024 06:05                2963
function.sodium-crypto-sign-secretkey.php          24-Jun-2024 06:05                2939
function.sodium-crypto-sign-seed-keypair.php       24-Jun-2024 06:05                3172
function.sodium-crypto-sign-verify-detached.php    24-Jun-2024 06:05                3699
function.sodium-crypto-sign.php                    24-Jun-2024 06:05                3389
function.sodium-crypto-stream-keygen.php           24-Jun-2024 06:05                2669
function.sodium-crypto-stream-xchacha20-keygen.php 24-Jun-2024 06:05                2827
function.sodium-crypto-stream-xchacha20-xor-ic.php 24-Jun-2024 06:05                9858
function.sodium-crypto-stream-xchacha20-xor.php    24-Jun-2024 06:05                4932
function.sodium-crypto-stream-xchacha20.php        24-Jun-2024 06:05                3845
function.sodium-crypto-stream-xor.php              24-Jun-2024 06:05                3728
function.sodium-crypto-stream.php                  24-Jun-2024 06:05                3564
function.sodium-hex2bin.php                        24-Jun-2024 06:05                3495
function.sodium-increment.php                      24-Jun-2024 06:05                2578
function.sodium-memcmp.php                         24-Jun-2024 06:05                3802
function.sodium-memzero.php                        24-Jun-2024 06:05                2647
function.sodium-pad.php                            24-Jun-2024 06:05                2940
function.sodium-unpad.php                          24-Jun-2024 06:05                2903
function.solr-get-version.php                      24-Jun-2024 06:05                3994
function.sort.php                                  24-Jun-2024 06:06               12640
function.soundex.php                               24-Jun-2024 06:06                7371
function.spl-autoload-call.php                     24-Jun-2024 06:05                2724
function.spl-autoload-extensions.php               24-Jun-2024 06:05                5142
function.spl-autoload-functions.php                24-Jun-2024 06:05                3370
function.spl-autoload-register.php                 24-Jun-2024 06:05               13674
function.spl-autoload-unregister.php               24-Jun-2024 06:05                3190
function.spl-autoload.php                          24-Jun-2024 06:05                4862
function.spl-classes.php                           24-Jun-2024 06:05                3862
function.spl-object-hash.php                       24-Jun-2024 06:05                5180
function.spl-object-id.php                         24-Jun-2024 06:05                4260
function.sprintf.php                               24-Jun-2024 06:06               29515
function.sqlsrv-begin-transaction.php              24-Jun-2024 06:05               11412
function.sqlsrv-cancel.php                         24-Jun-2024 06:05               10497
function.sqlsrv-client-info.php                    24-Jun-2024 06:05                6852
function.sqlsrv-close.php                          24-Jun-2024 06:05                5659
function.sqlsrv-commit.php                         24-Jun-2024 06:05               11252
function.sqlsrv-configure.php                      24-Jun-2024 06:05                4829
function.sqlsrv-connect.php                        24-Jun-2024 06:05               12444
function.sqlsrv-errors.php                         24-Jun-2024 06:05               10174
function.sqlsrv-execute.php                        24-Jun-2024 06:05               10345
function.sqlsrv-fetch-array.php                    24-Jun-2024 06:05               15878
function.sqlsrv-fetch-object.php                   24-Jun-2024 06:05               12859
function.sqlsrv-fetch.php                          24-Jun-2024 06:05               11067
function.sqlsrv-field-metadata.php                 24-Jun-2024 06:05                8998
function.sqlsrv-free-stmt.php                      24-Jun-2024 06:05                7891
function.sqlsrv-get-config.php                     24-Jun-2024 06:05                3422
function.sqlsrv-get-field.php                      24-Jun-2024 06:05               10497
function.sqlsrv-has-rows.php                       24-Jun-2024 06:05                6447
function.sqlsrv-next-result.php                    24-Jun-2024 06:05                9433
function.sqlsrv-num-fields.php                     24-Jun-2024 06:05                8343
function.sqlsrv-num-rows.php                       24-Jun-2024 06:05                8106
function.sqlsrv-prepare.php                        24-Jun-2024 06:05               14809
function.sqlsrv-query.php                          24-Jun-2024 06:05               12102
function.sqlsrv-rollback.php                       24-Jun-2024 06:05               10705
function.sqlsrv-rows-affected.php                  24-Jun-2024 06:05                8097
function.sqlsrv-send-stream-data.php               24-Jun-2024 06:05                8667
function.sqlsrv-server-info.php                    24-Jun-2024 06:05                6256
function.sqrt.php                                  24-Jun-2024 06:05                4662
function.srand.php                                 24-Jun-2024 06:05                7524
function.sscanf.php                                24-Jun-2024 06:06               11790
function.ssdeep-fuzzy-compare.php                  24-Jun-2024 06:06                3335
function.ssdeep-fuzzy-hash-filename.php            24-Jun-2024 06:06                3045
function.ssdeep-fuzzy-hash.php                     24-Jun-2024 06:06                2887
function.ssh2-auth-agent.php                       24-Jun-2024 06:05                4833
function.ssh2-auth-hostbased-file.php              24-Jun-2024 06:05                7797
function.ssh2-auth-none.php                        24-Jun-2024 06:05                4923
function.ssh2-auth-password.php                    24-Jun-2024 06:05                5083
function.ssh2-auth-pubkey-file.php                 24-Jun-2024 06:05                7298
function.ssh2-connect.php                          24-Jun-2024 06:05               15817
function.ssh2-disconnect.php                       24-Jun-2024 06:05                3153
function.ssh2-exec.php                             24-Jun-2024 06:05                7687
function.ssh2-fetch-stream.php                     24-Jun-2024 06:05                5601
function.ssh2-fingerprint.php                      24-Jun-2024 06:05                5594
function.ssh2-forward-accept.php                   24-Jun-2024 06:05                3118
function.ssh2-forward-listen.php                   24-Jun-2024 06:05                4563
function.ssh2-methods-negotiated.php               24-Jun-2024 06:05                8059
function.ssh2-poll.php                             24-Jun-2024 06:05                3603
function.ssh2-publickey-add.php                    24-Jun-2024 06:05                8499
function.ssh2-publickey-init.php                   24-Jun-2024 06:05                4730
function.ssh2-publickey-list.php                   24-Jun-2024 06:05                8893
function.ssh2-publickey-remove.php                 24-Jun-2024 06:05                4774
function.ssh2-scp-recv.php                         24-Jun-2024 06:05                5532
function.ssh2-scp-send.php                         24-Jun-2024 06:05                6143
function.ssh2-send-eof.php                         24-Jun-2024 06:05                3506
function.ssh2-sftp-chmod.php                       24-Jun-2024 06:05                6063
function.ssh2-sftp-lstat.php                       24-Jun-2024 06:05                7427
function.ssh2-sftp-mkdir.php                       24-Jun-2024 06:05                6926
function.ssh2-sftp-readlink.php                    24-Jun-2024 06:05                5428
function.ssh2-sftp-realpath.php                    24-Jun-2024 06:05                5623
function.ssh2-sftp-rename.php                      24-Jun-2024 06:05                5642
function.ssh2-sftp-rmdir.php                       24-Jun-2024 06:05                5631
function.ssh2-sftp-stat.php                        24-Jun-2024 06:05                7342
function.ssh2-sftp-symlink.php                     24-Jun-2024 06:05                5852
function.ssh2-sftp-unlink.php                      24-Jun-2024 06:05                5101
function.ssh2-sftp.php                             24-Jun-2024 06:05                5533
function.ssh2-shell.php                            24-Jun-2024 06:05                8148
function.ssh2-tunnel.php                           24-Jun-2024 06:05                5413
function.stat.php                                  24-Jun-2024 06:05               16716
function.stats-absolute-deviation.php              24-Jun-2024 06:05                2893
function.stats-cdf-beta.php                        24-Jun-2024 06:05                5245
function.stats-cdf-binomial.php                    24-Jun-2024 06:05                5230
function.stats-cdf-cauchy.php                      24-Jun-2024 06:05                5265
function.stats-cdf-chisquare.php                   24-Jun-2024 06:05                4584
function.stats-cdf-exponential.php                 24-Jun-2024 06:05                4615
function.stats-cdf-f.php                           24-Jun-2024 06:05                5170
function.stats-cdf-gamma.php                       24-Jun-2024 06:05                5229
function.stats-cdf-laplace.php                     24-Jun-2024 06:05                5250
function.stats-cdf-logistic.php                    24-Jun-2024 06:05                5285
function.stats-cdf-negative-binomial.php           24-Jun-2024 06:05                5373
function.stats-cdf-noncentral-chisquare.php        24-Jun-2024 06:05                5475
function.stats-cdf-noncentral-f.php                24-Jun-2024 06:05                6049
function.stats-cdf-noncentral-t.php                24-Jun-2024 06:05                5335
function.stats-cdf-normal.php                      24-Jun-2024 06:05                5267
function.stats-cdf-poisson.php                     24-Jun-2024 06:05                4549
function.stats-cdf-t.php                           24-Jun-2024 06:05                4477
function.stats-cdf-uniform.php                     24-Jun-2024 06:05                5230
function.stats-cdf-weibull.php                     24-Jun-2024 06:05                5267
function.stats-covariance.php                      24-Jun-2024 06:05                3078
function.stats-dens-beta.php                       24-Jun-2024 06:05                3564
function.stats-dens-cauchy.php                     24-Jun-2024 06:05                3622
function.stats-dens-chisquare.php                  24-Jun-2024 06:05                3292
function.stats-dens-exponential.php                24-Jun-2024 06:05                3282
function.stats-dens-f.php                          24-Jun-2024 06:05                3562
function.stats-dens-gamma.php                      24-Jun-2024 06:05                3615
function.stats-dens-laplace.php                    24-Jun-2024 06:05                3649
function.stats-dens-logistic.php                   24-Jun-2024 06:05                3661
function.stats-dens-normal.php                     24-Jun-2024 06:05                3632
function.stats-dens-pmf-binomial.php               24-Jun-2024 06:05                3686
function.stats-dens-pmf-hypergeometric.php         24-Jun-2024 06:05                4338
function.stats-dens-pmf-negative-binomial.php      24-Jun-2024 06:05                3815
function.stats-dens-pmf-poisson.php                24-Jun-2024 06:05                3283
function.stats-dens-t.php                          24-Jun-2024 06:05                3196
function.stats-dens-uniform.php                    24-Jun-2024 06:05                3597
function.stats-dens-weibull.php                    24-Jun-2024 06:05                3629
function.stats-harmonic-mean.php                   24-Jun-2024 06:05                2777
function.stats-kurtosis.php                        24-Jun-2024 06:05                2785
function.stats-rand-gen-beta.php                   24-Jun-2024 06:05                3091
function.stats-rand-gen-chisquare.php              24-Jun-2024 06:05                2764
function.stats-rand-gen-exponential.php            24-Jun-2024 06:05                2762
function.stats-rand-gen-f.php                      24-Jun-2024 06:05                3145
function.stats-rand-gen-funiform.php               24-Jun-2024 06:05                3072
function.stats-rand-gen-gamma.php                  24-Jun-2024 06:05                3158
function.stats-rand-gen-ibinomial-negative.php     24-Jun-2024 06:05                3238
function.stats-rand-gen-ibinomial.php              24-Jun-2024 06:05                3162
function.stats-rand-gen-int.php                    24-Jun-2024 06:05                2336
function.stats-rand-gen-ipoisson.php               24-Jun-2024 06:05                2737
function.stats-rand-gen-iuniform.php               24-Jun-2024 06:05                3139
function.stats-rand-gen-noncentral-chisquare.php   24-Jun-2024 06:05                3280
function.stats-rand-gen-noncentral-f.php           24-Jun-2024 06:05                3633
function.stats-rand-gen-noncentral-t.php           24-Jun-2024 06:05                3193
function.stats-rand-gen-normal.php                 24-Jun-2024 06:05                3106
function.stats-rand-gen-t.php                      24-Jun-2024 06:05                2656
function.stats-rand-get-seeds.php                  24-Jun-2024 06:05                2379
function.stats-rand-phrase-to-seeds.php            24-Jun-2024 06:05                2745
function.stats-rand-ranf.php                       24-Jun-2024 06:05                2380
function.stats-rand-setall.php                     24-Jun-2024 06:05                3014
function.stats-skew.php                            24-Jun-2024 06:05                2751
function.stats-standard-deviation.php              24-Jun-2024 06:05                3920
function.stats-stat-binomial-coef.php              24-Jun-2024 06:05                3051
function.stats-stat-correlation.php                24-Jun-2024 06:05                3258
function.stats-stat-factorial.php                  24-Jun-2024 06:05                2624
function.stats-stat-independent-t.php              24-Jun-2024 06:05                3373
function.stats-stat-innerproduct.php               24-Jun-2024 06:05                3200
function.stats-stat-paired-t.php                   24-Jun-2024 06:05                3137
function.stats-stat-percentile.php                 24-Jun-2024 06:05                3003
function.stats-stat-powersum.php                   24-Jun-2024 06:05                2995
function.stats-variance.php                        24-Jun-2024 06:05                3422
function.stomp-connect-error.php                   24-Jun-2024 06:05                3770
function.stomp-version.php                         24-Jun-2024 06:05                3186
function.str-contains.php                          24-Jun-2024 06:06                8416
function.str-decrement.php                         24-Jun-2024 06:06                6581
function.str-ends-with.php                         24-Jun-2024 06:06                8353
function.str-getcsv.php                            24-Jun-2024 06:06                9484
function.str-increment.php                         24-Jun-2024 06:06                6268
function.str-ireplace.php                          24-Jun-2024 06:06                9741
function.str-pad.php                               24-Jun-2024 06:06                8470
function.str-repeat.php                            24-Jun-2024 06:06                4800
function.str-replace.php                           24-Jun-2024 06:06               17514
function.str-rot13.php                             24-Jun-2024 06:06                3712
function.str-shuffle.php                           24-Jun-2024 06:06                6224
function.str-split.php                             24-Jun-2024 06:06                8823
function.str-starts-with.php                       24-Jun-2024 06:06                8360
function.str-word-count.php                        24-Jun-2024 06:06                9371
function.strcasecmp.php                            24-Jun-2024 06:06                6392
function.strchr.php                                24-Jun-2024 06:06                1710
function.strcmp.php                                24-Jun-2024 06:06                6142
function.strcoll.php                               24-Jun-2024 06:06                5166
function.strcspn.php                               24-Jun-2024 06:06               11737
function.stream-bucket-append.php                  24-Jun-2024 06:05                2352
function.stream-bucket-make-writeable.php          24-Jun-2024 06:05                4489
function.stream-bucket-new.php                     24-Jun-2024 06:05                2362
function.stream-bucket-prepend.php                 24-Jun-2024 06:05                6430
function.stream-context-create.php                 24-Jun-2024 06:05                8020
function.stream-context-get-default.php            24-Jun-2024 06:05                9086
function.stream-context-get-options.php            24-Jun-2024 06:05                4618
function.stream-context-get-params.php             24-Jun-2024 06:05                5659
function.stream-context-set-default.php            24-Jun-2024 06:05                6397
function.stream-context-set-option.php             24-Jun-2024 06:05                5659
function.stream-context-set-options.php            24-Jun-2024 06:05                6550
function.stream-context-set-params.php             24-Jun-2024 06:05                4874
function.stream-copy-to-stream.php                 24-Jun-2024 06:05                7924
function.stream-filter-append.php                  24-Jun-2024 06:05               11307
function.stream-filter-prepend.php                 24-Jun-2024 06:05                8558
function.stream-filter-register.php                24-Jun-2024 06:05               18707
function.stream-filter-remove.php                  24-Jun-2024 06:05                6761
function.stream-get-contents.php                   24-Jun-2024 06:05                9229
function.stream-get-filters.php                    24-Jun-2024 06:05                4143
function.stream-get-line.php                       24-Jun-2024 06:05                5221
function.stream-get-meta-data.php                  24-Jun-2024 06:05               14917
function.stream-get-transports.php                 24-Jun-2024 06:05                4133
function.stream-get-wrappers.php                   24-Jun-2024 06:05                4923
function.stream-is-local.php                       24-Jun-2024 06:05                4338
function.stream-isatty.php                         24-Jun-2024 06:05                4097
function.stream-notification-callback.php          24-Jun-2024 06:05               22777
function.stream-register-wrapper.php               24-Jun-2024 06:05                1975
function.stream-resolve-include-path.php           24-Jun-2024 06:05                4471
function.stream-select.php                         24-Jun-2024 06:05               16862
function.stream-set-blocking.php                   24-Jun-2024 06:05                4996
function.stream-set-chunk-size.php                 24-Jun-2024 06:05                4407
function.stream-set-read-buffer.php                24-Jun-2024 06:05                3852
function.stream-set-timeout.php                    24-Jun-2024 06:05                8207
function.stream-set-write-buffer.php               24-Jun-2024 06:05                6004
function.stream-socket-accept.php                  24-Jun-2024 06:05                7763
function.stream-socket-client.php                  24-Jun-2024 06:05               18188
function.stream-socket-enable-crypto.php           24-Jun-2024 06:05               13611
function.stream-socket-get-name.php                24-Jun-2024 06:05                3972
function.stream-socket-pair.php                    24-Jun-2024 06:05               10002
function.stream-socket-recvfrom.php                24-Jun-2024 06:05               11011
function.stream-socket-sendto.php                  24-Jun-2024 06:05                7748
function.stream-socket-server.php                  24-Jun-2024 06:05               15785
function.stream-socket-shutdown.php                24-Jun-2024 06:05                6710
function.stream-supports-lock.php                  24-Jun-2024 06:05                3314
function.stream-wrapper-register.php               24-Jun-2024 06:05                9591
function.stream-wrapper-restore.php                24-Jun-2024 06:05                3003
function.stream-wrapper-unregister.php             24-Jun-2024 06:05                3232
function.strftime.php                              24-Jun-2024 06:05               56331
function.strip-tags.php                            24-Jun-2024 06:06                9574
function.stripcslashes.php                         24-Jun-2024 06:06                4110
function.stripos.php                               24-Jun-2024 06:06               12272
function.stripslashes.php                          24-Jun-2024 06:06                7676
function.stristr.php                               24-Jun-2024 06:06               10752
function.strlen.php                                24-Jun-2024 06:06                5110
function.strnatcasecmp.php                         24-Jun-2024 06:06                7765
function.strnatcmp.php                             24-Jun-2024 06:06                8997
function.strncasecmp.php                           24-Jun-2024 06:06                6993
function.strncmp.php                               24-Jun-2024 06:06                6993
function.strpbrk.php                               24-Jun-2024 06:06                5452
function.strpos.php                                24-Jun-2024 06:06               14065
function.strptime.php                              24-Jun-2024 06:05               12174
function.strrchr.php                               24-Jun-2024 06:06                8663
function.strrev.php                                24-Jun-2024 06:06                3242
function.strripos.php                              24-Jun-2024 06:06               11069
function.strrpos.php                               24-Jun-2024 06:06               13599
function.strspn.php                                24-Jun-2024 06:06               11042
function.strstr.php                                24-Jun-2024 06:06                8964
function.strtok.php                                24-Jun-2024 06:06               13659
function.strtolower.php                            24-Jun-2024 06:06                6042
function.strtotime.php                             24-Jun-2024 06:05               13184
function.strtoupper.php                            24-Jun-2024 06:06                6011
function.strtr.php                                 24-Jun-2024 06:06               11952
function.strval.php                                24-Jun-2024 06:06                6652
function.substr-compare.php                        24-Jun-2024 06:06               11111
function.substr-count.php                          24-Jun-2024 06:06                9760
function.substr-replace.php                        24-Jun-2024 06:06               16581
function.substr.php                                24-Jun-2024 06:06               22804
function.svn-add.php                               24-Jun-2024 06:05                6490
function.svn-auth-get-parameter.php                24-Jun-2024 06:05                3998
function.svn-auth-set-parameter.php                24-Jun-2024 06:05                5454
function.svn-blame.php                             24-Jun-2024 06:05                5049
function.svn-cat.php                               24-Jun-2024 06:05                4874
function.svn-checkout.php                          24-Jun-2024 06:05                7479
function.svn-cleanup.php                           24-Jun-2024 06:05                5249
function.svn-client-version.php                    24-Jun-2024 06:05                3525
function.svn-commit.php                            24-Jun-2024 06:05                8161
function.svn-delete.php                            24-Jun-2024 06:05                4797
function.svn-diff.php                              24-Jun-2024 06:05               13480
function.svn-export.php                            24-Jun-2024 06:05                5433
function.svn-fs-abort-txn.php                      24-Jun-2024 06:05                3238
function.svn-fs-apply-text.php                     24-Jun-2024 06:05                2816
function.svn-fs-begin-txn2.php                     24-Jun-2024 06:05                2759
function.svn-fs-change-node-prop.php               24-Jun-2024 06:05                3287
function.svn-fs-check-path.php                     24-Jun-2024 06:05                2861
function.svn-fs-contents-changed.php               24-Jun-2024 06:05                3292
function.svn-fs-copy.php                           24-Jun-2024 06:05                4231
function.svn-fs-delete.php                         24-Jun-2024 06:05                3516
function.svn-fs-dir-entries.php                    24-Jun-2024 06:05                2874
function.svn-fs-file-contents.php                  24-Jun-2024 06:05                2897
function.svn-fs-file-length.php                    24-Jun-2024 06:05                2820
function.svn-fs-is-dir.php                         24-Jun-2024 06:05                3562
function.svn-fs-is-file.php                        24-Jun-2024 06:05                3550
function.svn-fs-make-dir.php                       24-Jun-2024 06:05                3540
function.svn-fs-make-file.php                      24-Jun-2024 06:05                3557
function.svn-fs-node-created-rev.php               24-Jun-2024 06:05                2863
function.svn-fs-node-prop.php                      24-Jun-2024 06:05                2961
function.svn-fs-props-changed.php                  24-Jun-2024 06:05                3279
function.svn-fs-revision-prop.php                  24-Jun-2024 06:05                2974
function.svn-fs-revision-root.php                  24-Jun-2024 06:05                2842
function.svn-fs-txn-root.php                       24-Jun-2024 06:05                2607
function.svn-fs-youngest-rev.php                   24-Jun-2024 06:05                2649
function.svn-import.php                            24-Jun-2024 06:05                6139
function.svn-log.php                               24-Jun-2024 06:05                9130
function.svn-ls.php                                24-Jun-2024 06:05                7384
function.svn-mkdir.php                             24-Jun-2024 06:05                3335
function.svn-repos-create.php                      24-Jun-2024 06:05                3027
function.svn-repos-fs-begin-txn-for-commit.php     24-Jun-2024 06:05                3347
function.svn-repos-fs-commit-txn.php               24-Jun-2024 06:05                2704
function.svn-repos-fs.php                          24-Jun-2024 06:05                2604
function.svn-repos-hotcopy.php                     24-Jun-2024 06:05                2973
function.svn-repos-open.php                        24-Jun-2024 06:05                2576
function.svn-repos-recover.php                     24-Jun-2024 06:05                2620
function.svn-revert.php                            24-Jun-2024 06:05                3672
function.svn-status.php                            24-Jun-2024 06:05               14888
function.svn-update.php                            24-Jun-2024 06:05                6276
function.swoole-async-dns-lookup.php               24-Jun-2024 06:05                3951
function.swoole-async-read.php                     24-Jun-2024 06:05                4537
function.swoole-async-readfile.php                 24-Jun-2024 06:05                3937
function.swoole-async-set.php                      24-Jun-2024 06:05                2480
function.swoole-async-write.php                    24-Jun-2024 06:05                3844
function.swoole-async-writefile.php                24-Jun-2024 06:05                3848
function.swoole-clear-error.php                    24-Jun-2024 06:05                2346
function.swoole-client-select.php                  24-Jun-2024 06:05                3548
function.swoole-cpu-num.php                        24-Jun-2024 06:05                2194
function.swoole-errno.php                          24-Jun-2024 06:05                2175
function.swoole-error-log.php                      24-Jun-2024 06:05                3649
function.swoole-event-add.php                      24-Jun-2024 06:05                3553
function.swoole-event-defer.php                    24-Jun-2024 06:05                2725
function.swoole-event-del.php                      24-Jun-2024 06:05                2687
function.swoole-event-exit.php                     24-Jun-2024 06:05                2233
function.swoole-event-set.php                      24-Jun-2024 06:05                3545
function.swoole-event-wait.php                     24-Jun-2024 06:05                2206
function.swoole-event-write.php                    24-Jun-2024 06:05                2934
function.swoole-get-local-ip.php                   24-Jun-2024 06:05                2259
function.swoole-last-error.php                     24-Jun-2024 06:05                2223
function.swoole-load-module.php                    24-Jun-2024 06:05                2380
function.swoole-select.php                         24-Jun-2024 06:05                3517
function.swoole-set-process-name.php               24-Jun-2024 06:05                2694
function.swoole-strerror.php                       24-Jun-2024 06:05                2643
function.swoole-timer-after.php                    24-Jun-2024 06:05                3063
function.swoole-timer-exists.php                   24-Jun-2024 06:05                2504
function.swoole-timer-tick.php                     24-Jun-2024 06:05                2963
function.swoole-version.php                        24-Jun-2024 06:05                2195
function.symlink.php                               24-Jun-2024 06:05                5748
function.sys-get-temp-dir.php                      24-Jun-2024 06:05                4219
function.sys-getloadavg.php                        24-Jun-2024 06:05                4306
function.syslog.php                                24-Jun-2024 06:05                9393
function.system.php                                24-Jun-2024 06:05                7839
function.taint.php                                 24-Jun-2024 06:05                2730
function.tan.php                                   24-Jun-2024 06:05                4365
function.tanh.php                                  24-Jun-2024 06:05                3272
function.tcpwrap-check.php                         24-Jun-2024 06:05                5907
function.tempnam.php                               24-Jun-2024 06:05                7285
function.textdomain.php                            24-Jun-2024 06:05                3294
function.tidy-access-count.php                     24-Jun-2024 06:05                6462
function.tidy-config-count.php                     24-Jun-2024 06:05                4375
function.tidy-error-count.php                      24-Jun-2024 06:05                5386
function.tidy-get-output.php                       24-Jun-2024 06:05                4333
function.tidy-warning-count.php                    24-Jun-2024 06:05                4950
function.time-nanosleep.php                        24-Jun-2024 06:05                8784
function.time-sleep-until.php                      24-Jun-2024 06:05                5941
function.time.php                                  24-Jun-2024 06:05                4669
function.timezone-abbreviations-list.php           24-Jun-2024 06:05                1975
function.timezone-identifiers-list.php             24-Jun-2024 06:05                1991
function.timezone-location-get.php                 24-Jun-2024 06:05                1947
function.timezone-name-from-abbr.php               24-Jun-2024 06:05                6434
function.timezone-name-get.php                     24-Jun-2024 06:05                1891
function.timezone-offset-get.php                   24-Jun-2024 06:05                1889
function.timezone-open.php                         24-Jun-2024 06:05                1877
function.timezone-transitions-get.php              24-Jun-2024 06:05                1950
function.timezone-version-get.php                  24-Jun-2024 06:05                4523
function.tmpfile.php                               24-Jun-2024 06:05                5590
function.token-get-all.php                         24-Jun-2024 06:05               12094
function.token-name.php                            24-Jun-2024 06:05                4228
function.touch.php                                 24-Jun-2024 06:05                8302
function.trader-acos.php                           24-Jun-2024 06:05                2543
function.trader-ad.php                             24-Jun-2024 06:05                3465
function.trader-add.php                            24-Jun-2024 06:05                2864
function.trader-adosc.php                          24-Jun-2024 06:05                4339
function.trader-adx.php                            24-Jun-2024 06:05                3552
function.trader-adxr.php                           24-Jun-2024 06:05                3563
function.trader-apo.php                            24-Jun-2024 06:05                3740
function.trader-aroon.php                          24-Jun-2024 06:05                3111
function.trader-aroonosc.php                       24-Jun-2024 06:05                3148
function.trader-asin.php                           24-Jun-2024 06:05                2546
function.trader-atan.php                           24-Jun-2024 06:05                2539
function.trader-atr.php                            24-Jun-2024 06:05                3542
function.trader-avgprice.php                       24-Jun-2024 06:05                3524
function.trader-bbands.php                         24-Jun-2024 06:05                4515
function.trader-beta.php                           24-Jun-2024 06:05                3075
function.trader-bop.php                            24-Jun-2024 06:05                3473
function.trader-cci.php                            24-Jun-2024 06:05                3547
function.trader-cdl2crows.php                      24-Jun-2024 06:05                3546
function.trader-cdl3blackcrows.php                 24-Jun-2024 06:05                3608
function.trader-cdl3inside.php                     24-Jun-2024 06:05                3589
function.trader-cdl3linestrike.php                 24-Jun-2024 06:05                3612
function.trader-cdl3outside.php                    24-Jun-2024 06:05                3604
function.trader-cdl3starsinsouth.php               24-Jun-2024 06:05                3653
function.trader-cdl3whitesoldiers.php              24-Jun-2024 06:05                3677
function.trader-cdlabandonedbaby.php               24-Jun-2024 06:05                4061
function.trader-cdladvanceblock.php                24-Jun-2024 06:05                3630
function.trader-cdlbelthold.php                    24-Jun-2024 06:05                3586
function.trader-cdlbreakaway.php                   24-Jun-2024 06:05                3600
function.trader-cdlclosingmarubozu.php             24-Jun-2024 06:05                3671
function.trader-cdlconcealbabyswall.php            24-Jun-2024 06:05                3694
function.trader-cdlcounterattack.php               24-Jun-2024 06:05                3658
function.trader-cdldarkcloudcover.php              24-Jun-2024 06:05                4055
function.trader-cdldoji.php                        24-Jun-2024 06:05                3543
function.trader-cdldojistar.php                    24-Jun-2024 06:05                3578
function.trader-cdldragonflydoji.php               24-Jun-2024 06:05                3633
function.trader-cdlengulfing.php                   24-Jun-2024 06:05                3618
function.trader-cdleveningdojistar.php             24-Jun-2024 06:05                4072
function.trader-cdleveningstar.php                 24-Jun-2024 06:05                4049
function.trader-cdlgapsidesidewhite.php            24-Jun-2024 06:05                3701
function.trader-cdlgravestonedoji.php              24-Jun-2024 06:05                3654
function.trader-cdlhammer.php                      24-Jun-2024 06:05                3569
function.trader-cdlhangingman.php                  24-Jun-2024 06:05                3590
function.trader-cdlharami.php                      24-Jun-2024 06:05                3571
function.trader-cdlharamicross.php                 24-Jun-2024 06:05                3613
function.trader-cdlhighwave.php                    24-Jun-2024 06:05                3587
function.trader-cdlhikkake.php                     24-Jun-2024 06:05                3576
function.trader-cdlhikkakemod.php                  24-Jun-2024 06:05                3617
function.trader-cdlhomingpigeon.php                24-Jun-2024 06:05                3638
function.trader-cdlidentical3crows.php             24-Jun-2024 06:05                3662
function.trader-cdlinneck.php                      24-Jun-2024 06:05                3588
function.trader-cdlinvertedhammer.php              24-Jun-2024 06:05                3636
function.trader-cdlkicking.php                     24-Jun-2024 06:05                3590
function.trader-cdlkickingbylength.php             24-Jun-2024 06:05                3696
function.trader-cdlladderbottom.php                24-Jun-2024 06:05                3646
function.trader-cdllongleggeddoji.php              24-Jun-2024 06:05                3651
function.trader-cdllongline.php                    24-Jun-2024 06:05                3595
function.trader-cdlmarubozu.php                    24-Jun-2024 06:05                3581
function.trader-cdlmatchinglow.php                 24-Jun-2024 06:05                3607
function.trader-cdlmathold.php                     24-Jun-2024 06:05                3995
function.trader-cdlmorningdojistar.php             24-Jun-2024 06:05                4068
function.trader-cdlmorningstar.php                 24-Jun-2024 06:05                4029
function.trader-cdlonneck.php                      24-Jun-2024 06:05                3568
function.trader-cdlpiercing.php                    24-Jun-2024 06:05                3585
function.trader-cdlrickshawman.php                 24-Jun-2024 06:05                3625
function.trader-cdlrisefall3methods.php            24-Jun-2024 06:05                3695
function.trader-cdlseparatinglines.php             24-Jun-2024 06:05                3677
function.trader-cdlshootingstar.php                24-Jun-2024 06:05                3636
function.trader-cdlshortline.php                   24-Jun-2024 06:05                3608
function.trader-cdlspinningtop.php                 24-Jun-2024 06:05                3623
function.trader-cdlstalledpattern.php              24-Jun-2024 06:05                3658
function.trader-cdlsticksandwich.php               24-Jun-2024 06:05                3639
function.trader-cdltakuri.php                      24-Jun-2024 06:05                3610
function.trader-cdltasukigap.php                   24-Jun-2024 06:05                3585
function.trader-cdlthrusting.php                   24-Jun-2024 06:05                3594
function.trader-cdltristar.php                     24-Jun-2024 06:05                3582
function.trader-cdlunique3river.php                24-Jun-2024 06:05                3633
function.trader-cdlupsidegap2crows.php             24-Jun-2024 06:05                3681
function.trader-cdlxsidegap3methods.php            24-Jun-2024 06:05                3680
function.trader-ceil.php                           24-Jun-2024 06:05                2563
function.trader-cmo.php                            24-Jun-2024 06:05                2786
function.trader-correl.php                         24-Jun-2024 06:05                3127
function.trader-cos.php                            24-Jun-2024 06:05                2529
function.trader-cosh.php                           24-Jun-2024 06:05                2545
function.trader-dema.php                           24-Jun-2024 06:05                2797
function.trader-div.php                            24-Jun-2024 06:05                2880
function.trader-dx.php                             24-Jun-2024 06:05                3528
function.trader-ema.php                            24-Jun-2024 06:05                2780
function.trader-errno.php                          24-Jun-2024 06:05                2258
function.trader-exp.php                            24-Jun-2024 06:05                2573
function.trader-floor.php                          24-Jun-2024 06:05                2555
function.trader-get-compat.php                     24-Jun-2024 06:05                2448
function.trader-get-unstable-period.php            24-Jun-2024 06:05                2775
function.trader-ht-dcperiod.php                    24-Jun-2024 06:05                2543
function.trader-ht-dcphase.php                     24-Jun-2024 06:05                2514
function.trader-ht-phasor.php                      24-Jun-2024 06:05                2495
function.trader-ht-sine.php                        24-Jun-2024 06:05                2474
function.trader-ht-trendline.php                   24-Jun-2024 06:05                2535
function.trader-ht-trendmode.php                   24-Jun-2024 06:05                2525
function.trader-kama.php                           24-Jun-2024 06:05                2835
function.trader-linearreg-angle.php                24-Jun-2024 06:05                2929
function.trader-linearreg-intercept.php            24-Jun-2024 06:05                2987
function.trader-linearreg-slope.php                24-Jun-2024 06:05                2939
function.trader-linearreg.php                      24-Jun-2024 06:05                2851
function.trader-ln.php                             24-Jun-2024 06:05                2531
function.trader-log10.php                          24-Jun-2024 06:05                2535
function.trader-ma.php                             24-Jun-2024 06:05                3196
function.trader-macd.php                           24-Jun-2024 06:05                3741
function.trader-macdext.php                        24-Jun-2024 06:05                5235
function.trader-macdfix.php                        24-Jun-2024 06:05                2886
function.trader-mama.php                           24-Jun-2024 06:05                3230
function.trader-mavp.php                           24-Jun-2024 06:05                4148
function.trader-max.php                            24-Jun-2024 06:05                2801
function.trader-maxindex.php                       24-Jun-2024 06:05                2858
function.trader-medprice.php                       24-Jun-2024 06:05                2772
function.trader-mfi.php                            24-Jun-2024 06:05                3896
function.trader-midpoint.php                       24-Jun-2024 06:05                2832
function.trader-midprice.php                       24-Jun-2024 06:05                3162
function.trader-min.php                            24-Jun-2024 06:05                2808
function.trader-minindex.php                       24-Jun-2024 06:05                2853
function.trader-minmax.php                         24-Jun-2024 06:05                2857
function.trader-minmaxindex.php                    24-Jun-2024 06:05                2908
function.trader-minus-di.php                       24-Jun-2024 06:05                3615
function.trader-minus-dm.php                       24-Jun-2024 06:05                3162
function.trader-mom.php                            24-Jun-2024 06:05                2772
function.trader-mult.php                           24-Jun-2024 06:05                2880
function.trader-natr.php                           24-Jun-2024 06:05                3553
function.trader-obv.php                            24-Jun-2024 06:05                2724
function.trader-plus-di.php                        24-Jun-2024 06:05                3586
function.trader-plus-dm.php                        24-Jun-2024 06:05                3149
function.trader-ppo.php                            24-Jun-2024 06:05                3744
function.trader-roc.php                            24-Jun-2024 06:05                2796
function.trader-rocp.php                           24-Jun-2024 06:05                2824
function.trader-rocr.php                           24-Jun-2024 06:05                2809
function.trader-rocr100.php                        24-Jun-2024 06:05                2849
function.trader-rsi.php                            24-Jun-2024 06:05                2777
function.trader-sar.php                            24-Jun-2024 06:05                3787
function.trader-sarext.php                         24-Jun-2024 06:05                7199
function.trader-set-compat.php                     24-Jun-2024 06:05                2684
function.trader-set-unstable-period.php            24-Jun-2024 06:05                3272
function.trader-sin.php                            24-Jun-2024 06:05                2553
function.trader-sinh.php                           24-Jun-2024 06:05                2541
function.trader-sma.php                            24-Jun-2024 06:05                2777
function.trader-sqrt.php                           24-Jun-2024 06:05                2534
function.trader-stddev.php                         24-Jun-2024 06:05                3121
function.trader-stoch.php                          24-Jun-2024 06:05                5444
function.trader-stochf.php                         24-Jun-2024 06:05                4542
function.trader-stochrsi.php                       24-Jun-2024 06:05                4275
function.trader-sub.php                            24-Jun-2024 06:05                2885
function.trader-sum.php                            24-Jun-2024 06:05                2759
function.trader-t3.php                             24-Jun-2024 06:05                3143
function.trader-tan.php                            24-Jun-2024 06:05                2522
function.trader-tanh.php                           24-Jun-2024 06:05                2546
function.trader-tema.php                           24-Jun-2024 06:05                2803
function.trader-trange.php                         24-Jun-2024 06:05                3069
function.trader-trima.php                          24-Jun-2024 06:05                2805
function.trader-trix.php                           24-Jun-2024 06:05                2815
function.trader-tsf.php                            24-Jun-2024 06:05                2784
function.trader-typprice.php                       24-Jun-2024 06:05                3092
function.trader-ultosc.php                         24-Jun-2024 06:05                4404
function.trader-var.php                            24-Jun-2024 06:05                3091
function.trader-wclprice.php                       24-Jun-2024 06:05                3097
function.trader-willr.php                          24-Jun-2024 06:05                3559
function.trader-wma.php                            24-Jun-2024 06:05                2808
function.trait-exists.php                          24-Jun-2024 06:06                3171
function.trigger-error.php                         24-Jun-2024 06:05                8203
function.trim.php                                  24-Jun-2024 06:06               13835
function.uasort.php                                24-Jun-2024 06:06               10664
function.ucfirst.php                               24-Jun-2024 06:06                6199
function.ucwords.php                               24-Jun-2024 06:06                9896
function.ui-draw-text-font-fontfamilies.php        24-Jun-2024 06:06                2473
function.ui-quit.php                               24-Jun-2024 06:06                2098
function.ui-run.php                                24-Jun-2024 06:06                2475
function.uksort.php                                24-Jun-2024 06:06               10069
function.umask.php                                 24-Jun-2024 06:05                5815
function.uniqid.php                                24-Jun-2024 06:05                8546
function.unixtojd.php                              24-Jun-2024 06:05                4009
function.unlink.php                                24-Jun-2024 06:05                6245
function.unpack.php                                24-Jun-2024 06:05               10954
function.unregister-tick-function.php              24-Jun-2024 06:06                3283
function.unserialize.php                           24-Jun-2024 06:06               18110
function.unset.php                                 24-Jun-2024 06:06               15688
function.untaint.php                               24-Jun-2024 06:05                2590
function.uopz-add-function.php                     24-Jun-2024 06:05                7221
function.uopz-allow-exit.php                       24-Jun-2024 06:05                4689
function.uopz-backup.php                           24-Jun-2024 06:05                4621
function.uopz-compose.php                          24-Jun-2024 06:05                6893
function.uopz-copy.php                             24-Jun-2024 06:05                5208
function.uopz-del-function.php                     24-Jun-2024 06:05                6646
function.uopz-delete.php                           24-Jun-2024 06:05                6023
function.uopz-extend.php                           24-Jun-2024 06:05                5078
function.uopz-flags.php                            24-Jun-2024 06:05               11006
function.uopz-function.php                         24-Jun-2024 06:05                7355
function.uopz-get-exit-status.php                  24-Jun-2024 06:05                4249
function.uopz-get-hook.php                         24-Jun-2024 06:05                5400
function.uopz-get-mock.php                         24-Jun-2024 06:05                5002
function.uopz-get-property.php                     24-Jun-2024 06:05                6267
function.uopz-get-return.php                       24-Jun-2024 06:05                4489
function.uopz-get-static.php                       24-Jun-2024 06:05                5220
function.uopz-implement.php                        24-Jun-2024 06:05                5103
function.uopz-overload.php                         24-Jun-2024 06:05                3974
function.uopz-redefine.php                         24-Jun-2024 06:05                5188
function.uopz-rename.php                           24-Jun-2024 06:05                6808
function.uopz-restore.php                          24-Jun-2024 06:05                4988
function.uopz-set-hook.php                         24-Jun-2024 06:05                5726
function.uopz-set-mock.php                         24-Jun-2024 06:05               10869
function.uopz-set-property.php                     24-Jun-2024 06:05                7570
function.uopz-set-return.php                       24-Jun-2024 06:05                9671
function.uopz-set-static.php                       24-Jun-2024 06:05                5821
function.uopz-undefine.php                         24-Jun-2024 06:05                4746
function.uopz-unset-hook.php                       24-Jun-2024 06:05                5619
function.uopz-unset-mock.php                       24-Jun-2024 06:05                5362
function.uopz-unset-return.php                     24-Jun-2024 06:05                4965
function.urldecode.php                             24-Jun-2024 06:05                6377
function.urlencode.php                             24-Jun-2024 06:05                9679
function.use-soap-error-handler.php                24-Jun-2024 06:06                4130
function.user-error.php                            24-Jun-2024 06:05                1784
function.usleep.php                                24-Jun-2024 06:05                7105
function.usort.php                                 24-Jun-2024 06:06               27614
function.utf8-decode.php                           24-Jun-2024 06:06               18786
function.utf8-encode.php                           24-Jun-2024 06:06               15355
function.var-dump.php                              24-Jun-2024 06:06                7117
function.var-export.php                            24-Jun-2024 06:06               16742
function.var-representation.php                    24-Jun-2024 06:05               13459
function.variant-abs.php                           24-Jun-2024 06:06                4270
function.variant-add.php                           24-Jun-2024 06:06                5598
function.variant-and.php                           24-Jun-2024 06:06                7690
function.variant-cast.php                          24-Jun-2024 06:06                3582
function.variant-cat.php                           24-Jun-2024 06:06                4804
function.variant-cmp.php                           24-Jun-2024 06:06                8102
function.variant-date-from-timestamp.php           24-Jun-2024 06:06                3711
function.variant-date-to-timestamp.php             24-Jun-2024 06:06                3844
function.variant-div.php                           24-Jun-2024 06:06                6509
function.variant-eqv.php                           24-Jun-2024 06:06                4537
function.variant-fix.php                           24-Jun-2024 06:06                5629
function.variant-get-type.php                      24-Jun-2024 06:06                3572
function.variant-idiv.php                          24-Jun-2024 06:06                5875
function.variant-imp.php                           24-Jun-2024 06:06                7238
function.variant-int.php                           24-Jun-2024 06:06                5129
function.variant-mod.php                           24-Jun-2024 06:06                4878
function.variant-mul.php                           24-Jun-2024 06:06                5990
function.variant-neg.php                           24-Jun-2024 06:06                3939
function.variant-not.php                           24-Jun-2024 06:06                4205
function.variant-or.php                            24-Jun-2024 06:06                7846
function.variant-pow.php                           24-Jun-2024 06:06                4729
function.variant-round.php                         24-Jun-2024 06:06                4608
function.variant-set-type.php                      24-Jun-2024 06:06                3716
function.variant-set.php                           24-Jun-2024 06:06                2946
function.variant-sub.php                           24-Jun-2024 06:06                5560
function.variant-xor.php                           24-Jun-2024 06:06                6585
function.version-compare.php                       24-Jun-2024 06:05               11489
function.vfprintf.php                              24-Jun-2024 06:06               21065
function.virtual.php                               24-Jun-2024 06:06                5442
function.vprintf.php                               24-Jun-2024 06:06               20451
function.vsprintf.php                              24-Jun-2024 06:06               20332
function.wddx-add-vars.php                         24-Jun-2024 06:06                3850
function.wddx-deserialize.php                      24-Jun-2024 06:06                3692
function.wddx-packet-end.php                       24-Jun-2024 06:06                2907
function.wddx-packet-start.php                     24-Jun-2024 06:06                3152
function.wddx-serialize-value.php                  24-Jun-2024 06:06                3325
function.wddx-serialize-vars.php                   24-Jun-2024 06:06                6084
function.win32-continue-service.php                24-Jun-2024 06:06                6812
function.win32-create-service.php                  24-Jun-2024 06:06               28925
function.win32-delete-service.php                  24-Jun-2024 06:06                7271
function.win32-get-last-control-message.php        24-Jun-2024 06:06                8615
function.win32-pause-service.php                   24-Jun-2024 06:06                6798
function.win32-query-service-status.php            24-Jun-2024 06:06                8870
function.win32-send-custom-control.php             24-Jun-2024 06:06                7462
function.win32-set-service-exit-code.php           24-Jun-2024 06:06                5937
function.win32-set-service-exit-mode.php           24-Jun-2024 06:06                6085
function.win32-set-service-status.php              24-Jun-2024 06:06                9400
function.win32-start-service-ctrl-dispatcher.php   24-Jun-2024 06:06               11446
function.win32-start-service.php                   24-Jun-2024 06:06                6802
function.win32-stop-service.php                    24-Jun-2024 06:06                6739
function.wincache-fcache-fileinfo.php              24-Jun-2024 06:05                9334
function.wincache-fcache-meminfo.php               24-Jun-2024 06:05                7148
function.wincache-lock.php                         24-Jun-2024 06:05                8589
function.wincache-ocache-fileinfo.php              24-Jun-2024 06:05                9992
function.wincache-ocache-meminfo.php               24-Jun-2024 06:05                7343
function.wincache-refresh-if-changed.php           24-Jun-2024 06:05                7893
function.wincache-rplist-fileinfo.php              24-Jun-2024 06:05                7689
function.wincache-rplist-meminfo.php               24-Jun-2024 06:05                7263
function.wincache-scache-info.php                  24-Jun-2024 06:05                9607
function.wincache-scache-meminfo.php               24-Jun-2024 06:05                6750
function.wincache-ucache-add.php                   24-Jun-2024 06:05               13628
function.wincache-ucache-cas.php                   24-Jun-2024 06:05                6548
function.wincache-ucache-clear.php                 24-Jun-2024 06:05                7648
function.wincache-ucache-dec.php                   24-Jun-2024 06:05                6486
function.wincache-ucache-delete.php                24-Jun-2024 06:05               11447
function.wincache-ucache-exists.php                24-Jun-2024 06:05                6240
function.wincache-ucache-get.php                   24-Jun-2024 06:05               10631
function.wincache-ucache-inc.php                   24-Jun-2024 06:05                6478
function.wincache-ucache-info.php                  24-Jun-2024 06:05               11428
function.wincache-ucache-meminfo.php               24-Jun-2024 06:05                6939
function.wincache-ucache-set.php                   24-Jun-2024 06:05               13694
function.wincache-unlock.php                       24-Jun-2024 06:05                7851
function.wordwrap.php                              24-Jun-2024 06:06                9401
function.xattr-get.php                             24-Jun-2024 06:05                6189
function.xattr-list.php                            24-Jun-2024 06:05                6625
function.xattr-remove.php                          24-Jun-2024 06:05                6421
function.xattr-set.php                             24-Jun-2024 06:05                8166
function.xattr-supported.php                       24-Jun-2024 06:05                5407
function.xdiff-file-bdiff-size.php                 24-Jun-2024 06:05                4927
function.xdiff-file-bdiff.php                      24-Jun-2024 06:05                6026
function.xdiff-file-bpatch.php                     24-Jun-2024 06:05                6583
function.xdiff-file-diff-binary.php                24-Jun-2024 06:05                6452
function.xdiff-file-diff.php                       24-Jun-2024 06:05                7463
function.xdiff-file-merge3.php                     24-Jun-2024 06:05                6877
function.xdiff-file-patch-binary.php               24-Jun-2024 06:05                6749
function.xdiff-file-patch.php                      24-Jun-2024 06:05                8997
function.xdiff-file-rabdiff.php                    24-Jun-2024 06:05                6582
function.xdiff-string-bdiff-size.php               24-Jun-2024 06:05                5230
function.xdiff-string-bdiff.php                    24-Jun-2024 06:05                3919
function.xdiff-string-bpatch.php                   24-Jun-2024 06:05                4017
function.xdiff-string-diff-binary.php              24-Jun-2024 06:05                4413
function.xdiff-string-diff.php                     24-Jun-2024 06:05                7701
function.xdiff-string-merge3.php                   24-Jun-2024 06:05                4866
function.xdiff-string-patch-binary.php             24-Jun-2024 06:05                4555
function.xdiff-string-patch.php                    24-Jun-2024 06:05                8351
function.xdiff-string-rabdiff.php                  24-Jun-2024 06:05                4544
function.xhprof-disable.php                        24-Jun-2024 06:05                4047
function.xhprof-enable.php                         24-Jun-2024 06:05                7183
function.xhprof-sample-disable.php                 24-Jun-2024 06:05                4717
function.xhprof-sample-enable.php                  24-Jun-2024 06:05                3536
function.xml-error-string.php                      24-Jun-2024 06:06                3575
function.xml-get-current-byte-index.php            24-Jun-2024 06:06                4512
function.xml-get-current-column-number.php         24-Jun-2024 06:06                4360
function.xml-get-current-line-number.php           24-Jun-2024 06:06                4162
function.xml-get-error-code.php                    24-Jun-2024 06:06                3888
function.xml-parse-into-struct.php                 24-Jun-2024 06:06               19780
function.xml-parse.php                             24-Jun-2024 06:06                8388
function.xml-parser-create-ns.php                  24-Jun-2024 06:06                5703
function.xml-parser-create.php                     24-Jun-2024 06:06                5187
function.xml-parser-free.php                       24-Jun-2024 06:06                4307
function.xml-parser-get-option.php                 24-Jun-2024 06:06                6152
function.xml-parser-set-option.php                 24-Jun-2024 06:06                8162
function.xml-set-character-data-handler.php        24-Jun-2024 06:06                5813
function.xml-set-default-handler.php               24-Jun-2024 06:06                5720
function.xml-set-element-handler.php               24-Jun-2024 06:06                9201
function.xml-set-end-namespace-decl-handler.php    24-Jun-2024 06:06                6649
function.xml-set-external-entity-ref-handler.php   24-Jun-2024 06:06                8680
function.xml-set-notation-decl-handler.php         24-Jun-2024 06:06                7910
function.xml-set-object.php                        24-Jun-2024 06:06                9326
function.xml-set-processing-instruction-handler..> 24-Jun-2024 06:06                6835
function.xml-set-start-namespace-decl-handler.php  24-Jun-2024 06:06                6985
function.xml-set-unparsed-entity-decl-handler.php  24-Jun-2024 06:06                8748
function.xmlrpc-decode-request.php                 24-Jun-2024 06:06                2841
function.xmlrpc-decode.php                         24-Jun-2024 06:06                4153
function.xmlrpc-encode-request.php                 24-Jun-2024 06:06                8628
function.xmlrpc-encode.php                         24-Jun-2024 06:06                2397
function.xmlrpc-get-type.php                       24-Jun-2024 06:06                6336
function.xmlrpc-is-fault.php                       24-Jun-2024 06:06                3958
function.xmlrpc-parse-method-descriptions.php      24-Jun-2024 06:06                2606
function.xmlrpc-server-add-introspection-data.php  24-Jun-2024 06:06                2801
function.xmlrpc-server-call-method.php             24-Jun-2024 06:06                3213
function.xmlrpc-server-create.php                  24-Jun-2024 06:06                2313
function.xmlrpc-server-destroy.php                 24-Jun-2024 06:06                2526
function.xmlrpc-server-register-introspection-c..> 24-Jun-2024 06:06                2881
function.xmlrpc-server-register-method.php         24-Jun-2024 06:06                2954
function.xmlrpc-set-type.php                       24-Jun-2024 06:06                5511
function.yaml-emit-file.php                        24-Jun-2024 06:05                6814
function.yaml-emit.php                             24-Jun-2024 06:05               12396
function.yaml-parse-file.php                       24-Jun-2024 06:05                6115
function.yaml-parse-url.php                        24-Jun-2024 06:05                6440
function.yaml-parse.php                            24-Jun-2024 06:05                9976
function.yaz-addinfo.php                           24-Jun-2024 06:05                3463
function.yaz-ccl-conf.php                          24-Jun-2024 06:05                5759
function.yaz-ccl-parse.php                         24-Jun-2024 06:05                6816
function.yaz-close.php                             24-Jun-2024 06:05                3607
function.yaz-connect.php                           24-Jun-2024 06:05                9174
function.yaz-database.php                          24-Jun-2024 06:05                3491
function.yaz-element.php                           24-Jun-2024 06:05                3923
function.yaz-errno.php                             24-Jun-2024 06:05                3686
function.yaz-error.php                             24-Jun-2024 06:05                3441
function.yaz-es-result.php                         24-Jun-2024 06:05                3359
function.yaz-es.php                                24-Jun-2024 06:05                7217
function.yaz-get-option.php                        24-Jun-2024 06:05                3436
function.yaz-hits.php                              24-Jun-2024 06:05                4920
function.yaz-itemorder.php                         24-Jun-2024 06:05                7111
function.yaz-present.php                           24-Jun-2024 06:05                3067
function.yaz-range.php                             24-Jun-2024 06:05                3672
function.yaz-record.php                            24-Jun-2024 06:05               14298
function.yaz-scan-result.php                       24-Jun-2024 06:05                4071
function.yaz-scan.php                              24-Jun-2024 06:05                9419
function.yaz-schema.php                            24-Jun-2024 06:05                3508
function.yaz-search.php                            24-Jun-2024 06:05                8763
function.yaz-set-option.php                        24-Jun-2024 06:05                7071
function.yaz-sort.php                              24-Jun-2024 06:05                5643
function.yaz-syntax.php                            24-Jun-2024 06:05                3466
function.yaz-wait.php                              24-Jun-2024 06:05                4207
function.zend-thread-id.php                        24-Jun-2024 06:05                3802
function.zend-version.php                          24-Jun-2024 06:05                3998
function.zip-close.php                             24-Jun-2024 06:05                3999
function.zip-entry-close.php                       24-Jun-2024 06:05                4245
function.zip-entry-compressedsize.php              24-Jun-2024 06:05                4529
function.zip-entry-compressionmethod.php           24-Jun-2024 06:05                4655
function.zip-entry-filesize.php                    24-Jun-2024 06:05                4461
function.zip-entry-name.php                        24-Jun-2024 06:05                4337
function.zip-entry-open.php                        24-Jun-2024 06:05                5958
function.zip-entry-read.php                        24-Jun-2024 06:05                5125
function.zip-open.php                              24-Jun-2024 06:05                4554
function.zip-read.php                              24-Jun-2024 06:05                4720
function.zlib-decode.php                           24-Jun-2024 06:05                3519
function.zlib-encode.php                           24-Jun-2024 06:05                5467
function.zlib-get-coding-type.php                  24-Jun-2024 06:05                2966
function.zookeeper-dispatch.php                    24-Jun-2024 06:05                8453
functional.parallel.php                            24-Jun-2024 06:05                2682
functions.anonymous.php                            24-Jun-2024 06:05               24049
functions.arguments.php                            24-Jun-2024 06:05               43180
functions.arrow.php                                24-Jun-2024 06:05               10231
functions.first_class_callable_syntax.php          24-Jun-2024 06:05               11339
functions.internal.php                             24-Jun-2024 06:05                7928
functions.returning-values.php                     24-Jun-2024 06:05                6348
functions.user-defined.php                         24-Jun-2024 06:05                9546
functions.variable-functions.php                   24-Jun-2024 06:05               11586
gearman.configuration.php                          24-Jun-2024 06:05                1376
gearman.constants.php                              24-Jun-2024 06:05               23917
gearman.examples-reverse-bg.php                    24-Jun-2024 06:05               10727
gearman.examples-reverse-task.php                  24-Jun-2024 06:05               17376
gearman.examples-reverse.php                       24-Jun-2024 06:05               12802
gearman.examples.php                               24-Jun-2024 06:05                1633
gearman.installation.php                           24-Jun-2024 06:05                1709
gearman.requirements.php                           24-Jun-2024 06:05                1611
gearman.resources.php                              24-Jun-2024 06:05                1344
gearman.setup.php                                  24-Jun-2024 06:05                1733
gearmanclient.addoptions.php                       24-Jun-2024 06:05                3375
gearmanclient.addserver.php                        24-Jun-2024 06:05                5526
gearmanclient.addservers.php                       24-Jun-2024 06:05                4960
gearmanclient.addtask.php                          24-Jun-2024 06:05               15212
gearmanclient.addtaskbackground.php                24-Jun-2024 06:05               20976
gearmanclient.addtaskhigh.php                      24-Jun-2024 06:05               11715
gearmanclient.addtaskhighbackground.php            24-Jun-2024 06:05                6624
gearmanclient.addtasklow.php                       24-Jun-2024 06:05               11697
gearmanclient.addtasklowbackground.php             24-Jun-2024 06:05                6617
gearmanclient.addtaskstatus.php                    24-Jun-2024 06:05                9856
gearmanclient.clearcallbacks.php                   24-Jun-2024 06:05                4391
gearmanclient.clone.php                            24-Jun-2024 06:05                2688
gearmanclient.construct.php                        24-Jun-2024 06:05                2865
gearmanclient.context.php                          24-Jun-2024 06:05                2933
gearmanclient.data.php                             24-Jun-2024 06:05                3198
gearmanclient.do.php                               24-Jun-2024 06:05               22232
gearmanclient.dobackground.php                     24-Jun-2024 06:05                9717
gearmanclient.dohigh.php                           24-Jun-2024 06:05                5169
gearmanclient.dohighbackground.php                 24-Jun-2024 06:05                4996
gearmanclient.dojobhandle.php                      24-Jun-2024 06:05                2990
gearmanclient.dolow.php                            24-Jun-2024 06:05                5155
gearmanclient.dolowbackground.php                  24-Jun-2024 06:05                4978
gearmanclient.donormal.php                         24-Jun-2024 06:05               22800
gearmanclient.dostatus.php                         24-Jun-2024 06:05                8173
gearmanclient.echo.php                             24-Jun-2024 06:05                3023
gearmanclient.error.php                            24-Jun-2024 06:05                2925
gearmanclient.geterrno.php                         24-Jun-2024 06:05                2700
gearmanclient.jobstatus.php                        24-Jun-2024 06:05                8373
gearmanclient.ping.php                             24-Jun-2024 06:05                2996
gearmanclient.removeoptions.php                    24-Jun-2024 06:05                2723
gearmanclient.returncode.php                       24-Jun-2024 06:05                2344
gearmanclient.runtasks.php                         24-Jun-2024 06:05                3752
gearmanclient.setclientcallback.php                24-Jun-2024 06:05                5398
gearmanclient.setcompletecallback.php              24-Jun-2024 06:05                5284
gearmanclient.setcontext.php                       24-Jun-2024 06:05                3267
gearmanclient.setcreatedcallback.php               24-Jun-2024 06:05                4823
gearmanclient.setdata.php                          24-Jun-2024 06:05                3465
gearmanclient.setdatacallback.php                  24-Jun-2024 06:05                4808
gearmanclient.setexceptioncallback.php             24-Jun-2024 06:05                4728
gearmanclient.setfailcallback.php                  24-Jun-2024 06:05                4814
gearmanclient.setoptions.php                       24-Jun-2024 06:05                2709
gearmanclient.setstatuscallback.php                24-Jun-2024 06:05                4814
gearmanclient.settimeout.php                       24-Jun-2024 06:05                2753
gearmanclient.setwarningcallback.php               24-Jun-2024 06:05                4817
gearmanclient.setworkloadcallback.php              24-Jun-2024 06:05                4971
gearmanclient.timeout.php                          24-Jun-2024 06:05                2795
gearmanclient.wait.php                             24-Jun-2024 06:05                2842
gearmanjob.complete.php                            24-Jun-2024 06:05                3621
gearmanjob.construct.php                           24-Jun-2024 06:05                2378
gearmanjob.data.php                                24-Jun-2024 06:05                3581
gearmanjob.exception.php                           24-Jun-2024 06:05                3788
gearmanjob.fail.php                                24-Jun-2024 06:05                3713
gearmanjob.functionname.php                        24-Jun-2024 06:05                2971
gearmanjob.handle.php                              24-Jun-2024 06:05                2858
gearmanjob.returncode.php                          24-Jun-2024 06:05                2655
gearmanjob.sendcomplete.php                        24-Jun-2024 06:05                3342
gearmanjob.senddata.php                            24-Jun-2024 06:05                3309
gearmanjob.sendexception.php                       24-Jun-2024 06:05                3522
gearmanjob.sendfail.php                            24-Jun-2024 06:05                3432
gearmanjob.sendstatus.php                          24-Jun-2024 06:05                4037
gearmanjob.sendwarning.php                         24-Jun-2024 06:05                3518
gearmanjob.setreturn.php                           24-Jun-2024 06:05                2595
gearmanjob.status.php                              24-Jun-2024 06:05                4318
gearmanjob.unique.php                              24-Jun-2024 06:05                3095
gearmanjob.warning.php                             24-Jun-2024 06:05                3799
gearmanjob.workload.php                            24-Jun-2024 06:05                2853
gearmanjob.workloadsize.php                        24-Jun-2024 06:05                2671
gearmantask.construct.php                          24-Jun-2024 06:05                2403
gearmantask.create.php                             24-Jun-2024 06:05                2833
gearmantask.data.php                               24-Jun-2024 06:05                2832
gearmantask.datasize.php                           24-Jun-2024 06:05                2855
gearmantask.function.php                           24-Jun-2024 06:05                2688
gearmantask.functionname.php                       24-Jun-2024 06:05                2625
gearmantask.isknown.php                            24-Jun-2024 06:05                2501
gearmantask.isrunning.php                          24-Jun-2024 06:05                2501
gearmantask.jobhandle.php                          24-Jun-2024 06:05                3004
gearmantask.recvdata.php                           24-Jun-2024 06:05                3501
gearmantask.returncode.php                         24-Jun-2024 06:05                2682
gearmantask.senddata.php                           24-Jun-2024 06:05                3314
gearmantask.sendworkload.php                       24-Jun-2024 06:05                3463
gearmantask.taskdenominator.php                    24-Jun-2024 06:05                3048
gearmantask.tasknumerator.php                      24-Jun-2024 06:05                3020
gearmantask.unique.php                             24-Jun-2024 06:05                3265
gearmantask.uuid.php                               24-Jun-2024 06:05                3438
gearmanworker.addfunction.php                      24-Jun-2024 06:05                7946
gearmanworker.addoptions.php                       24-Jun-2024 06:05                3425
gearmanworker.addserver.php                        24-Jun-2024 06:05                5253
gearmanworker.addservers.php                       24-Jun-2024 06:05                4682
gearmanworker.clone.php                            24-Jun-2024 06:05                2359
gearmanworker.construct.php                        24-Jun-2024 06:05                2838
gearmanworker.echo.php                             24-Jun-2024 06:05                3061
gearmanworker.error.php                            24-Jun-2024 06:05                2892
gearmanworker.geterrno.php                         24-Jun-2024 06:05                2667
gearmanworker.options.php                          24-Jun-2024 06:05                2674
gearmanworker.register.php                         24-Jun-2024 06:05                3818
gearmanworker.removeoptions.php                    24-Jun-2024 06:05                3447
gearmanworker.returncode.php                       24-Jun-2024 06:05                2862
gearmanworker.setid.php                            24-Jun-2024 06:05                4128
gearmanworker.setoptions.php                       24-Jun-2024 06:05                3580
gearmanworker.settimeout.php                       24-Jun-2024 06:05                7839
gearmanworker.timeout.php                          24-Jun-2024 06:05                2774
gearmanworker.unregister.php                       24-Jun-2024 06:05                3382
gearmanworker.unregisterall.php                    24-Jun-2024 06:05                3038
gearmanworker.wait.php                             24-Jun-2024 06:05                7923
gearmanworker.work.php                             24-Jun-2024 06:05                5625
gender-gender.connect.php                          24-Jun-2024 06:05                2593
gender-gender.construct.php                        24-Jun-2024 06:05                2446
gender-gender.country.php                          24-Jun-2024 06:05                3846
gender-gender.get.php                              24-Jun-2024 06:05                2909
gender-gender.isnick.php                           24-Jun-2024 06:05                3514
gender-gender.similarnames.php                     24-Jun-2024 06:05                3022
gender.example.admin.php                           24-Jun-2024 06:05                8116
gender.examples.php                                24-Jun-2024 06:05                1411
gender.installation.php                            24-Jun-2024 06:05                2091
gender.setup.php                                   24-Jun-2024 06:05                1483
generator.current.php                              24-Jun-2024 06:05                2144
generator.getreturn.php                            24-Jun-2024 06:05                3884
generator.key.php                                  24-Jun-2024 06:05                3939
generator.next.php                                 24-Jun-2024 06:05                2476
generator.rewind.php                               24-Jun-2024 06:05                2242
generator.send.php                                 24-Jun-2024 06:05                5551
generator.throw.php                                24-Jun-2024 06:05                5100
generator.valid.php                                24-Jun-2024 06:05                2351
generator.wakeup.php                               24-Jun-2024 06:05                2250
geoip.configuration.php                            24-Jun-2024 06:05                2609
geoip.constants.php                                24-Jun-2024 06:05                6379
geoip.installation.php                             24-Jun-2024 06:05                1844
geoip.requirements.php                             24-Jun-2024 06:05                1814
geoip.resources.php                                24-Jun-2024 06:05                1300
geoip.setup.php                                    24-Jun-2024 06:05                1694
gettext.configuration.php                          24-Jun-2024 06:05                1379
gettext.constants.php                              24-Jun-2024 06:05                1246
gettext.installation.php                           24-Jun-2024 06:05                1543
gettext.requirements.php                           24-Jun-2024 06:05                1499
gettext.resources.php                              24-Jun-2024 06:05                1317
gettext.setup.php                                  24-Jun-2024 06:05                1741
getting-started.php                                24-Jun-2024 06:05                2017
globiterator.construct.php                         24-Jun-2024 06:05                7928
globiterator.count.php                             24-Jun-2024 06:05                4524
gmagick.addimage.php                               24-Jun-2024 06:05                2904
gmagick.addnoiseimage.php                          24-Jun-2024 06:05                2959
gmagick.annotateimage.php                          24-Jun-2024 06:05                4494
gmagick.blurimage.php                              24-Jun-2024 06:05                3355
gmagick.borderimage.php                            24-Jun-2024 06:05                3804
gmagick.charcoalimage.php                          24-Jun-2024 06:05                3305
gmagick.chopimage.php                              24-Jun-2024 06:05                3957
gmagick.clear.php                                  24-Jun-2024 06:05                2652
gmagick.commentimage.php                           24-Jun-2024 06:05                2906
gmagick.compositeimage.php                         24-Jun-2024 06:05                4120
gmagick.configuration.php                          24-Jun-2024 06:05                1391
gmagick.constants.php                              24-Jun-2024 06:05              103257
gmagick.construct.php                              24-Jun-2024 06:05                2662
gmagick.cropimage.php                              24-Jun-2024 06:05                4092
gmagick.cropthumbnailimage.php                     24-Jun-2024 06:05                3342
gmagick.current.php                                24-Jun-2024 06:05                2553
gmagick.cyclecolormapimage.php                     24-Jun-2024 06:05                3032
gmagick.deconstructimages.php                      24-Jun-2024 06:05                2801
gmagick.despeckleimage.php                         24-Jun-2024 06:05                3499
gmagick.destroy.php                                24-Jun-2024 06:05                2785
gmagick.drawimage.php                              24-Jun-2024 06:05                3028
gmagick.edgeimage.php                              24-Jun-2024 06:05                2975
gmagick.embossimage.php                            24-Jun-2024 06:05                3483
gmagick.enhanceimage.php                           24-Jun-2024 06:05                2663
gmagick.equalizeimage.php                          24-Jun-2024 06:05                2622
gmagick.examples.php                               24-Jun-2024 06:05                3465
gmagick.flipimage.php                              24-Jun-2024 06:05                2960
gmagick.flopimage.php                              24-Jun-2024 06:05                2957
gmagick.frameimage.php                             24-Jun-2024 06:05                4629
gmagick.gammaimage.php                             24-Jun-2024 06:05                3186
gmagick.getcopyright.php                           24-Jun-2024 06:05                2644
gmagick.getfilename.php                            24-Jun-2024 06:05                2594
gmagick.getimagebackgroundcolor.php                24-Jun-2024 06:05                2731
gmagick.getimageblueprimary.php                    24-Jun-2024 06:05                3034
gmagick.getimagebordercolor.php                    24-Jun-2024 06:05                2775
gmagick.getimagechanneldepth.php                   24-Jun-2024 06:05                2836
gmagick.getimagecolors.php                         24-Jun-2024 06:05                2630
gmagick.getimagecolorspace.php                     24-Jun-2024 06:05                2588
gmagick.getimagecompose.php                        24-Jun-2024 06:05                2668
gmagick.getimagedelay.php                          24-Jun-2024 06:05                2565
gmagick.getimagedepth.php                          24-Jun-2024 06:05                2535
gmagick.getimagedispose.php                        24-Jun-2024 06:05                2589
gmagick.getimageextrema.php                        24-Jun-2024 06:05                2813
gmagick.getimagefilename.php                       24-Jun-2024 06:05                2673
gmagick.getimageformat.php                         24-Jun-2024 06:05                2656
gmagick.getimagegamma.php                          24-Jun-2024 06:05                2556
gmagick.getimagegreenprimary.php                   24-Jun-2024 06:05                2775
gmagick.getimageheight.php                         24-Jun-2024 06:05                2587
gmagick.getimagehistogram.php                      24-Jun-2024 06:05                2948
gmagick.getimageindex.php                          24-Jun-2024 06:05                2718
gmagick.getimageinterlacescheme.php                24-Jun-2024 06:05                2706
gmagick.getimageiterations.php                     24-Jun-2024 06:05                2633
gmagick.getimagematte.php                          24-Jun-2024 06:05                2973
gmagick.getimagemattecolor.php                     24-Jun-2024 06:05                2681
gmagick.getimageprofile.php                        24-Jun-2024 06:05                2788
gmagick.getimageredprimary.php                     24-Jun-2024 06:05                2796
gmagick.getimagerenderingintent.php                24-Jun-2024 06:05                2717
gmagick.getimageresolution.php                     24-Jun-2024 06:05                2649
gmagick.getimagescene.php                          24-Jun-2024 06:05                2552
gmagick.getimagesignature.php                      24-Jun-2024 06:05                2667
gmagick.getimagetype.php                           24-Jun-2024 06:05                2559
gmagick.getimageunits.php                          24-Jun-2024 06:05                2309
gmagick.getimagewhitepoint.php                     24-Jun-2024 06:05                2772
gmagick.getimagewidth.php                          24-Jun-2024 06:05                2566
gmagick.getpackagename.php                         24-Jun-2024 06:05                2620
gmagick.getquantumdepth.php                        24-Jun-2024 06:05                2797
gmagick.getreleasedate.php                         24-Jun-2024 06:05                2654
gmagick.getsamplingfactors.php                     24-Jun-2024 06:05                2707
gmagick.getsize.php                                24-Jun-2024 06:05                2856
gmagick.getversion.php                             24-Jun-2024 06:05                2597
gmagick.hasnextimage.php                           24-Jun-2024 06:05                2954
gmagick.haspreviousimage.php                       24-Jun-2024 06:05                2998
gmagick.implodeimage.php                           24-Jun-2024 06:05                3015
gmagick.installation.php                           24-Jun-2024 06:05                2064
gmagick.labelimage.php                             24-Jun-2024 06:05                2784
gmagick.levelimage.php                             24-Jun-2024 06:05                4735
gmagick.magnifyimage.php                           24-Jun-2024 06:05                2648
gmagick.mapimage.php                               24-Jun-2024 06:05                3320
gmagick.medianfilterimage.php                      24-Jun-2024 06:05                3104
gmagick.minifyimage.php                            24-Jun-2024 06:05                2682
gmagick.modulateimage.php                          24-Jun-2024 06:05                3933
gmagick.motionblurimage.php                        24-Jun-2024 06:05                3958
gmagick.newimage.php                               24-Jun-2024 06:05                3980
gmagick.nextimage.php                              24-Jun-2024 06:05                2806
gmagick.normalizeimage.php                         24-Jun-2024 06:05                3060
gmagick.oilpaintimage.php                          24-Jun-2024 06:05                3076
gmagick.previousimage.php                          24-Jun-2024 06:05                2801
gmagick.profileimage.php                           24-Jun-2024 06:05                3634
gmagick.quantizeimage.php                          24-Jun-2024 06:05                5403
gmagick.quantizeimages.php                         24-Jun-2024 06:05                5406
gmagick.queryfontmetrics.php                       24-Jun-2024 06:05                2975
gmagick.queryfonts.php                             24-Jun-2024 06:05                2751
gmagick.queryformats.php                           24-Jun-2024 06:05                3154
gmagick.radialblurimage.php                        24-Jun-2024 06:05                3280
gmagick.raiseimage.php                             24-Jun-2024 06:05                4471
gmagick.read.php                                   24-Jun-2024 06:05                2799
gmagick.readimage.php                              24-Jun-2024 06:05                2849
gmagick.readimageblob.php                          24-Jun-2024 06:05                3272
gmagick.readimagefile.php                          24-Jun-2024 06:05                3149
gmagick.reducenoiseimage.php                       24-Jun-2024 06:05                3254
gmagick.removeimage.php                            24-Jun-2024 06:05                2630
gmagick.removeimageprofile.php                     24-Jun-2024 06:05                2961
gmagick.requirements.php                           24-Jun-2024 06:05                1774
gmagick.resampleimage.php                          24-Jun-2024 06:05                3983
gmagick.resizeimage.php                            24-Jun-2024 06:05                4320
gmagick.rollimage.php                              24-Jun-2024 06:05                3059
gmagick.rotateimage.php                            24-Jun-2024 06:05                3234
gmagick.scaleimage.php                             24-Jun-2024 06:05                3602
gmagick.separateimagechannel.php                   24-Jun-2024 06:05                3246
gmagick.setcompressionquality.php                  24-Jun-2024 06:05                4265
gmagick.setfilename.php                            24-Jun-2024 06:05                2979
gmagick.setimagebackgroundcolor.php                24-Jun-2024 06:05                3048
gmagick.setimageblueprimary.php                    24-Jun-2024 06:05                3342
gmagick.setimagebordercolor.php                    24-Jun-2024 06:05                3010
gmagick.setimagechanneldepth.php                   24-Jun-2024 06:05                3489
gmagick.setimagecolorspace.php                     24-Jun-2024 06:05                3131
gmagick.setimagecompose.php                        24-Jun-2024 06:05                2897
gmagick.setimagedelay.php                          24-Jun-2024 06:05                2911
gmagick.setimagedepth.php                          24-Jun-2024 06:05                2909
gmagick.setimagedispose.php                        24-Jun-2024 06:05                2953
gmagick.setimagefilename.php                       24-Jun-2024 06:05                3003
gmagick.setimageformat.php                         24-Jun-2024 06:05                2966
gmagick.setimagegamma.php                          24-Jun-2024 06:05                2903
gmagick.setimagegreenprimary.php                   24-Jun-2024 06:05                3350
gmagick.setimageindex.php                          24-Jun-2024 06:05                3050
gmagick.setimageinterlacescheme.php                24-Jun-2024 06:05                3197
gmagick.setimageiterations.php                     24-Jun-2024 06:05                3006
gmagick.setimageprofile.php                        24-Jun-2024 06:05                3439
gmagick.setimageredprimary.php                     24-Jun-2024 06:05                3253
gmagick.setimagerenderingintent.php                24-Jun-2024 06:05                3228
gmagick.setimageresolution.php                     24-Jun-2024 06:05                3247
gmagick.setimagescene.php                          24-Jun-2024 06:05                2899
gmagick.setimagetype.php                           24-Jun-2024 06:05                3024
gmagick.setimageunits.php                          24-Jun-2024 06:05                3083
gmagick.setimagewhitepoint.php                     24-Jun-2024 06:05                3279
gmagick.setsamplingfactors.php                     24-Jun-2024 06:05                3125
gmagick.setsize.php                                24-Jun-2024 06:05                3595
gmagick.setup.php                                  24-Jun-2024 06:05                1659
gmagick.shearimage.php                             24-Jun-2024 06:05                3977
gmagick.solarizeimage.php                          24-Jun-2024 06:05                3157
gmagick.spreadimage.php                            24-Jun-2024 06:05                3001
gmagick.stripimage.php                             24-Jun-2024 06:05                2610
gmagick.swirlimage.php                             24-Jun-2024 06:05                3082
gmagick.thumbnailimage.php                         24-Jun-2024 06:05                3913
gmagick.trimimage.php                              24-Jun-2024 06:05                3146
gmagick.write.php                                  24-Jun-2024 06:05                1762
gmagick.writeimage.php                             24-Jun-2024 06:05                3558
gmagickdraw.annotate.php                           24-Jun-2024 06:05                3223
gmagickdraw.arc.php                                24-Jun-2024 06:05                4383
gmagickdraw.bezier.php                             24-Jun-2024 06:05                2662
gmagickdraw.ellipse.php                            24-Jun-2024 06:05                4304
gmagickdraw.getfillcolor.php                       24-Jun-2024 06:05                2479
gmagickdraw.getfillopacity.php                     24-Jun-2024 06:05                2430
gmagickdraw.getfont.php                            24-Jun-2024 06:05                2421
gmagickdraw.getfontsize.php                        24-Jun-2024 06:05                2472
gmagickdraw.getfontstyle.php                       24-Jun-2024 06:05                2548
gmagickdraw.getfontweight.php                      24-Jun-2024 06:05                2393
gmagickdraw.getstrokecolor.php                     24-Jun-2024 06:05                2534
gmagickdraw.getstrokeopacity.php                   24-Jun-2024 06:05                2507
gmagickdraw.getstrokewidth.php                     24-Jun-2024 06:05                2526
gmagickdraw.gettextdecoration.php                  24-Jun-2024 06:05                2460
gmagickdraw.gettextencoding.php                    24-Jun-2024 06:05                2549
gmagickdraw.line.php                               24-Jun-2024 06:05                3667
gmagickdraw.point.php                              24-Jun-2024 06:05                2954
gmagickdraw.polygon.php                            24-Jun-2024 06:05                2729
gmagickdraw.polyline.php                           24-Jun-2024 06:05                2764
gmagickdraw.rectangle.php                          24-Jun-2024 06:05                3771
gmagickdraw.rotate.php                             24-Jun-2024 06:05                2720
gmagickdraw.roundrectangle.php                     24-Jun-2024 06:05                4548
gmagickdraw.scale.php                              24-Jun-2024 06:05                3018
gmagickdraw.setfillcolor.php                       24-Jun-2024 06:05                2980
gmagickdraw.setfillopacity.php                     24-Jun-2024 06:05                2818
gmagickdraw.setfont.php                            24-Jun-2024 06:05                2718
gmagickdraw.setfontsize.php                        24-Jun-2024 06:05                2748
gmagickdraw.setfontstyle.php                       24-Jun-2024 06:05                2879
gmagickdraw.setfontweight.php                      24-Jun-2024 06:05                2750
gmagickdraw.setstrokecolor.php                     24-Jun-2024 06:05                3004
gmagickdraw.setstrokeopacity.php                   24-Jun-2024 06:05                2836
gmagickdraw.setstrokewidth.php                     24-Jun-2024 06:05                2796
gmagickdraw.settextdecoration.php                  24-Jun-2024 06:05                2882
gmagickdraw.settextencoding.php                    24-Jun-2024 06:05                3090
gmagickpixel.construct.php                         24-Jun-2024 06:05                2592
gmagickpixel.getcolor.php                          24-Jun-2024 06:05                4382
gmagickpixel.getcolorcount.php                     24-Jun-2024 06:05                2521
gmagickpixel.getcolorvalue.php                     24-Jun-2024 06:05                2926
gmagickpixel.setcolor.php                          24-Jun-2024 06:05                3057
gmagickpixel.setcolorvalue.php                     24-Jun-2024 06:05                3336
gmp.configuration.php                              24-Jun-2024 06:05                1363
gmp.constants.php                                  24-Jun-2024 06:05                4583
gmp.construct.php                                  24-Jun-2024 06:05                3775
gmp.examples.php                                   24-Jun-2024 06:05                3141
gmp.installation.php                               24-Jun-2024 06:05                1456
gmp.requirements.php                               24-Jun-2024 06:05                1819
gmp.serialize.php                                  24-Jun-2024 06:05                2295
gmp.setup.php                                      24-Jun-2024 06:05                1621
gmp.unserialize.php                                24-Jun-2024 06:05                2604
gnupg.configuration.php                            24-Jun-2024 06:05                1360
gnupg.constants.php                                24-Jun-2024 06:05                9447
gnupg.examples-clearsign.php                       24-Jun-2024 06:05                6416
gnupg.examples.php                                 24-Jun-2024 06:05                1415
gnupg.installation.php                             24-Jun-2024 06:05                1690
gnupg.requirements.php                             24-Jun-2024 06:05                1378
gnupg.resources.php                                24-Jun-2024 06:05                1300
gnupg.setup.php                                    24-Jun-2024 06:05                1712
hash.configuration.php                             24-Jun-2024 06:05                1358
hash.constants.php                                 24-Jun-2024 06:05                1902
hash.installation.php                              24-Jun-2024 06:05                1788
hash.resources.php                                 24-Jun-2024 06:05                1414
hash.setup.php                                     24-Jun-2024 06:05                1632
hashcontext.construct.php                          24-Jun-2024 06:05                1948
hashcontext.serialize.php                          24-Jun-2024 06:05                2424
hashcontext.unserialize.php                        24-Jun-2024 06:05                2742
history.php                                        24-Jun-2024 06:06                2312
history.php.books.php                              24-Jun-2024 06:06                2681
history.php.php                                    24-Jun-2024 06:06               11532
history.php.publications.php                       24-Jun-2024 06:06                1896
history.php.related.php                            24-Jun-2024 06:06                6244
hrtime-performancecounter.getfrequency.php         24-Jun-2024 06:05                2777
hrtime-performancecounter.getticks.php             24-Jun-2024 06:05                2650
hrtime-performancecounter.gettickssince.php        24-Jun-2024 06:05                2955
hrtime-stopwatch.getelapsedticks.php               24-Jun-2024 06:05                2552
hrtime-stopwatch.getelapsedtime.php                24-Jun-2024 06:05                2950
hrtime-stopwatch.getlastelapsedticks.php           24-Jun-2024 06:05                2620
hrtime-stopwatch.getlastelapsedtime.php            24-Jun-2024 06:05                2974
hrtime-stopwatch.isrunning.php                     24-Jun-2024 06:05                2513
hrtime-stopwatch.start.php                         24-Jun-2024 06:05                2414
hrtime-stopwatch.stop.php                          24-Jun-2024 06:05                2293
hrtime.example.basic.php                           24-Jun-2024 06:05                5494
hrtime.examples.php                                24-Jun-2024 06:05                1405
hrtime.installation.php                            24-Jun-2024 06:05                2091
hrtime.setup.php                                   24-Jun-2024 06:05                1480
ibase.configuration.php                            24-Jun-2024 06:05                8119
ibase.constants.php                                24-Jun-2024 06:05               21661
ibase.installation.php                             24-Jun-2024 06:05                3500
ibase.requirements.php                             24-Jun-2024 06:05                1310
ibase.resources.php                                24-Jun-2024 06:05                1303
ibase.setup.php                                    24-Jun-2024 06:05                1733
ibm-db2.configuration.php                          24-Jun-2024 06:05               20950
ibm-db2.constants.php                              24-Jun-2024 06:05                9167
ibm-db2.installation.php                           24-Jun-2024 06:05                3625
ibm-db2.requirements.php                           24-Jun-2024 06:05                3317
ibm-db2.resources.php                              24-Jun-2024 06:05                1367
ibm-db2.setup.php                                  24-Jun-2024 06:05                1742
iconv.configuration.php                            24-Jun-2024 06:05                4899
iconv.constants.php                                24-Jun-2024 06:05                3801
iconv.installation.php                             24-Jun-2024 06:05                1682
iconv.requirements.php                             24-Jun-2024 06:05                1619
iconv.resources.php                                24-Jun-2024 06:05                1303
iconv.setup.php                                    24-Jun-2024 06:05                1720
igbinary.configuration.php                         24-Jun-2024 06:05                3607
igbinary.installation.php                          24-Jun-2024 06:05                2102
igbinary.requirements.php                          24-Jun-2024 06:05                1328
igbinary.setup.php                                 24-Jun-2024 06:05                1666
image.configuration.php                            24-Jun-2024 06:05                3539
image.constants.php                                24-Jun-2024 06:05               54771
image.examples-png.php                             24-Jun-2024 06:05                4824
image.examples-watermark.php                       24-Jun-2024 06:05                6023
image.examples.merged-watermark.php                24-Jun-2024 06:05                8749
image.examples.php                                 24-Jun-2024 06:05                1698
image.installation.php                             24-Jun-2024 06:05                6269
image.requirements.php                             24-Jun-2024 06:05                4630
image.resources.php                                24-Jun-2024 06:05                2155
image.setup.php                                    24-Jun-2024 06:05                1718
imagick.adaptiveblurimage.php                      24-Jun-2024 06:05                7040
imagick.adaptiveresizeimage.php                    24-Jun-2024 06:05                9190
imagick.adaptivesharpenimage.php                   24-Jun-2024 06:05                6548
imagick.adaptivethresholdimage.php                 24-Jun-2024 06:05                6282
imagick.addimage.php                               24-Jun-2024 06:05                2966
imagick.addnoiseimage.php                          24-Jun-2024 06:05                5650
imagick.affinetransformimage.php                   24-Jun-2024 06:05                6678
imagick.animateimages.php                          24-Jun-2024 06:05                3231
imagick.annotateimage.php                          24-Jun-2024 06:05                8719
imagick.appendimages.php                           24-Jun-2024 06:05                6744
imagick.autolevelimage.php                         24-Jun-2024 06:05                4509
imagick.averageimages.php                          24-Jun-2024 06:05                2769
imagick.blackthresholdimage.php                    24-Jun-2024 06:05                5354
imagick.blueshiftimage.php                         24-Jun-2024 06:05                4554
imagick.blurimage.php                              24-Jun-2024 06:05                5818
imagick.borderimage.php                            24-Jun-2024 06:05                6104
imagick.brightnesscontrastimage.php                24-Jun-2024 06:05                5714
imagick.charcoalimage.php                          24-Jun-2024 06:05                5047
imagick.chopimage.php                              24-Jun-2024 06:05                7073
imagick.clampimage.php                             24-Jun-2024 06:05                2759
imagick.clear.php                                  24-Jun-2024 06:05                2310
imagick.clipimage.php                              24-Jun-2024 06:05                2565
imagick.clipimagepath.php                          24-Jun-2024 06:05                3177
imagick.clippathimage.php                          24-Jun-2024 06:05                3568
imagick.clone.php                                  24-Jun-2024 06:05                4189
imagick.clutimage.php                              24-Jun-2024 06:05                6103
imagick.coalesceimages.php                         24-Jun-2024 06:05                2857
imagick.colorfloodfillimage.php                    24-Jun-2024 06:05                5502
imagick.colorizeimage.php                          24-Jun-2024 06:05                6942
imagick.colormatriximage.php                       24-Jun-2024 06:05                7677
imagick.combineimages.php                          24-Jun-2024 06:05                3410
imagick.commentimage.php                           24-Jun-2024 06:05                5034
imagick.compareimagechannels.php                   24-Jun-2024 06:05                3997
imagick.compareimagelayers.php                     24-Jun-2024 06:05                5557
imagick.compareimages.php                          24-Jun-2024 06:05                5704
imagick.compositeimage.php                         24-Jun-2024 06:05                8057
imagick.configuration.php                          24-Jun-2024 06:05                4566
imagick.constants.php                              24-Jun-2024 06:05              163069
imagick.construct.php                              24-Jun-2024 06:05                2633
imagick.contrastimage.php                          24-Jun-2024 06:05                5095
imagick.contraststretchimage.php                   24-Jun-2024 06:05                4019
imagick.convolveimage.php                          24-Jun-2024 06:05                6011
imagick.count.php                                  24-Jun-2024 06:05                2747
imagick.cropimage.php                              24-Jun-2024 06:05                6212
imagick.cropthumbnailimage.php                     24-Jun-2024 06:05                3580
imagick.current.php                                24-Jun-2024 06:05                2518
imagick.cyclecolormapimage.php                     24-Jun-2024 06:05                3049
imagick.decipherimage.php                          24-Jun-2024 06:05                3323
imagick.deconstructimages.php                      24-Jun-2024 06:05                2673
imagick.deleteimageartifact.php                    24-Jun-2024 06:05                3739
imagick.deleteimageproperty.php                    24-Jun-2024 06:05                2689
imagick.deskewimage.php                            24-Jun-2024 06:05               11091
imagick.despeckleimage.php                         24-Jun-2024 06:05                4320
imagick.destroy.php                                24-Jun-2024 06:05                2448
imagick.displayimage.php                           24-Jun-2024 06:05                2850
imagick.displayimages.php                          24-Jun-2024 06:05                2894
imagick.distortimage.php                           24-Jun-2024 06:05               11930
imagick.drawimage.php                              24-Jun-2024 06:05                2677
imagick.edgeimage.php                              24-Jun-2024 06:05                4733
imagick.embossimage.php                            24-Jun-2024 06:05                5430
imagick.encipherimage.php                          24-Jun-2024 06:05                3319
imagick.enhanceimage.php                           24-Jun-2024 06:05                4287
imagick.equalizeimage.php                          24-Jun-2024 06:05                4254
imagick.evaluateimage.php                          24-Jun-2024 06:05                5987
imagick.examples-1.php                             24-Jun-2024 06:05               29978
imagick.examples.php                               24-Jun-2024 06:05                1417
imagick.exportimagepixels.php                      24-Jun-2024 06:05                8011
imagick.extentimage.php                            24-Jun-2024 06:05                5319
imagick.filter.php                                 24-Jun-2024 06:05                7670
imagick.flattenimages.php                          24-Jun-2024 06:05                2882
imagick.flipimage.php                              24-Jun-2024 06:05                4587
imagick.floodfillpaintimage.php                    24-Jun-2024 06:05               11686
imagick.flopimage.php                              24-Jun-2024 06:05                4619
imagick.forwardfouriertransformimage.php           24-Jun-2024 06:05               12141
imagick.frameimage.php                             24-Jun-2024 06:05                8394
imagick.functionimage.php                          24-Jun-2024 06:05               13819
imagick.fximage.php                                24-Jun-2024 06:05                6111
imagick.gammaimage.php                             24-Jun-2024 06:05                5772
imagick.gaussianblurimage.php                      24-Jun-2024 06:05                6308
imagick.getcolorspace.php                          24-Jun-2024 06:05                2510
imagick.getcompression.php                         24-Jun-2024 06:05                2315
imagick.getcompressionquality.php                  24-Jun-2024 06:05                2389
imagick.getcopyright.php                           24-Jun-2024 06:05                2418
imagick.getfilename.php                            24-Jun-2024 06:05                2495
imagick.getfont.php                                24-Jun-2024 06:05                3142
imagick.getformat.php                              24-Jun-2024 06:05                2457
imagick.getgravity.php                             24-Jun-2024 06:05                2489
imagick.gethomeurl.php                             24-Jun-2024 06:05                2295
imagick.getimage.php                               24-Jun-2024 06:05                2499
imagick.getimagealphachannel.php                   24-Jun-2024 06:05                3600
imagick.getimageartifact.php                       24-Jun-2024 06:05                3630
imagick.getimageattribute.php                      24-Jun-2024 06:05                2849
imagick.getimagebackgroundcolor.php                24-Jun-2024 06:05                2665
imagick.getimageblob.php                           24-Jun-2024 06:05                2751
imagick.getimageblueprimary.php                    24-Jun-2024 06:05                2943
imagick.getimagebordercolor.php                    24-Jun-2024 06:05                2681
imagick.getimagechanneldepth.php                   24-Jun-2024 06:05                3275
imagick.getimagechanneldistortion.php              24-Jun-2024 06:05                4140
imagick.getimagechanneldistortions.php             24-Jun-2024 06:05                4574
imagick.getimagechannelextrema.php                 24-Jun-2024 06:05                3692
imagick.getimagechannelkurtosis.php                24-Jun-2024 06:05                3709
imagick.getimagechannelmean.php                    24-Jun-2024 06:05                3309
imagick.getimagechannelrange.php                   24-Jun-2024 06:05                3562
imagick.getimagechannelstatistics.php              24-Jun-2024 06:05                2653
imagick.getimageclipmask.php                       24-Jun-2024 06:05                3042
imagick.getimagecolormapcolor.php                  24-Jun-2024 06:05                3017
imagick.getimagecolors.php                         24-Jun-2024 06:05                2459
imagick.getimagecolorspace.php                     24-Jun-2024 06:05                2442
imagick.getimagecompose.php                        24-Jun-2024 06:05                2459
imagick.getimagecompression.php                    24-Jun-2024 06:05                2403
imagick.getimagecompressionquality.php             24-Jun-2024 06:05                2497
imagick.getimagedelay.php                          24-Jun-2024 06:05                2488
imagick.getimagedepth.php                          24-Jun-2024 06:05                2248
imagick.getimagedispose.php                        24-Jun-2024 06:05                2528
imagick.getimagedistortion.php                     24-Jun-2024 06:05                3314
imagick.getimageextrema.php                        24-Jun-2024 06:05                2932
imagick.getimagefilename.php                       24-Jun-2024 06:05                2602
imagick.getimageformat.php                         24-Jun-2024 06:05                2584
imagick.getimagegamma.php                          24-Jun-2024 06:05                2483
imagick.getimagegeometry.php                       24-Jun-2024 06:05                4208
imagick.getimagegravity.php                        24-Jun-2024 06:05                2782
imagick.getimagegreenprimary.php                   24-Jun-2024 06:05                2753
imagick.getimageheight.php                         24-Jun-2024 06:05                2514
imagick.getimagehistogram.php                      24-Jun-2024 06:05               17257
imagick.getimageindex.php                          24-Jun-2024 06:05                3039
imagick.getimageinterlacescheme.php                24-Jun-2024 06:05                2559
imagick.getimageinterpolatemethod.php              24-Jun-2024 06:05                2787
imagick.getimageiterations.php                     24-Jun-2024 06:05                2576
imagick.getimagelength.php                         24-Jun-2024 06:05                3431
imagick.getimagematte.php                          24-Jun-2024 06:05                2894
imagick.getimagemattecolor.php                     24-Jun-2024 06:05                2847
imagick.getimagemimetype.php                       24-Jun-2024 06:05                2313
imagick.getimageorientation.php                    24-Jun-2024 06:05                2680
imagick.getimagepage.php                           24-Jun-2024 06:05                2745
imagick.getimagepixelcolor.php                     24-Jun-2024 06:05                3209
imagick.getimageprofile.php                        24-Jun-2024 06:05                2853
imagick.getimageprofiles.php                       24-Jun-2024 06:05                3611
imagick.getimageproperties.php                     24-Jun-2024 06:05                5867
imagick.getimageproperty.php                       24-Jun-2024 06:05                5015
imagick.getimageredprimary.php                     24-Jun-2024 06:05                2840
imagick.getimageregion.php                         24-Jun-2024 06:05                4009
imagick.getimagerenderingintent.php                24-Jun-2024 06:05                2704
imagick.getimageresolution.php                     24-Jun-2024 06:05                2580
imagick.getimagesblob.php                          24-Jun-2024 06:05                2573
imagick.getimagescene.php                          24-Jun-2024 06:05                2470
imagick.getimagesignature.php                      24-Jun-2024 06:05                2599
imagick.getimagesize.php                           24-Jun-2024 06:05                2697
imagick.getimagetickspersecond.php                 24-Jun-2024 06:05                2616
imagick.getimagetotalinkdensity.php                24-Jun-2024 06:05                2545
imagick.getimagetype.php                           24-Jun-2024 06:05                4923
imagick.getimageunits.php                          24-Jun-2024 06:05                2532
imagick.getimagevirtualpixelmethod.php             24-Jun-2024 06:05                2683
imagick.getimagewhitepoint.php                     24-Jun-2024 06:05                2733
imagick.getimagewidth.php                          24-Jun-2024 06:05                2488
imagick.getinterlacescheme.php                     24-Jun-2024 06:05                2634
imagick.getiteratorindex.php                       24-Jun-2024 06:05                6171
imagick.getnumberimages.php                        24-Jun-2024 06:05                2583
imagick.getoption.php                              24-Jun-2024 06:05                2827
imagick.getpackagename.php                         24-Jun-2024 06:05                2556
imagick.getpage.php                                24-Jun-2024 06:05                2549
imagick.getpixeliterator.php                       24-Jun-2024 06:05                6043
imagick.getpixelregioniterator.php                 24-Jun-2024 06:05                6791
imagick.getpointsize.php                           24-Jun-2024 06:05                2858
imagick.getquantum.php                             24-Jun-2024 06:05                2341
imagick.getquantumdepth.php                        24-Jun-2024 06:05                2667
imagick.getquantumrange.php                        24-Jun-2024 06:05                2929
imagick.getregistry.php                            24-Jun-2024 06:05                2556
imagick.getreleasedate.php                         24-Jun-2024 06:05                2580
imagick.getresource.php                            24-Jun-2024 06:05                2984
imagick.getresourcelimit.php                       24-Jun-2024 06:05                3401
imagick.getsamplingfactors.php                     24-Jun-2024 06:05                2644
imagick.getsize.php                                24-Jun-2024 06:05                5882
imagick.getsizeoffset.php                          24-Jun-2024 06:05                2650
imagick.getversion.php                             24-Jun-2024 06:05                2566
imagick.haldclutimage.php                          24-Jun-2024 06:05                6185
imagick.hasnextimage.php                           24-Jun-2024 06:05                2691
imagick.haspreviousimage.php                       24-Jun-2024 06:05                2729
imagick.identifyformat.php                         24-Jun-2024 06:05                4515
imagick.identifyimage.php                          24-Jun-2024 06:05                4161
imagick.implodeimage.php                           24-Jun-2024 06:05                4723
imagick.importimagepixels.php                      24-Jun-2024 06:05               11477
imagick.installation.php                           24-Jun-2024 06:05                3099
imagick.inversefouriertransformimage.php           24-Jun-2024 06:05                3535
imagick.labelimage.php                             24-Jun-2024 06:05                2633
imagick.levelimage.php                             24-Jun-2024 06:05                7838
imagick.linearstretchimage.php                     24-Jun-2024 06:05                5730
imagick.liquidrescaleimage.php                     24-Jun-2024 06:05                4582
imagick.listregistry.php                           24-Jun-2024 06:05                2400
imagick.magnifyimage.php                           24-Jun-2024 06:05                4286
imagick.mapimage.php                               24-Jun-2024 06:05                3299
imagick.mattefloodfillimage.php                    24-Jun-2024 06:05                5839
imagick.medianfilterimage.php                      24-Jun-2024 06:05                5201
imagick.mergeimagelayers.php                       24-Jun-2024 06:05                6532
imagick.minifyimage.php                            24-Jun-2024 06:05                2428
imagick.modulateimage.php                          24-Jun-2024 06:05                5678
imagick.montageimage.php                           24-Jun-2024 06:05                4602
imagick.morphimages.php                            24-Jun-2024 06:05                2853
imagick.morphology.php                             24-Jun-2024 06:05               66909
imagick.mosaicimages.php                           24-Jun-2024 06:05                2767
imagick.motionblurimage.php                        24-Jun-2024 06:05                6849
imagick.negateimage.php                            24-Jun-2024 06:05                5622
imagick.newimage.php                               24-Jun-2024 06:05                6362
imagick.newpseudoimage.php                         24-Jun-2024 06:05                5880
imagick.nextimage.php                              24-Jun-2024 06:05                2360
imagick.normalizeimage.php                         24-Jun-2024 06:05                6451
imagick.oilpaintimage.php                          24-Jun-2024 06:05                4656
imagick.opaquepaintimage.php                       24-Jun-2024 06:05                5116
imagick.optimizeimagelayers.php                    24-Jun-2024 06:05                5403
imagick.orderedposterizeimage.php                  24-Jun-2024 06:05                6895
imagick.paintfloodfillimage.php                    24-Jun-2024 06:05                5826
imagick.paintopaqueimage.php                       24-Jun-2024 06:05                5450
imagick.painttransparentimage.php                  24-Jun-2024 06:05                4715
imagick.pingimage.php                              24-Jun-2024 06:05                2755
imagick.pingimageblob.php                          24-Jun-2024 06:05                6035
imagick.pingimagefile.php                          24-Jun-2024 06:05                5867
imagick.polaroidimage.php                          24-Jun-2024 06:05                4824
imagick.posterizeimage.php                         24-Jun-2024 06:05                5689
imagick.previewimages.php                          24-Jun-2024 06:05                3172
imagick.previousimage.php                          24-Jun-2024 06:05                2415
imagick.profileimage.php                           24-Jun-2024 06:05                3260
imagick.quantizeimage.php                          24-Jun-2024 06:05                6762
imagick.quantizeimages.php                         24-Jun-2024 06:05                4089
imagick.queryfontmetrics.php                       24-Jun-2024 06:05                5642
imagick.queryfonts.php                             24-Jun-2024 06:05                4788
imagick.queryformats.php                           24-Jun-2024 06:05                7163
imagick.radialblurimage.php                        24-Jun-2024 06:05                5588
imagick.raiseimage.php                             24-Jun-2024 06:05                6573
imagick.randomthresholdimage.php                   24-Jun-2024 06:05                6506
imagick.readimage.php                              24-Jun-2024 06:05                2597
imagick.readimageblob.php                          24-Jun-2024 06:05                5501
imagick.readimagefile.php                          24-Jun-2024 06:05                3258
imagick.readimages.php                             24-Jun-2024 06:05                2644
imagick.recolorimage.php                           24-Jun-2024 06:05                6411
imagick.reducenoiseimage.php                       24-Jun-2024 06:05                5251
imagick.remapimage.php                             24-Jun-2024 06:05                3525
imagick.removeimage.php                            24-Jun-2024 06:05                2571
imagick.removeimageprofile.php                     24-Jun-2024 06:05                2848
imagick.render.php                                 24-Jun-2024 06:05                2323
imagick.requirements.php                           24-Jun-2024 06:05                1657
imagick.resampleimage.php                          24-Jun-2024 06:05                5682
imagick.resetimagepage.php                         24-Jun-2024 06:05                2873
imagick.resizeimage.php                            24-Jun-2024 06:05               11373
imagick.resources.php                              24-Jun-2024 06:05                1314
imagick.rollimage.php                              24-Jun-2024 06:05                4854
imagick.rotateimage.php                            24-Jun-2024 06:05                5744
imagick.rotationalblurimage.php                    24-Jun-2024 06:05                5820
imagick.roundcorners.php                           24-Jun-2024 06:05                6811
imagick.sampleimage.php                            24-Jun-2024 06:05                3020
imagick.scaleimage.php                             24-Jun-2024 06:05                7061
imagick.segmentimage.php                           24-Jun-2024 06:05                6837
imagick.selectiveblurimage.php                     24-Jun-2024 06:05                6683
imagick.separateimagechannel.php                   24-Jun-2024 06:05                5458
imagick.sepiatoneimage.php                         24-Jun-2024 06:05                4954
imagick.setbackgroundcolor.php                     24-Jun-2024 06:05                3314
imagick.setcolorspace.php                          24-Jun-2024 06:05                3082
imagick.setcompression.php                         24-Jun-2024 06:05                2814
imagick.setcompressionquality.php                  24-Jun-2024 06:05                6975
imagick.setfilename.php                            24-Jun-2024 06:05                2684
imagick.setfirstiterator.php                       24-Jun-2024 06:05                2409
imagick.setfont.php                                24-Jun-2024 06:05                5596
imagick.setformat.php                              24-Jun-2024 06:05                2586
imagick.setgravity.php                             24-Jun-2024 06:05                2793
imagick.setimage.php                               24-Jun-2024 06:05                4765
imagick.setimagealphachannel.php                   24-Jun-2024 06:05                3746
imagick.setimageartifact.php                       24-Jun-2024 06:05                7409
imagick.setimageattribute.php                      24-Jun-2024 06:05                3203
imagick.setimagebackgroundcolor.php                24-Jun-2024 06:05                3563
imagick.setimagebias.php                           24-Jun-2024 06:05                6814
imagick.setimagebiasquantum.php                    24-Jun-2024 06:05                2924
imagick.setimageblueprimary.php                    24-Jun-2024 06:05                3219
imagick.setimagebordercolor.php                    24-Jun-2024 06:05                3541
imagick.setimagechanneldepth.php                   24-Jun-2024 06:05                3236
imagick.setimageclipmask.php                       24-Jun-2024 06:05                8794
imagick.setimagecolormapcolor.php                  24-Jun-2024 06:05                3259
imagick.setimagecolorspace.php                     24-Jun-2024 06:05                3280
imagick.setimagecompose.php                        24-Jun-2024 06:05                2999
imagick.setimagecompression.php                    24-Jun-2024 06:05                2971
imagick.setimagecompressionquality.php             24-Jun-2024 06:05                4946
imagick.setimagedelay.php                          24-Jun-2024 06:05                6227
imagick.setimagedepth.php                          24-Jun-2024 06:05                2817
imagick.setimagedispose.php                        24-Jun-2024 06:05                2861
imagick.setimageextent.php                         24-Jun-2024 06:05                3136
imagick.setimagefilename.php                       24-Jun-2024 06:05                2913
imagick.setimageformat.php                         24-Jun-2024 06:05                2785
imagick.setimagegamma.php                          24-Jun-2024 06:05                2821
imagick.setimagegravity.php                        24-Jun-2024 06:05                2958
imagick.setimagegreenprimary.php                   24-Jun-2024 06:05                3212
imagick.setimageindex.php                          24-Jun-2024 06:05                3419
imagick.setimageinterlacescheme.php                24-Jun-2024 06:05                2981
imagick.setimageinterpolatemethod.php              24-Jun-2024 06:05                2888
imagick.setimageiterations.php                     24-Jun-2024 06:05                5073
imagick.setimagematte.php                          24-Jun-2024 06:05                2831
imagick.setimagemattecolor.php                     24-Jun-2024 06:05                3754
imagick.setimageopacity.php                        24-Jun-2024 06:05                5102
imagick.setimageorientation.php                    24-Jun-2024 06:05                4765
imagick.setimagepage.php                           24-Jun-2024 06:05                3775
imagick.setimageprofile.php                        24-Jun-2024 06:05                3355
imagick.setimageproperty.php                       24-Jun-2024 06:05                5241
imagick.setimageredprimary.php                     24-Jun-2024 06:05                3208
imagick.setimagerenderingintent.php                24-Jun-2024 06:05                2987
imagick.setimageresolution.php                     24-Jun-2024 06:05                5067
imagick.setimagescene.php                          24-Jun-2024 06:05                2841
imagick.setimagetickspersecond.php                 24-Jun-2024 06:05                7788
imagick.setimagetype.php                           24-Jun-2024 06:05                2619
imagick.setimageunits.php                          24-Jun-2024 06:05                2655
imagick.setimagevirtualpixelmethod.php             24-Jun-2024 06:05                2775
imagick.setimagewhitepoint.php                     24-Jun-2024 06:05                3206
imagick.setinterlacescheme.php                     24-Jun-2024 06:05                2703
imagick.setiteratorindex.php                       24-Jun-2024 06:05                6318
imagick.setlastiterator.php                        24-Jun-2024 06:05                2423
imagick.setoption.php                              24-Jun-2024 06:05               11603
imagick.setpage.php                                24-Jun-2024 06:05                3508
imagick.setpointsize.php                           24-Jun-2024 06:05                5299
imagick.setprogressmonitor.php                     24-Jun-2024 06:05               10287
imagick.setregistry.php                            24-Jun-2024 06:05                3101
imagick.setresolution.php                          24-Jun-2024 06:05                3800
imagick.setresourcelimit.php                       24-Jun-2024 06:05                3720
imagick.setsamplingfactors.php                     24-Jun-2024 06:05                6819
imagick.setsize.php                                24-Jun-2024 06:05                2934
imagick.setsizeoffset.php                          24-Jun-2024 06:05                3467
imagick.settype.php                                24-Jun-2024 06:05                2565
imagick.setup.php                                  24-Jun-2024 06:05                1737
imagick.shadeimage.php                             24-Jun-2024 06:05                5718
imagick.shadowimage.php                            24-Jun-2024 06:05                5493
imagick.sharpenimage.php                           24-Jun-2024 06:05                5663
imagick.shaveimage.php                             24-Jun-2024 06:05                4796
imagick.shearimage.php                             24-Jun-2024 06:05                6524
imagick.sigmoidalcontrastimage.php                 24-Jun-2024 06:05                8044
imagick.sketchimage.php                            24-Jun-2024 06:05                5921
imagick.smushimages.php                            24-Jun-2024 06:05                5838
imagick.solarizeimage.php                          24-Jun-2024 06:05                4899
imagick.sparsecolorimage.php                       24-Jun-2024 06:05               26832
imagick.spliceimage.php                            24-Jun-2024 06:05                5861
imagick.spreadimage.php                            24-Jun-2024 06:05                4729
imagick.statisticimage.php                         24-Jun-2024 06:05                6783
imagick.steganoimage.php                           24-Jun-2024 06:05                3086
imagick.stereoimage.php                            24-Jun-2024 06:05                2892
imagick.stripimage.php                             24-Jun-2024 06:05                2568
imagick.subimagematch.php                          24-Jun-2024 06:05                7552
imagick.swirlimage.php                             24-Jun-2024 06:05                4781
imagick.textureimage.php                           24-Jun-2024 06:05                6187
imagick.thresholdimage.php                         24-Jun-2024 06:05                5315
imagick.thumbnailimage.php                         24-Jun-2024 06:05                7614
imagick.tintimage.php                              24-Jun-2024 06:05                7881
imagick.tostring.php                               24-Jun-2024 06:05                2973
imagick.transformimage.php                         24-Jun-2024 06:05                6088
imagick.transformimagecolorspace.php               24-Jun-2024 06:05                5795
imagick.transparentpaintimage.php                  24-Jun-2024 06:05                7332
imagick.transposeimage.php                         24-Jun-2024 06:05                4666
imagick.transverseimage.php                        24-Jun-2024 06:05                4654
imagick.trimimage.php                              24-Jun-2024 06:05                5818
imagick.uniqueimagecolors.php                      24-Jun-2024 06:05                5598
imagick.unsharpmaskimage.php                       24-Jun-2024 06:05                6771
imagick.valid.php                                  24-Jun-2024 06:05                2303
imagick.vignetteimage.php                          24-Jun-2024 06:05                6672
imagick.waveimage.php                              24-Jun-2024 06:05                6413
imagick.whitethresholdimage.php                    24-Jun-2024 06:05                5266
imagick.writeimage.php                             24-Jun-2024 06:05                3064
imagick.writeimagefile.php                         24-Jun-2024 06:05                3832
imagick.writeimages.php                            24-Jun-2024 06:05                2918
imagick.writeimagesfile.php                        24-Jun-2024 06:05                3882
imagickdraw.affine.php                             24-Jun-2024 06:05               17007
imagickdraw.annotation.php                         24-Jun-2024 06:05                3381
imagickdraw.arc.php                                24-Jun-2024 06:05                9736
imagickdraw.bezier.php                             24-Jun-2024 06:05               16896
imagickdraw.circle.php                             24-Jun-2024 06:05                9119
imagickdraw.clear.php                              24-Jun-2024 06:05                2377
imagickdraw.clone.php                              24-Jun-2024 06:05                2480
imagickdraw.color.php                              24-Jun-2024 06:05                3546
imagickdraw.comment.php                            24-Jun-2024 06:05                2789
imagickdraw.composite.php                          24-Jun-2024 06:05               12017
imagickdraw.construct.php                          24-Jun-2024 06:05                2255
imagickdraw.destroy.php                            24-Jun-2024 06:05                2359
imagickdraw.ellipse.php                            24-Jun-2024 06:05               12270
imagickdraw.getclippath.php                        24-Jun-2024 06:05                2350
imagickdraw.getcliprule.php                        24-Jun-2024 06:05                2471
imagickdraw.getclipunits.php                       24-Jun-2024 06:05                2415
imagickdraw.getfillcolor.php                       24-Jun-2024 06:05                2424
imagickdraw.getfillopacity.php                     24-Jun-2024 06:05                2384
imagickdraw.getfillrule.php                        24-Jun-2024 06:05                2433
imagickdraw.getfont.php                            24-Jun-2024 06:05                2317
imagickdraw.getfontfamily.php                      24-Jun-2024 06:05                2377
imagickdraw.getfontsize.php                        24-Jun-2024 06:05                2453
imagickdraw.getfontstretch.php                     24-Jun-2024 06:05                2408
imagickdraw.getfontstyle.php                       24-Jun-2024 06:05                2596
imagickdraw.getfontweight.php                      24-Jun-2024 06:05                2435
imagickdraw.getgravity.php                         24-Jun-2024 06:05                2501
imagickdraw.getstrokeantialias.php                 24-Jun-2024 06:05                2773
imagickdraw.getstrokecolor.php                     24-Jun-2024 06:05                2818
imagickdraw.getstrokedasharray.php                 24-Jun-2024 06:05                2511
imagickdraw.getstrokedashoffset.php                24-Jun-2024 06:05                2485
imagickdraw.getstrokelinecap.php                   24-Jun-2024 06:05                2626
imagickdraw.getstrokelinejoin.php                  24-Jun-2024 06:05                2655
imagickdraw.getstrokemiterlimit.php                24-Jun-2024 06:05                2747
imagickdraw.getstrokeopacity.php                   24-Jun-2024 06:05                2488
imagickdraw.getstrokewidth.php                     24-Jun-2024 06:05                2497
imagickdraw.gettextalignment.php                   24-Jun-2024 06:05                2517
imagickdraw.gettextantialias.php                   24-Jun-2024 06:05                2654
imagickdraw.gettextdecoration.php                  24-Jun-2024 06:05                2554
imagickdraw.gettextencoding.php                    24-Jun-2024 06:05                2479
imagickdraw.gettextinterlinespacing.php            24-Jun-2024 06:05                2445
imagickdraw.gettextinterwordspacing.php            24-Jun-2024 06:05                2469
imagickdraw.gettextkerning.php                     24-Jun-2024 06:05                2364
imagickdraw.gettextundercolor.php                  24-Jun-2024 06:05                2527
imagickdraw.getvectorgraphics.php                  24-Jun-2024 06:05                2577
imagickdraw.line.php                               24-Jun-2024 06:05                8383
imagickdraw.matte.php                              24-Jun-2024 06:05                8404
imagickdraw.pathclose.php                          24-Jun-2024 06:05                2482
imagickdraw.pathcurvetoabsolute.php                24-Jun-2024 06:05                4942
imagickdraw.pathcurvetoquadraticbezierabsolute.php 24-Jun-2024 06:05               11203
imagickdraw.pathcurvetoquadraticbezierrelative.php 24-Jun-2024 06:05                4323
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 24-Jun-2024 06:05               10358
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 24-Jun-2024 06:05               10494
imagickdraw.pathcurvetorelative.php                24-Jun-2024 06:05                4958
imagickdraw.pathcurvetosmoothabsolute.php          24-Jun-2024 06:05                4695
imagickdraw.pathcurvetosmoothrelative.php          24-Jun-2024 06:05                4702
imagickdraw.pathellipticarcabsolute.php            24-Jun-2024 06:05                5715
imagickdraw.pathellipticarcrelative.php            24-Jun-2024 06:05                5685
imagickdraw.pathfinish.php                         24-Jun-2024 06:05                2315
imagickdraw.pathlinetoabsolute.php                 24-Jun-2024 06:05                3248
imagickdraw.pathlinetohorizontalabsolute.php       24-Jun-2024 06:05                3098
imagickdraw.pathlinetohorizontalrelative.php       24-Jun-2024 06:05                3093
imagickdraw.pathlinetorelative.php                 24-Jun-2024 06:05                3298
imagickdraw.pathlinetoverticalabsolute.php         24-Jun-2024 06:05                3062
imagickdraw.pathlinetoverticalrelative.php         24-Jun-2024 06:05                3067
imagickdraw.pathmovetoabsolute.php                 24-Jun-2024 06:05                3295
imagickdraw.pathmovetorelative.php                 24-Jun-2024 06:05                3231
imagickdraw.pathstart.php                          24-Jun-2024 06:05               11827
imagickdraw.point.php                              24-Jun-2024 06:05                6913
imagickdraw.polygon.php                            24-Jun-2024 06:05                9001
imagickdraw.polyline.php                           24-Jun-2024 06:05                9005
imagickdraw.pop.php                                24-Jun-2024 06:05                2725
imagickdraw.popclippath.php                        24-Jun-2024 06:05                2274
imagickdraw.popdefs.php                            24-Jun-2024 06:05                7767
imagickdraw.poppattern.php                         24-Jun-2024 06:05                2458
imagickdraw.push.php                               24-Jun-2024 06:05                8486
imagickdraw.pushclippath.php                       24-Jun-2024 06:05                2971
imagickdraw.pushdefs.php                           24-Jun-2024 06:05                2573
imagickdraw.pushpattern.php                        24-Jun-2024 06:05               14657
imagickdraw.rectangle.php                          24-Jun-2024 06:05                8589
imagickdraw.render.php                             24-Jun-2024 06:05                2500
imagickdraw.resetvectorgraphics.php                24-Jun-2024 06:05                2461
imagickdraw.rotate.php                             24-Jun-2024 06:05                7784
imagickdraw.roundrectangle.php                     24-Jun-2024 06:05                9439
imagickdraw.scale.php                              24-Jun-2024 06:05                8130
imagickdraw.setclippath.php                        24-Jun-2024 06:05                8461
imagickdraw.setcliprule.php                        24-Jun-2024 06:05                9472
imagickdraw.setclipunits.php                       24-Jun-2024 06:05                8849
imagickdraw.setfillalpha.php                       24-Jun-2024 06:05                7805
imagickdraw.setfillcolor.php                       24-Jun-2024 06:05                7807
imagickdraw.setfillopacity.php                     24-Jun-2024 06:05                7863
imagickdraw.setfillpatternurl.php                  24-Jun-2024 06:05                3292
imagickdraw.setfillrule.php                        24-Jun-2024 06:05               13009
imagickdraw.setfont.php                            24-Jun-2024 06:05                9316
imagickdraw.setfontfamily.php                      24-Jun-2024 06:05                9928
imagickdraw.setfontsize.php                        24-Jun-2024 06:05                8311
imagickdraw.setfontstretch.php                     24-Jun-2024 06:05                9738
imagickdraw.setfontstyle.php                       24-Jun-2024 06:05                9028
imagickdraw.setfontweight.php                      24-Jun-2024 06:05                9171
imagickdraw.setgravity.php                         24-Jun-2024 06:05               10595
imagickdraw.setresolution.php                      24-Jun-2024 06:05                2943
imagickdraw.setstrokealpha.php                     24-Jun-2024 06:05                8465
imagickdraw.setstrokeantialias.php                 24-Jun-2024 06:05                9004
imagickdraw.setstrokecolor.php                     24-Jun-2024 06:05                8524
imagickdraw.setstrokedasharray.php                 24-Jun-2024 06:05               13446
imagickdraw.setstrokedashoffset.php                24-Jun-2024 06:05                9896
imagickdraw.setstrokelinecap.php                   24-Jun-2024 06:05                8612
imagickdraw.setstrokelinejoin.php                  24-Jun-2024 06:05               11498
imagickdraw.setstrokemiterlimit.php                24-Jun-2024 06:05               11315
imagickdraw.setstrokeopacity.php                   24-Jun-2024 06:05               10261
imagickdraw.setstrokepatternurl.php                24-Jun-2024 06:05                2996
imagickdraw.setstrokewidth.php                     24-Jun-2024 06:05                8496
imagickdraw.settextalignment.php                   24-Jun-2024 06:05                9477
imagickdraw.settextantialias.php                   24-Jun-2024 06:05                8891
imagickdraw.settextdecoration.php                  24-Jun-2024 06:05                7513
imagickdraw.settextencoding.php                    24-Jun-2024 06:05                3178
imagickdraw.settextinterlinespacing.php            24-Jun-2024 06:05                2971
imagickdraw.settextinterwordspacing.php            24-Jun-2024 06:05                2807
imagickdraw.settextkerning.php                     24-Jun-2024 06:05                2880
imagickdraw.settextundercolor.php                  24-Jun-2024 06:05                7829
imagickdraw.setvectorgraphics.php                  24-Jun-2024 06:05                8991
imagickdraw.setviewbox.php                         24-Jun-2024 06:05               10374
imagickdraw.skewx.php                              24-Jun-2024 06:05                8195
imagickdraw.skewy.php                              24-Jun-2024 06:05                8184
imagickdraw.translate.php                          24-Jun-2024 06:05                8522
imagickkernel.addkernel.php                        24-Jun-2024 06:05                7068
imagickkernel.addunitykernel.php                   24-Jun-2024 06:05               13731
imagickkernel.frombuiltin.php                      24-Jun-2024 06:05               26273
imagickkernel.frommatrix.php                       24-Jun-2024 06:05               23205
imagickkernel.getmatrix.php                        24-Jun-2024 06:05                7127
imagickkernel.scale.php                            24-Jun-2024 06:05               13235
imagickkernel.separate.php                         24-Jun-2024 06:05                9780
imagickpixel.clear.php                             24-Jun-2024 06:05                2421
imagickpixel.construct.php                         24-Jun-2024 06:05               11855
imagickpixel.destroy.php                           24-Jun-2024 06:05                2510
imagickpixel.getcolor.php                          24-Jun-2024 06:05                7908
imagickpixel.getcolorasstring.php                  24-Jun-2024 06:05                4888
imagickpixel.getcolorcount.php                     24-Jun-2024 06:05                4956
imagickpixel.getcolorquantum.php                   24-Jun-2024 06:05                2922
imagickpixel.getcolorvalue.php                     24-Jun-2024 06:05                8679
imagickpixel.getcolorvaluequantum.php              24-Jun-2024 06:05                6143
imagickpixel.gethsl.php                            24-Jun-2024 06:05                4391
imagickpixel.getindex.php                          24-Jun-2024 06:05                2311
imagickpixel.ispixelsimilar.php                    24-Jun-2024 06:05                3664
imagickpixel.ispixelsimilarquantum.php             24-Jun-2024 06:05                3261
imagickpixel.issimilar.php                         24-Jun-2024 06:05               16573
imagickpixel.setcolor.php                          24-Jun-2024 06:05                7533
imagickpixel.setcolorcount.php                     24-Jun-2024 06:05                2716
imagickpixel.setcolorvalue.php                     24-Jun-2024 06:05                5206
imagickpixel.setcolorvaluequantum.php              24-Jun-2024 06:05                8501
imagickpixel.sethsl.php                            24-Jun-2024 06:05                7559
imagickpixel.setindex.php                          24-Jun-2024 06:05                2645
imagickpixeliterator.clear.php                     24-Jun-2024 06:05                6347
imagickpixeliterator.construct.php                 24-Jun-2024 06:05                6020
imagickpixeliterator.destroy.php                   24-Jun-2024 06:05                2551
imagickpixeliterator.getcurrentiteratorrow.php     24-Jun-2024 06:05                2650
imagickpixeliterator.getiteratorrow.php            24-Jun-2024 06:05                2575
imagickpixeliterator.getnextiteratorrow.php        24-Jun-2024 06:05                6770
imagickpixeliterator.getpreviousiteratorrow.php    24-Jun-2024 06:05                2719
imagickpixeliterator.newpixeliterator.php          24-Jun-2024 06:05                2804
imagickpixeliterator.newpixelregioniterator.php    24-Jun-2024 06:05                4313
imagickpixeliterator.resetiterator.php             24-Jun-2024 06:05                8755
imagickpixeliterator.setiteratorfirstrow.php       24-Jun-2024 06:05                2645
imagickpixeliterator.setiteratorlastrow.php        24-Jun-2024 06:05                2638
imagickpixeliterator.setiteratorrow.php            24-Jun-2024 06:05                7163
imagickpixeliterator.synciterator.php              24-Jun-2024 06:05                2493
imap.configuration.php                             24-Jun-2024 06:05                3367
imap.constants.php                                 24-Jun-2024 06:05               24906
imap.installation.php                              24-Jun-2024 06:05                2746
imap.requirements.php                              24-Jun-2024 06:05                3130
imap.resources.php                                 24-Jun-2024 06:05                1490
imap.setup.php                                     24-Jun-2024 06:05                1706
index.php                                          24-Jun-2024 06:06               16041
indexes.examples.php                               24-Jun-2024 06:06              736756
indexes.functions.php                              24-Jun-2024 06:06             1202743
indexes.php                                        24-Jun-2024 06:06                1528
infiniteiterator.construct.php                     24-Jun-2024 06:05                5118
infiniteiterator.next.php                          24-Jun-2024 06:05                3360
info.configuration.php                             24-Jun-2024 06:05               13574
info.constants.php                                 24-Jun-2024 06:05               24330
info.requirements.php                              24-Jun-2024 06:05                1333
info.resources.php                                 24-Jun-2024 06:05                1296
info.setup.php                                     24-Jun-2024 06:05                1641
ini.core.php                                       24-Jun-2024 06:06               75155
ini.list.php                                       24-Jun-2024 06:06              105410
ini.php                                            24-Jun-2024 06:06                1652
ini.sections.php                                   24-Jun-2024 06:06                4198
inotify.configuration.php                          24-Jun-2024 06:05                1398
inotify.constants.php                              24-Jun-2024 06:05               10472
inotify.install.php                                24-Jun-2024 06:05                1894
inotify.requirements.php                           24-Jun-2024 06:05                1344
inotify.resources.php                              24-Jun-2024 06:05                1424
inotify.setup.php                                  24-Jun-2024 06:05                1754
install.cloud.azure.php                            24-Jun-2024 06:05                4442
install.cloud.digitalocean.php                     24-Jun-2024 06:05                3177
install.cloud.ec2.php                              24-Jun-2024 06:05                1502
install.cloud.php                                  24-Jun-2024 06:05                1822
install.fpm.configuration.php                      24-Jun-2024 06:05               37509
install.fpm.install.php                            24-Jun-2024 06:05                3487
install.fpm.php                                    24-Jun-2024 06:05                3835
install.general.php                                24-Jun-2024 06:05                4893
install.macosx.bundled.php                         24-Jun-2024 06:05               10475
install.macosx.compile.php                         24-Jun-2024 06:05                1422
install.macosx.packages.php                        24-Jun-2024 06:05                3156
install.macosx.php                                 24-Jun-2024 06:05                2064
install.pecl.downloads.php                         24-Jun-2024 06:05                3715
install.pecl.intro.php                             24-Jun-2024 06:05                3212
install.pecl.pear.php                              24-Jun-2024 06:05                3049
install.pecl.php                                   24-Jun-2024 06:05                2172
install.pecl.php-config.php                        24-Jun-2024 06:05                4369
install.pecl.phpize.php                            24-Jun-2024 06:05                3251
install.pecl.static.php                            24-Jun-2024 06:05                3608
install.pecl.windows.php                           24-Jun-2024 06:05                9699
install.php                                        24-Jun-2024 06:05                6132
install.problems.bugs.php                          24-Jun-2024 06:05                2033
install.problems.faq.php                           24-Jun-2024 06:05                1332
install.problems.php                               24-Jun-2024 06:05                1620
install.problems.support.php                       24-Jun-2024 06:05                2428
install.unix.apache2.php                           24-Jun-2024 06:05               12787
install.unix.commandline.php                       24-Jun-2024 06:05                3936
install.unix.debian.php                            24-Jun-2024 06:05                7044
install.unix.lighttpd-14.php                       24-Jun-2024 06:05                6255
install.unix.litespeed.php                         24-Jun-2024 06:05                9348
install.unix.nginx.php                             24-Jun-2024 06:05                8620
install.unix.openbsd.php                           24-Jun-2024 06:05                5975
install.unix.php                                   24-Jun-2024 06:05                8111
install.unix.solaris.php                           24-Jun-2024 06:05                4013
install.windows.apache2.php                        24-Jun-2024 06:05                7142
install.windows.building.php                       24-Jun-2024 06:05                1769
install.windows.commandline.php                    24-Jun-2024 06:05                8429
install.windows.manual.php                         24-Jun-2024 06:05                5620
install.windows.pecl.php                           24-Jun-2024 06:05                1698
install.windows.php                                24-Jun-2024 06:05                3330
install.windows.recommended.php                    24-Jun-2024 06:05                4959
install.windows.requirements.php                   24-Jun-2024 06:05                2355
install.windows.tools.php                          24-Jun-2024 06:05                1903
install.windows.troubleshooting.php                24-Jun-2024 06:05                1912
internaliterator.construct.php                     24-Jun-2024 06:05                2017
internaliterator.current.php                       24-Jun-2024 06:05                2309
internaliterator.key.php                           24-Jun-2024 06:05                2292
internaliterator.next.php                          24-Jun-2024 06:05                2297
internaliterator.rewind.php                        24-Jun-2024 06:05                2333
internaliterator.valid.php                         24-Jun-2024 06:05                2342
intl.configuration.php                             24-Jun-2024 06:05                5437
intl.constants.php                                 24-Jun-2024 06:05               71168
intl.examples.basic.php                            24-Jun-2024 06:05                4432
intl.examples.php                                  24-Jun-2024 06:05                1452
intl.installation.php                              24-Jun-2024 06:05                1888
intl.requirements.php                              24-Jun-2024 06:05                1490
intl.resources.php                                 24-Jun-2024 06:05                1296
intl.setup.php                                     24-Jun-2024 06:05                1707
intlbreakiterator.construct.php                    24-Jun-2024 06:05                4247
intlbreakiterator.createcharacterinstance.php      24-Jun-2024 06:05                3375
intlbreakiterator.createcodepointinstance.php      24-Jun-2024 06:05                2819
intlbreakiterator.createlineinstance.php           24-Jun-2024 06:05                3336
intlbreakiterator.createsentenceinstance.php       24-Jun-2024 06:05                3339
intlbreakiterator.createtitleinstance.php          24-Jun-2024 06:05                3308
intlbreakiterator.createwordinstance.php           24-Jun-2024 06:05                3275
intlbreakiterator.current.php                      24-Jun-2024 06:05                2505
intlbreakiterator.first.php                        24-Jun-2024 06:05                2489
intlbreakiterator.following.php                    24-Jun-2024 06:05                2784
intlbreakiterator.geterrorcode.php                 24-Jun-2024 06:05                3039
intlbreakiterator.geterrormessage.php              24-Jun-2024 06:05                3086
intlbreakiterator.getlocale.php                    24-Jun-2024 06:05                2889
intlbreakiterator.getpartsiterator.php             24-Jun-2024 06:05                3765
intlbreakiterator.gettext.php                      24-Jun-2024 06:05                2621
intlbreakiterator.isboundary.php                   24-Jun-2024 06:05                2751
intlbreakiterator.last.php                         24-Jun-2024 06:05                2495
intlbreakiterator.next.php                         24-Jun-2024 06:05                2915
intlbreakiterator.preceding.php                    24-Jun-2024 06:05                2771
intlbreakiterator.previous.php                     24-Jun-2024 06:05                2542
intlbreakiterator.settext.php                      24-Jun-2024 06:05                3645
intlcalendar.add.php                               24-Jun-2024 06:05                8991
intlcalendar.after.php                             24-Jun-2024 06:05                6955
intlcalendar.before.php                            24-Jun-2024 06:05                4315
intlcalendar.clear.php                             24-Jun-2024 06:05               19285
intlcalendar.construct.php                         24-Jun-2024 06:05                2378
intlcalendar.createinstance.php                    24-Jun-2024 06:05               13815
intlcalendar.equals.php                            24-Jun-2024 06:05               11077
intlcalendar.fielddifference.php                   24-Jun-2024 06:05               11471
intlcalendar.fromdatetime.php                      24-Jun-2024 06:05                8178
intlcalendar.get.php                               24-Jun-2024 06:05                8917
intlcalendar.getactualmaximum.php                  24-Jun-2024 06:05                8848
intlcalendar.getactualminimum.php                  24-Jun-2024 06:05                6048
intlcalendar.getavailablelocales.php               24-Jun-2024 06:05                4539
intlcalendar.getdayofweektype.php                  24-Jun-2024 06:05               10774
intlcalendar.geterrorcode.php                      24-Jun-2024 06:05                9337
intlcalendar.geterrormessage.php                   24-Jun-2024 06:05                6260
intlcalendar.getfirstdayofweek.php                 24-Jun-2024 06:05                8839
intlcalendar.getgreatestminimum.php                24-Jun-2024 06:05                4884
intlcalendar.getkeywordvaluesforlocale.php         24-Jun-2024 06:05                7684
intlcalendar.getleastmaximum.php                   24-Jun-2024 06:05                8497
intlcalendar.getlocale.php                         24-Jun-2024 06:05                6455
intlcalendar.getmaximum.php                        24-Jun-2024 06:05                5561
intlcalendar.getminimaldaysinfirstweek.php         24-Jun-2024 06:05                9177
intlcalendar.getminimum.php                        24-Jun-2024 06:05                4819
intlcalendar.getnow.php                            24-Jun-2024 06:05                5408
intlcalendar.getrepeatedwalltimeoption.php         24-Jun-2024 06:05               10594
intlcalendar.getskippedwalltimeoption.php          24-Jun-2024 06:05               12993
intlcalendar.gettime.php                           24-Jun-2024 06:05                6702
intlcalendar.gettimezone.php                       24-Jun-2024 06:05                7659
intlcalendar.gettype.php                           24-Jun-2024 06:05                5809
intlcalendar.getweekendtransition.php              24-Jun-2024 06:05                5501
intlcalendar.indaylighttime.php                    24-Jun-2024 06:05                8827
intlcalendar.isequivalentto.php                    24-Jun-2024 06:05                8725
intlcalendar.islenient.php                         24-Jun-2024 06:05                8442
intlcalendar.isset.php                             24-Jun-2024 06:05                5034
intlcalendar.isweekend.php                         24-Jun-2024 06:05                9204
intlcalendar.roll.php                              24-Jun-2024 06:05                9699
intlcalendar.set.php                               24-Jun-2024 06:05               16253
intlcalendar.setdate.php                           24-Jun-2024 06:05                4995
intlcalendar.setdatetime.php                       24-Jun-2024 06:05                6919
intlcalendar.setfirstdayofweek.php                 24-Jun-2024 06:05                9001
intlcalendar.setlenient.php                        24-Jun-2024 06:05                5217
intlcalendar.setminimaldaysinfirstweek.php         24-Jun-2024 06:05                5583
intlcalendar.setrepeatedwalltimeoption.php         24-Jun-2024 06:05                6757
intlcalendar.setskippedwalltimeoption.php          24-Jun-2024 06:05                7687
intlcalendar.settime.php                           24-Jun-2024 06:05                8850
intlcalendar.settimezone.php                       24-Jun-2024 06:05               11484
intlcalendar.todatetime.php                        24-Jun-2024 06:05                7357
intlchar.charage.php                               24-Jun-2024 06:05                6080
intlchar.chardigitvalue.php                        24-Jun-2024 06:05                5704
intlchar.chardirection.php                         24-Jun-2024 06:05               10833
intlchar.charfromname.php                          24-Jun-2024 06:05                7472
intlchar.charmirror.php                            24-Jun-2024 06:05                6775
intlchar.charname.php                              24-Jun-2024 06:05                7813
intlchar.chartype.php                              24-Jun-2024 06:05               11691
intlchar.chr.php                                   24-Jun-2024 06:05                5807
intlchar.digit.php                                 24-Jun-2024 06:05                8692
intlchar.enumcharnames.php                         24-Jun-2024 06:05                9271
intlchar.enumchartypes.php                         24-Jun-2024 06:05                5974
intlchar.foldcase.php                              24-Jun-2024 06:05                4274
intlchar.fordigit.php                              24-Jun-2024 06:05                7262
intlchar.getbidipairedbracket.php                  24-Jun-2024 06:05                6560
intlchar.getblockcode.php                          24-Jun-2024 06:05                5714
intlchar.getcombiningclass.php                     24-Jun-2024 06:05                5066
intlchar.getfc-nfkc-closure.php                    24-Jun-2024 06:05                5083
intlchar.getintpropertymaxvalue.php                24-Jun-2024 06:05                6567
intlchar.getintpropertyminvalue.php                24-Jun-2024 06:05                6560
intlchar.getintpropertyvalue.php                   24-Jun-2024 06:05                8365
intlchar.getnumericvalue.php                       24-Jun-2024 06:05                5795
intlchar.getpropertyenum.php                       24-Jun-2024 06:05                6920
intlchar.getpropertyname.php                       24-Jun-2024 06:05                9271
intlchar.getpropertyvalueenum.php                  24-Jun-2024 06:05                8138
intlchar.getpropertyvaluename.php                  24-Jun-2024 06:05               11053
intlchar.getunicodeversion.php                     24-Jun-2024 06:05                4029
intlchar.hasbinaryproperty.php                     24-Jun-2024 06:05                9303
intlchar.isalnum.php                               24-Jun-2024 06:05                6164
intlchar.isalpha.php                               24-Jun-2024 06:05                6032
intlchar.isbase.php                                24-Jun-2024 06:05                6371
intlchar.isblank.php                               24-Jun-2024 06:05                7142
intlchar.iscntrl.php                               24-Jun-2024 06:05                7118
intlchar.isdefined.php                             24-Jun-2024 06:05                7188
intlchar.isdigit.php                               24-Jun-2024 06:05                6424
intlchar.isgraph.php                               24-Jun-2024 06:05                6294
intlchar.isidignorable.php                         24-Jun-2024 06:05                6603
intlchar.isidpart.php                              24-Jun-2024 06:05                7196
intlchar.isidstart.php                             24-Jun-2024 06:05                6636
intlchar.isisocontrol.php                          24-Jun-2024 06:05                5818
intlchar.isjavaidpart.php                          24-Jun-2024 06:05                7228
intlchar.isjavaidstart.php                         24-Jun-2024 06:05                6893
intlchar.isjavaspacechar.php                       24-Jun-2024 06:05                7167
intlchar.islower.php                               24-Jun-2024 06:05                7582
intlchar.ismirrored.php                            24-Jun-2024 06:05                5978
intlchar.isprint.php                               24-Jun-2024 06:05                6429
intlchar.ispunct.php                               24-Jun-2024 06:05                6046
intlchar.isspace.php                               24-Jun-2024 06:05                6936
intlchar.istitle.php                               24-Jun-2024 06:05                7935
intlchar.isualphabetic.php                         24-Jun-2024 06:05                6172
intlchar.isulowercase.php                          24-Jun-2024 06:05                7210
intlchar.isupper.php                               24-Jun-2024 06:05                7590
intlchar.isuuppercase.php                          24-Jun-2024 06:05                7237
intlchar.isuwhitespace.php                         24-Jun-2024 06:05                7765
intlchar.iswhitespace.php                          24-Jun-2024 06:05                7657
intlchar.isxdigit.php                              24-Jun-2024 06:05                7440
intlchar.ord.php                                   24-Jun-2024 06:05                5646
intlchar.tolower.php                               24-Jun-2024 06:05                7987
intlchar.totitle.php                               24-Jun-2024 06:05                8180
intlchar.toupper.php                               24-Jun-2024 06:05                7878
intlcodepointbreakiterator.getlastcodepoint.php    24-Jun-2024 06:05                2744
intldateformatter.create.php                       24-Jun-2024 06:05               30275
intldateformatter.format.php                       24-Jun-2024 06:05               27195
intldateformatter.formatobject.php                 24-Jun-2024 06:05               14808
intldateformatter.getcalendar.php                  24-Jun-2024 06:05               11274
intldateformatter.getcalendarobject.php            24-Jun-2024 06:05                7767
intldateformatter.getdatetype.php                  24-Jun-2024 06:05               11749
intldateformatter.geterrorcode.php                 24-Jun-2024 06:05                8726
intldateformatter.geterrormessage.php              24-Jun-2024 06:05                8693
intldateformatter.getlocale.php                    24-Jun-2024 06:05               13026
intldateformatter.getpattern.php                   24-Jun-2024 06:05               10450
intldateformatter.gettimetype.php                  24-Jun-2024 06:05               12488
intldateformatter.gettimezone.php                  24-Jun-2024 06:05                8756
intldateformatter.gettimezoneid.php                24-Jun-2024 06:05                9043
intldateformatter.islenient.php                    24-Jun-2024 06:05               14821
intldateformatter.localtime.php                    24-Jun-2024 06:05               11632
intldateformatter.parse.php                        24-Jun-2024 06:05               13095
intldateformatter.setcalendar.php                  24-Jun-2024 06:05               14817
intldateformatter.setlenient.php                   24-Jun-2024 06:05               15695
intldateformatter.setpattern.php                   24-Jun-2024 06:05               11648
intldateformatter.settimezone.php                  24-Jun-2024 06:05               12727
intldatepatterngenerator.create.php                24-Jun-2024 06:05                4466
intldatepatterngenerator.getbestpattern.php        24-Jun-2024 06:05                6968
intlgregoriancalendar.construct.php                24-Jun-2024 06:05                5641
intlgregoriancalendar.createfromdate.php           24-Jun-2024 06:05                7567
intlgregoriancalendar.createfromdatetime.php       24-Jun-2024 06:05                9297
intlgregoriancalendar.getgregorianchange.php       24-Jun-2024 06:05                2740
intlgregoriancalendar.isleapyear.php               24-Jun-2024 06:05                3086
intlgregoriancalendar.setgregorianchange.php       24-Jun-2024 06:05                3115
intliterator.current.php                           24-Jun-2024 06:05                2374
intliterator.key.php                               24-Jun-2024 06:05                2356
intliterator.next.php                              24-Jun-2024 06:05                2358
intliterator.rewind.php                            24-Jun-2024 06:05                2390
intliterator.valid.php                             24-Jun-2024 06:05                2383
intlpartsiterator.getbreakiterator.php             24-Jun-2024 06:05                2592
intlrulebasedbreakiterator.construct.php           24-Jun-2024 06:05                3231
intlrulebasedbreakiterator.getbinaryrules.php      24-Jun-2024 06:05                2848
intlrulebasedbreakiterator.getrules.php            24-Jun-2024 06:05                2818
intlrulebasedbreakiterator.getrulestatus.php       24-Jun-2024 06:05                2790
intlrulebasedbreakiterator.getrulestatusvec.php    24-Jun-2024 06:05                2907
intltimezone.construct.php                         24-Jun-2024 06:05                2016
intltimezone.countequivalentids.php                24-Jun-2024 06:05                3710
intltimezone.createdefault.php                     24-Jun-2024 06:05                3040
intltimezone.createenumeration.php                 24-Jun-2024 06:05                4827
intltimezone.createtimezone.php                    24-Jun-2024 06:05                3689
intltimezone.createtimezoneidenumeration.php       24-Jun-2024 06:05                5894
intltimezone.fromdatetimezone.php                  24-Jun-2024 06:05                3817
intltimezone.getcanonicalid.php                    24-Jun-2024 06:05                4437
intltimezone.getdisplayname.php                    24-Jun-2024 06:05                5604
intltimezone.getdstsavings.php                     24-Jun-2024 06:05                3202
intltimezone.getequivalentid.php                   24-Jun-2024 06:05                4110
intltimezone.geterrorcode.php                      24-Jun-2024 06:05                3350
intltimezone.geterrormessage.php                   24-Jun-2024 06:05                3376
intltimezone.getgmt.php                            24-Jun-2024 06:05                2895
intltimezone.getid.php                             24-Jun-2024 06:05                3237
intltimezone.getidforwindowsid.php                 24-Jun-2024 06:05                5943
intltimezone.getoffset.php                         24-Jun-2024 06:05                5156
intltimezone.getrawoffset.php                      24-Jun-2024 06:05                3122
intltimezone.getregion.php                         24-Jun-2024 06:05                3730
intltimezone.gettzdataversion.php                  24-Jun-2024 06:05                3281
intltimezone.getunknown.php                        24-Jun-2024 06:05                3184
intltimezone.getwindowsid.php                      24-Jun-2024 06:05                4508
intltimezone.hassamerules.php                      24-Jun-2024 06:05                3558
intltimezone.todatetimezone.php                    24-Jun-2024 06:05                3477
intltimezone.usedaylighttime.php                   24-Jun-2024 06:05                3149
intro-whatcando.php                                24-Jun-2024 06:05                8309
intro-whatis.php                                   24-Jun-2024 06:05                4198
intro.apache.php                                   24-Jun-2024 06:05                1266
intro.apcu.php                                     24-Jun-2024 06:05                1981
intro.array.php                                    24-Jun-2024 06:06                2002
intro.bc.php                                       24-Jun-2024 06:05                4639
intro.bzip2.php                                    24-Jun-2024 06:05                1286
intro.calendar.php                                 24-Jun-2024 06:05                2320
intro.classobj.php                                 24-Jun-2024 06:06                1798
intro.cmark.php                                    24-Jun-2024 06:06                7421
intro.com.php                                      24-Jun-2024 06:06                3146
intro.componere.php                                24-Jun-2024 06:05                6727
intro.ctype.php                                    24-Jun-2024 06:06                4086
intro.cubrid.php                                   24-Jun-2024 06:05                1534
intro.curl.php                                     24-Jun-2024 06:05                1665
intro.datetime.php                                 24-Jun-2024 06:05                2945
intro.dba.php                                      24-Jun-2024 06:05                1554
intro.dbase.php                                    24-Jun-2024 06:05                7145
intro.dio.php                                      24-Jun-2024 06:05                1819
intro.dom.php                                      24-Jun-2024 06:06                1749
intro.ds.php                                       24-Jun-2024 06:05                1529
intro.eio.php                                      24-Jun-2024 06:05               14485
intro.enchant.php                                  24-Jun-2024 06:05                2667
intro.errorfunc.php                                24-Jun-2024 06:05                2094
intro.ev.php                                       24-Jun-2024 06:05                2335
intro.event.php                                    24-Jun-2024 06:05                2084
intro.exec.php                                     24-Jun-2024 06:05                1862
intro.exif.php                                     24-Jun-2024 06:05                1559
intro.expect.php                                   24-Jun-2024 06:05                1488
intro.fann.php                                     24-Jun-2024 06:05                1467
intro.fdf.php                                      24-Jun-2024 06:05                3883
intro.ffi.php                                      24-Jun-2024 06:05                3074
intro.fileinfo.php                                 24-Jun-2024 06:05                1500
intro.filesystem.php                               24-Jun-2024 06:05                1613
intro.filter.php                                   24-Jun-2024 06:06                2920
intro.fpm.php                                      24-Jun-2024 06:06                1380
intro.ftp.php                                      24-Jun-2024 06:05                1905
intro.funchand.php                                 24-Jun-2024 06:06                1340
intro.gearman.php                                  24-Jun-2024 06:05                1718
intro.gender.php                                   24-Jun-2024 06:05                1386
intro.geoip.php                                    24-Jun-2024 06:05                1624
intro.gettext.php                                  24-Jun-2024 06:05                1615
intro.gmagick.php                                  24-Jun-2024 06:05                1748
intro.gmp.php                                      24-Jun-2024 06:05                3173
intro.gnupg.php                                    24-Jun-2024 06:05                1275
intro.hash.php                                     24-Jun-2024 06:05                1324
intro.hrtime.php                                   24-Jun-2024 06:05                1718
intro.ibase.php                                    24-Jun-2024 06:05                3395
intro.ibm-db2.php                                  24-Jun-2024 06:05                1335
intro.iconv.php                                    24-Jun-2024 06:05                2094
intro.igbinary.php                                 24-Jun-2024 06:05                1730
intro.image.php                                    24-Jun-2024 06:05                7233
intro.imagick.php                                  24-Jun-2024 06:05                1811
intro.imap.php                                     24-Jun-2024 06:05                1742
intro.info.php                                     24-Jun-2024 06:05                1654
intro.inotify.php                                  24-Jun-2024 06:05                2397
intro.intl.php                                     24-Jun-2024 06:05                5415
intro.json.php                                     24-Jun-2024 06:05                1714
intro.ldap.php                                     24-Jun-2024 06:05                4321
intro.libxml.php                                   24-Jun-2024 06:06                1845
intro.lua.php                                      24-Jun-2024 06:05                1334
intro.luasandbox.php                               24-Jun-2024 06:05                2420
intro.lzf.php                                      24-Jun-2024 06:05                1513
intro.mail.php                                     24-Jun-2024 06:05                1293
intro.mailparse.php                                24-Jun-2024 06:05                2035
intro.math.php                                     24-Jun-2024 06:05                2095
intro.mbstring.php                                 24-Jun-2024 06:05                3113
intro.mcrypt.php                                   24-Jun-2024 06:05                2340
intro.memcache.php                                 24-Jun-2024 06:05                1799
intro.memcached.php                                24-Jun-2024 06:05                2010
intro.mhash.php                                    24-Jun-2024 06:05                3022
intro.misc.php                                     24-Jun-2024 06:05                1248
intro.mqseries.php                                 24-Jun-2024 06:05                1799
intro.mysql-xdevapi.php                            24-Jun-2024 06:05                1935
intro.mysql.php                                    24-Jun-2024 06:05                2045
intro.mysqli.php                                   24-Jun-2024 06:05                2318
intro.mysqlnd.php                                  24-Jun-2024 06:05                2011
intro.network.php                                  24-Jun-2024 06:05                1215
intro.oauth.php                                    24-Jun-2024 06:06                1414
intro.oci8.php                                     24-Jun-2024 06:05                1565
intro.opcache.php                                  24-Jun-2024 06:05                1627
intro.openal.php                                   24-Jun-2024 06:05                1308
intro.openssl.php                                  24-Jun-2024 06:05                1635
intro.outcontrol.php                               24-Jun-2024 06:05                1928
intro.parallel.php                                 24-Jun-2024 06:05                7210
intro.parle.php                                    24-Jun-2024 06:06                3494
intro.password.php                                 24-Jun-2024 06:05                1492
intro.pcntl.php                                    24-Jun-2024 06:05                2807
intro.pcre.php                                     24-Jun-2024 06:06                2773
intro.pdo.php                                      24-Jun-2024 06:05                2231
intro.pgsql.php                                    24-Jun-2024 06:05                1750
intro.phar.php                                     24-Jun-2024 06:05               10073
intro.phpdbg.php                                   24-Jun-2024 06:05                6346
intro.posix.php                                    24-Jun-2024 06:05                1782
intro.ps.php                                       24-Jun-2024 06:05                1863
intro.pspell.php                                   24-Jun-2024 06:05                1258
intro.pthreads.php                                 24-Jun-2024 06:05                9514
intro.quickhash.php                                24-Jun-2024 06:06                1322
intro.radius.php                                   24-Jun-2024 06:05                2220
intro.random.php                                   24-Jun-2024 06:05                1167
intro.rar.php                                      24-Jun-2024 06:05                1602
intro.readline.php                                 24-Jun-2024 06:05                2101
intro.recode.php                                   24-Jun-2024 06:05                2417
intro.reflection.php                               24-Jun-2024 06:06                1926
intro.rnp.php                                      24-Jun-2024 06:05                1335
intro.rpminfo.php                                  24-Jun-2024 06:05                1452
intro.rrd.php                                      24-Jun-2024 06:05                1491
intro.runkit7.php                                  24-Jun-2024 06:05                1534
intro.scoutapm.php                                 24-Jun-2024 06:05                1528
intro.seaslog.php                                  24-Jun-2024 06:05                3988
intro.sem.php                                      24-Jun-2024 06:05                3278
intro.session.php                                  24-Jun-2024 06:06                5041
intro.shmop.php                                    24-Jun-2024 06:05                1348
intro.simdjson.php                                 24-Jun-2024 06:05                1284
intro.simplexml.php                                24-Jun-2024 06:06                1402
intro.snmp.php                                     24-Jun-2024 06:05                1764
intro.soap.php                                     24-Jun-2024 06:06                1535
intro.sockets.php                                  24-Jun-2024 06:05                2643
intro.sodium.php                                   24-Jun-2024 06:05                1434
intro.solr.php                                     24-Jun-2024 06:05                1847
intro.spl.php                                      24-Jun-2024 06:05                1669
intro.sqlite3.php                                  24-Jun-2024 06:05                1225
intro.sqlsrv.php                                   24-Jun-2024 06:05                2256
intro.ssdeep.php                                   24-Jun-2024 06:06                1835
intro.ssh2.php                                     24-Jun-2024 06:05                1396
intro.stats.php                                    24-Jun-2024 06:05                1566
intro.stomp.php                                    24-Jun-2024 06:05                1399
intro.stream.php                                   24-Jun-2024 06:05                4189
intro.strings.php                                  24-Jun-2024 06:06                1735
intro.svm.php                                      24-Jun-2024 06:05                1297
intro.svn.php                                      24-Jun-2024 06:05                1829
intro.swoole.php                                   24-Jun-2024 06:05                1749
intro.sync.php                                     24-Jun-2024 06:05                2617
intro.taint.php                                    24-Jun-2024 06:05                4356
intro.tcpwrap.php                                  24-Jun-2024 06:05                1339
intro.tidy.php                                     24-Jun-2024 06:05                1464
intro.tokenizer.php                                24-Jun-2024 06:05                1595
intro.trader.php                                   24-Jun-2024 06:05                2443
intro.ui.php                                       24-Jun-2024 06:06                1256
intro.uodbc.php                                    24-Jun-2024 06:05                2811
intro.uopz.php                                     24-Jun-2024 06:05                2337
intro.url.php                                      24-Jun-2024 06:05                1206
intro.v8js.php                                     24-Jun-2024 06:05                1283
intro.var.php                                      24-Jun-2024 06:06                1452
intro.var_representation.php                       24-Jun-2024 06:05                1484
intro.varnish.php                                  24-Jun-2024 06:05                1373
intro.wddx.php                                     24-Jun-2024 06:06                2285
intro.win32service.php                             24-Jun-2024 06:06                1456
intro.wincache.php                                 24-Jun-2024 06:05                4945
intro.wkhtmltox.php                                24-Jun-2024 06:05                1332
intro.xattr.php                                    24-Jun-2024 06:05                1253
intro.xdiff.php                                    24-Jun-2024 06:05                2667
intro.xhprof.php                                   24-Jun-2024 06:05                2849
intro.xlswriter.php                                24-Jun-2024 06:05                1245
intro.xml.php                                      24-Jun-2024 06:06                2421
intro.xmldiff.php                                  24-Jun-2024 06:06                1466
intro.xmlreader.php                                24-Jun-2024 06:06                1647
intro.xmlrpc.php                                   24-Jun-2024 06:06                1943
intro.xmlwriter.php                                24-Jun-2024 06:06                1604
intro.xsl.php                                      24-Jun-2024 06:06                1394
intro.yac.php                                      24-Jun-2024 06:05                1257
intro.yaconf.php                                   24-Jun-2024 06:05                2628
intro.yaf.php                                      24-Jun-2024 06:05                1605
intro.yaml.php                                     24-Jun-2024 06:05                1461
intro.yar.php                                      24-Jun-2024 06:06                1326
intro.yaz.php                                      24-Jun-2024 06:05                2591
intro.zip.php                                      24-Jun-2024 06:05                1247
intro.zlib.php                                     24-Jun-2024 06:05                1811
intro.zmq.php                                      24-Jun-2024 06:05                1492
intro.zookeeper.php                                24-Jun-2024 06:05                1503
introduction.php                                   24-Jun-2024 06:05                1517
iterator.current.php                               24-Jun-2024 06:05                2178
iterator.key.php                                   24-Jun-2024 06:05                2569
iterator.next.php                                  24-Jun-2024 06:05                2430
iterator.rewind.php                                24-Jun-2024 06:05                2617
iterator.valid.php                                 24-Jun-2024 06:05                2807
iteratoraggregate.getiterator.php                  24-Jun-2024 06:05                2875
iteratoriterator.construct.php                     24-Jun-2024 06:05                3501
iteratoriterator.current.php                       24-Jun-2024 06:05                2741
iteratoriterator.getinneriterator.php              24-Jun-2024 06:05                3203
iteratoriterator.key.php                           24-Jun-2024 06:05                2693
iteratoriterator.next.php                          24-Jun-2024 06:05                2888
iteratoriterator.rewind.php                        24-Jun-2024 06:05                2919
iteratoriterator.valid.php                         24-Jun-2024 06:05                3076
json.configuration.php                             24-Jun-2024 06:05                1358
json.constants.php                                 24-Jun-2024 06:05               17352
json.installation.php                              24-Jun-2024 06:05                1947
json.resources.php                                 24-Jun-2024 06:05                1296
json.setup.php                                     24-Jun-2024 06:05                1620
jsonserializable.jsonserialize.php                 24-Jun-2024 06:05               12895
langref.php                                        24-Jun-2024 06:05               22097
language.attributes.classes.php                    24-Jun-2024 06:05                6642
language.attributes.overview.php                   24-Jun-2024 06:05               10355
language.attributes.php                            24-Jun-2024 06:05                1780
language.attributes.reflection.php                 24-Jun-2024 06:05                8254
language.attributes.syntax.php                     24-Jun-2024 06:05                6208
language.basic-syntax.comments.php                 24-Jun-2024 06:05                3939
language.basic-syntax.instruction-separation.php   24-Jun-2024 06:05                4342
language.basic-syntax.php                          24-Jun-2024 06:05                1748
language.basic-syntax.phpmode.php                  24-Jun-2024 06:05                4619
language.basic-syntax.phptags.php                  24-Jun-2024 06:05                4930
language.constants.magic.php                       24-Jun-2024 06:05                5616
language.constants.php                             24-Jun-2024 06:05                6323
language.constants.predefined.php                  24-Jun-2024 06:05                1600
language.constants.syntax.php                      24-Jun-2024 06:05               10522
language.control-structures.php                    24-Jun-2024 06:05                2806
language.enumerations.backed.php                   24-Jun-2024 06:05               10388
language.enumerations.basics.php                   24-Jun-2024 06:05                8384
language.enumerations.constants.php                24-Jun-2024 06:05                2496
language.enumerations.examples.php                 24-Jun-2024 06:05                7463
language.enumerations.expressions.php              24-Jun-2024 06:05                6801
language.enumerations.listing.php                  24-Jun-2024 06:05                2292
language.enumerations.methods.php                  24-Jun-2024 06:05               13734
language.enumerations.object-differences.inheri..> 24-Jun-2024 06:05                6151
language.enumerations.object-differences.php       24-Jun-2024 06:05                4944
language.enumerations.overview.php                 24-Jun-2024 06:05                2522
language.enumerations.php                          24-Jun-2024 06:05                2705
language.enumerations.serialization.php            24-Jun-2024 06:05                5020
language.enumerations.static-methods.php           24-Jun-2024 06:05                3393
language.enumerations.traits.php                   24-Jun-2024 06:05                4412
language.errors.basics.php                         24-Jun-2024 06:05                5027
language.errors.php                                24-Jun-2024 06:05                1954
language.errors.php7.php                           24-Jun-2024 06:05                5913
language.exceptions.extending.php                  24-Jun-2024 06:05               19627
language.exceptions.php                            24-Jun-2024 06:05               27707
language.expressions.php                           24-Jun-2024 06:05               15908
language.fibers.php                                24-Jun-2024 06:05                6343
language.functions.php                             24-Jun-2024 06:05                2118
language.generators.comparison.php                 24-Jun-2024 06:05                8942
language.generators.overview.php                   24-Jun-2024 06:05                9191
language.generators.php                            24-Jun-2024 06:05                1641
language.generators.syntax.php                     24-Jun-2024 06:05               23932
language.namespaces.basics.php                     24-Jun-2024 06:05               11114
language.namespaces.definition.php                 24-Jun-2024 06:05                4365
language.namespaces.definitionmultiple.php         24-Jun-2024 06:05                9038
language.namespaces.dynamic.php                    24-Jun-2024 06:05                8341
language.namespaces.fallback.php                   24-Jun-2024 06:05                6051
language.namespaces.faq.php                        24-Jun-2024 06:05               32072
language.namespaces.global.php                     24-Jun-2024 06:05                2767
language.namespaces.importing.php                  24-Jun-2024 06:05               15413
language.namespaces.nested.php                     24-Jun-2024 06:05                2801
language.namespaces.nsconstants.php                24-Jun-2024 06:05                8808
language.namespaces.php                            24-Jun-2024 06:05                2441
language.namespaces.rationale.php                  24-Jun-2024 06:05                6494
language.namespaces.rules.php                      24-Jun-2024 06:05               12544
language.oop5.abstract.php                         24-Jun-2024 06:05               10896
language.oop5.anonymous.php                        24-Jun-2024 06:05               10424
language.oop5.autoload.php                         24-Jun-2024 06:05                6656
language.oop5.basic.php                            24-Jun-2024 06:05               49108
language.oop5.changelog.php                        24-Jun-2024 06:05               13935
language.oop5.cloning.php                          24-Jun-2024 06:05                8771
language.oop5.constants.php                        24-Jun-2024 06:05                8826
language.oop5.decon.php                            24-Jun-2024 06:05               28363
language.oop5.final.php                            24-Jun-2024 06:05                6038
language.oop5.inheritance.php                      24-Jun-2024 06:05               13246
language.oop5.interfaces.php                       24-Jun-2024 06:05               23167
language.oop5.iterations.php                       24-Jun-2024 06:05                5889
language.oop5.late-static-bindings.php             24-Jun-2024 06:05               14363
language.oop5.magic.php                            24-Jun-2024 06:05               43543
language.oop5.object-comparison.php                24-Jun-2024 06:05                8853
language.oop5.overloading.php                      24-Jun-2024 06:05               24039
language.oop5.paamayim-nekudotayim.php             24-Jun-2024 06:05                8618
language.oop5.php                                  24-Jun-2024 06:05                3463
language.oop5.properties.php                       24-Jun-2024 06:05               27492
language.oop5.references.php                       24-Jun-2024 06:05                5798
language.oop5.serialization.php                    24-Jun-2024 06:05                7123
language.oop5.static.php                           24-Jun-2024 06:05                9378
language.oop5.traits.php                           24-Jun-2024 06:05               35499
language.oop5.variance.php                         24-Jun-2024 06:05               15851
language.oop5.visibility.php                       24-Jun-2024 06:05               24600
language.operators.arithmetic.php                  24-Jun-2024 06:05                5831
language.operators.array.php                       24-Jun-2024 06:05                8869
language.operators.assignment.php                  24-Jun-2024 06:05               11154
language.operators.bitwise.php                     24-Jun-2024 06:05               43826
language.operators.comparison.php                  24-Jun-2024 06:05               41954
language.operators.errorcontrol.php                24-Jun-2024 06:05                5938
language.operators.execution.php                   24-Jun-2024 06:05                3347
language.operators.increment.php                   24-Jun-2024 06:05               13993
language.operators.logical.php                     24-Jun-2024 06:05                7591
language.operators.php                             24-Jun-2024 06:05                3873
language.operators.precedence.php                  24-Jun-2024 06:05               19463
language.operators.string.php                      24-Jun-2024 06:05                3157
language.operators.type.php                        24-Jun-2024 06:05               18100
language.references.arent.php                      24-Jun-2024 06:05                3305
language.references.pass.php                       24-Jun-2024 06:05                6734
language.references.php                            24-Jun-2024 06:05                2056
language.references.return.php                     24-Jun-2024 06:05                7142
language.references.spot.php                       24-Jun-2024 06:05                2602
language.references.unset.php                      24-Jun-2024 06:05                2336
language.references.whatare.php                    24-Jun-2024 06:05                2149
language.references.whatdo.php                     24-Jun-2024 06:05               18529
language.types.array.php                           24-Jun-2024 06:05              101174
language.types.boolean.php                         24-Jun-2024 06:05                9694
language.types.callable.php                        24-Jun-2024 06:05               12318
language.types.declarations.php                    24-Jun-2024 06:05               43218
language.types.enumerations.php                    24-Jun-2024 06:05                3744
language.types.float.php                           24-Jun-2024 06:05                9709
language.types.integer.php                         24-Jun-2024 06:05               21115
language.types.intro.php                           24-Jun-2024 06:05                8465
language.types.iterable.php                        24-Jun-2024 06:05                3064
language.types.mixed.php                           24-Jun-2024 06:05                1763
language.types.never.php                           24-Jun-2024 06:05                2001
language.types.null.php                            24-Jun-2024 06:05                3569
language.types.numeric-strings.php                 24-Jun-2024 06:05               11182
language.types.object.php                          24-Jun-2024 06:05                5710
language.types.php                                 24-Jun-2024 06:05                2884
language.types.relative-class-types.php            24-Jun-2024 06:05                2410
language.types.resource.php                        24-Jun-2024 06:05                3221
language.types.string.php                          24-Jun-2024 06:05               82043
language.types.type-juggling.php                   24-Jun-2024 06:05               27000
language.types.type-system.php                     24-Jun-2024 06:05                8610
language.types.value.php                           24-Jun-2024 06:05                2230
language.types.void.php                            24-Jun-2024 06:05                2002
language.variables.basics.php                      24-Jun-2024 06:05               13789
language.variables.external.php                    24-Jun-2024 06:05               17502
language.variables.php                             24-Jun-2024 06:05                1841
language.variables.predefined.php                  24-Jun-2024 06:05                3047
language.variables.scope.php                       24-Jun-2024 06:05               28237
language.variables.superglobals.php                24-Jun-2024 06:05                4361
language.variables.variable.php                    24-Jun-2024 06:05               10253
ldap.configuration.php                             24-Jun-2024 06:05                2537
ldap.constants.php                                 24-Jun-2024 06:05               33942
ldap.controls.php                                  24-Jun-2024 06:05               10306
ldap.examples-basic.php                            24-Jun-2024 06:05                8302
ldap.examples-controls.php                         24-Jun-2024 06:05               16209
ldap.examples.php                                  24-Jun-2024 06:05                1454
ldap.installation.php                              24-Jun-2024 06:05                2992
ldap.requirements.php                              24-Jun-2024 06:05                1630
ldap.resources.php                                 24-Jun-2024 06:05                1559
ldap.setup.php                                     24-Jun-2024 06:05                1707
ldap.using.php                                     24-Jun-2024 06:05                2274
libxml.configuration.php                           24-Jun-2024 06:06                1412
libxml.constants.php                               24-Jun-2024 06:06               13521
libxml.installation.php                            24-Jun-2024 06:06                2103
libxml.installation_old.php                        24-Jun-2024 06:06                2769
libxml.requirements.php                            24-Jun-2024 06:06                1464
libxml.resources.php                               24-Jun-2024 06:06                1310
libxml.setup.php                                   24-Jun-2024 06:06                1877
limititerator.construct.php                        24-Jun-2024 06:05                7382
limititerator.current.php                          24-Jun-2024 06:05                3654
limititerator.getposition.php                      24-Jun-2024 06:05                5783
limititerator.key.php                              24-Jun-2024 06:05                3709
limititerator.next.php                             24-Jun-2024 06:05                3381
limititerator.rewind.php                           24-Jun-2024 06:05                3560
limititerator.seek.php                             24-Jun-2024 06:05                4225
limititerator.valid.php                            24-Jun-2024 06:05                3604
locale.acceptfromhttp.php                          24-Jun-2024 06:05                6342
locale.canonicalize.php                            24-Jun-2024 06:05                3209
locale.composelocale.php                           24-Jun-2024 06:05               13754
locale.filtermatches.php                           24-Jun-2024 06:05                9511
locale.getallvariants.php                          24-Jun-2024 06:05                6791
locale.getdefault.php                              24-Jun-2024 06:05                5978
locale.getdisplaylanguage.php                      24-Jun-2024 06:05                9940
locale.getdisplayname.php                          24-Jun-2024 06:05                9906
locale.getdisplayregion.php                        24-Jun-2024 06:05                9879
locale.getdisplayscript.php                        24-Jun-2024 06:05                9915
locale.getdisplayvariant.php                       24-Jun-2024 06:05                9939
locale.getkeywords.php                             24-Jun-2024 06:05                7363
locale.getprimarylanguage.php                      24-Jun-2024 06:05                6152
locale.getregion.php                               24-Jun-2024 06:05                6115
locale.getscript.php                               24-Jun-2024 06:05                5827
locale.lookup.php                                  24-Jun-2024 06:05               10393
locale.parselocale.php                             24-Jun-2024 06:05                7584
locale.setdefault.php                              24-Jun-2024 06:05                5511
lua.assign.php                                     24-Jun-2024 06:05                4697
lua.call.php                                       24-Jun-2024 06:05                7583
lua.configuration.php                              24-Jun-2024 06:05                1351
lua.construct.php                                  24-Jun-2024 06:05                2428
lua.eval.php                                       24-Jun-2024 06:05                3835
lua.getversion.php                                 24-Jun-2024 06:05                2322
lua.include.php                                    24-Jun-2024 06:05                2775
lua.installation.php                               24-Jun-2024 06:05                2137
lua.registercallback.php                           24-Jun-2024 06:05                4664
lua.requirements.php                               24-Jun-2024 06:05                1423
lua.resources.php                                  24-Jun-2024 06:05                1283
lua.setup.php                                      24-Jun-2024 06:05                1667
luaclosure.invoke.php                              24-Jun-2024 06:05                4159
luasandbox.callfunction.php                        24-Jun-2024 06:05                5093
luasandbox.configuration.php                       24-Jun-2024 06:05                1397
luasandbox.disableprofiler.php                     24-Jun-2024 06:05                2900
luasandbox.enableprofiler.php                      24-Jun-2024 06:05                3534
luasandbox.examples-basic.php                      24-Jun-2024 06:05                6665
luasandbox.examples.php                            24-Jun-2024 06:05                1497
luasandbox.getcpuusage.php                         24-Jun-2024 06:05                3648
luasandbox.getmemoryusage.php                      24-Jun-2024 06:05                3228
luasandbox.getpeakmemoryusage.php                  24-Jun-2024 06:05                3278
luasandbox.getprofilerfunctionreport.php           24-Jun-2024 06:05                6041
luasandbox.getversioninfo.php                      24-Jun-2024 06:05                3139
luasandbox.installation.php                        24-Jun-2024 06:05                2234
luasandbox.loadbinary.php                          24-Jun-2024 06:05                3663
luasandbox.loadstring.php                          24-Jun-2024 06:05                5659
luasandbox.pauseusagetimer.php                     24-Jun-2024 06:05                9456
luasandbox.registerlibrary.php                     24-Jun-2024 06:05                6676
luasandbox.requirements.php                        24-Jun-2024 06:05                1865
luasandbox.resources.php                           24-Jun-2024 06:05                1345
luasandbox.setcpulimit.php                         24-Jun-2024 06:05                6178
luasandbox.setmemorylimit.php                      24-Jun-2024 06:05                5583
luasandbox.setup.php                               24-Jun-2024 06:05                1755
luasandbox.unpauseusagetimer.php                   24-Jun-2024 06:05                3196
luasandbox.wrapphpfunction.php                     24-Jun-2024 06:05                4401
luasandboxfunction.call.php                        24-Jun-2024 06:05                8058
luasandboxfunction.construct.php                   24-Jun-2024 06:05                2718
luasandboxfunction.dump.php                        24-Jun-2024 06:05                2480
lzf.configuration.php                              24-Jun-2024 06:05                1351
lzf.constants.php                                  24-Jun-2024 06:05                1210
lzf.installation.php                               24-Jun-2024 06:05                2609
lzf.requirements.php                               24-Jun-2024 06:05                1296
lzf.resources.php                                  24-Jun-2024 06:05                1289
lzf.setup.php                                      24-Jun-2024 06:05                1688
mail.configuration.php                             24-Jun-2024 06:05                8178
mail.constants.php                                 24-Jun-2024 06:05                1219
mail.requirements.php                              24-Jun-2024 06:05                2117
mail.resources.php                                 24-Jun-2024 06:05                1296
mail.setup.php                                     24-Jun-2024 06:05                1625
mailparse.configuration.php                        24-Jun-2024 06:05                2674
mailparse.constants.php                            24-Jun-2024 06:05                2456
mailparse.installation.php                         24-Jun-2024 06:05                2623
mailparse.requirements.php                         24-Jun-2024 06:05                1338
mailparse.resources.php                            24-Jun-2024 06:05                1646
mailparse.setup.php                                24-Jun-2024 06:05                1766
manual.php                                         24-Jun-2024 06:05                1310
math.configuration.php                             24-Jun-2024 06:05                1352
math.constants.php                                 24-Jun-2024 06:05                7415
math.requirements.php                              24-Jun-2024 06:05                1333
math.resources.php                                 24-Jun-2024 06:05                1296
math.setup.php                                     24-Jun-2024 06:05                1620
mbstring.configuration.php                         24-Jun-2024 06:05               16732
mbstring.constants.php                             24-Jun-2024 06:05                7153
mbstring.encodings.php                             24-Jun-2024 06:05               16131
mbstring.http.php                                  24-Jun-2024 06:05                5490
mbstring.installation.php                          24-Jun-2024 06:05                3559
mbstring.ja-basic.php                              24-Jun-2024 06:05                4034
mbstring.overload.php                              24-Jun-2024 06:05                7503
mbstring.php4.req.php                              24-Jun-2024 06:05                4321
mbstring.requirements.php                          24-Jun-2024 06:05                1331
mbstring.resources.php                             24-Jun-2024 06:05                1324
mbstring.setup.php                                 24-Jun-2024 06:05                1766
mbstring.supported-encodings.php                   24-Jun-2024 06:05                8415
mcrypt.ciphers.php                                 24-Jun-2024 06:05                6462
mcrypt.configuration.php                           24-Jun-2024 06:05                3825
mcrypt.constants.php                               24-Jun-2024 06:05                6591
mcrypt.installation.php                            24-Jun-2024 06:05                1910
mcrypt.requirements.php                            24-Jun-2024 06:05                2301
mcrypt.resources.php                               24-Jun-2024 06:05                1413
mcrypt.setup.php                                   24-Jun-2024 06:05                1733
memcache.add.php                                   24-Jun-2024 06:05                7277
memcache.addserver.php                             24-Jun-2024 06:05               13817
memcache.close.php                                 24-Jun-2024 06:05                5216
memcache.connect.php                               24-Jun-2024 06:05                7477
memcache.constants.php                             24-Jun-2024 06:05                5350
memcache.decrement.php                             24-Jun-2024 06:05                7295
memcache.delete.php                                24-Jun-2024 06:05                6589
memcache.examples-overview.php                     24-Jun-2024 06:05                6525
memcache.examples.php                              24-Jun-2024 06:05                1452
memcache.flush.php                                 24-Jun-2024 06:05                4632
memcache.get.php                                   24-Jun-2024 06:05                8886
memcache.getextendedstats.php                      24-Jun-2024 06:05                8241
memcache.getserverstatus.php                       24-Jun-2024 06:05                6223
memcache.getstats.php                              24-Jun-2024 06:05                4857
memcache.getversion.php                            24-Jun-2024 06:05                5085
memcache.increment.php                             24-Jun-2024 06:05                7093
memcache.ini.php                                   24-Jun-2024 06:05               10954
memcache.installation.php                          24-Jun-2024 06:05                2270
memcache.pconnect.php                              24-Jun-2024 06:05                6323
memcache.replace.php                               24-Jun-2024 06:05                7380
memcache.requirements.php                          24-Jun-2024 06:05                1480
memcache.resources.php                             24-Jun-2024 06:05                1396
memcache.set.php                                   24-Jun-2024 06:05                9750
memcache.setcompressthreshold.php                  24-Jun-2024 06:05                6067
memcache.setserverparams.php                       24-Jun-2024 06:05               11251
memcache.setup.php                                 24-Jun-2024 06:05                1748
memcached.add.php                                  24-Jun-2024 06:05                4718
memcached.addbykey.php                             24-Jun-2024 06:05                5708
memcached.addserver.php                            24-Jun-2024 06:05                7952
memcached.addservers.php                           24-Jun-2024 06:05                5556
memcached.append.php                               24-Jun-2024 06:05                7548
memcached.appendbykey.php                          24-Jun-2024 06:05                5257
memcached.callbacks.php                            24-Jun-2024 06:05                1575
memcached.callbacks.read-through.php               24-Jun-2024 06:05                4443
memcached.callbacks.result.php                     24-Jun-2024 06:05                4954
memcached.cas.php                                  24-Jun-2024 06:05                9602
memcached.casbykey.php                             24-Jun-2024 06:05                6043
memcached.configuration.php                        24-Jun-2024 06:05               29159
memcached.constants.php                            24-Jun-2024 06:05               30274
memcached.construct.php                            24-Jun-2024 06:05                5795
memcached.decrement.php                            24-Jun-2024 06:05                9241
memcached.decrementbykey.php                       24-Jun-2024 06:05                6078
memcached.delete.php                               24-Jun-2024 06:05                5743
memcached.deletebykey.php                          24-Jun-2024 06:05                5707
memcached.deletemulti.php                          24-Jun-2024 06:05                4939
memcached.deletemultibykey.php                     24-Jun-2024 06:05                5926
memcached.expiration.php                           24-Jun-2024 06:05                2044
memcached.fetch.php                                24-Jun-2024 06:05                6836
memcached.fetchall.php                             24-Jun-2024 06:05                6612
memcached.flush.php                                24-Jun-2024 06:05                4815
memcached.get.php                                  24-Jun-2024 06:05               10597
memcached.getallkeys.php                           24-Jun-2024 06:05                3143
memcached.getbykey.php                             24-Jun-2024 06:05                6739
memcached.getdelayed.php                           24-Jun-2024 06:05                8968
memcached.getdelayedbykey.php                      24-Jun-2024 06:05                5919
memcached.getmulti.php                             24-Jun-2024 06:05               20956
memcached.getmultibykey.php                        24-Jun-2024 06:05                5757
memcached.getoption.php                            24-Jun-2024 06:05                5257
memcached.getresultcode.php                        24-Jun-2024 06:05                4323
memcached.getresultmessage.php                     24-Jun-2024 06:05                4755
memcached.getserverbykey.php                       24-Jun-2024 06:05                7467
memcached.getserverlist.php                        24-Jun-2024 06:05                4674
memcached.getstats.php                             24-Jun-2024 06:05                5853
memcached.getversion.php                           24-Jun-2024 06:05                4090
memcached.increment.php                            24-Jun-2024 06:05                8573
memcached.incrementbykey.php                       24-Jun-2024 06:05                6013
memcached.installation.php                         24-Jun-2024 06:05                2811
memcached.ispersistent.php                         24-Jun-2024 06:05                3085
memcached.ispristine.php                           24-Jun-2024 06:05                3024
memcached.prepend.php                              24-Jun-2024 06:05                7548
memcached.prependbykey.php                         24-Jun-2024 06:05                5274
memcached.quit.php                                 24-Jun-2024 06:05                2504
memcached.replace.php                              24-Jun-2024 06:05                4785
memcached.replacebykey.php                         24-Jun-2024 06:05                5787
memcached.requirements.php                         24-Jun-2024 06:05                1647
memcached.resetserverlist.php                      24-Jun-2024 06:05                3256
memcached.resources.php                            24-Jun-2024 06:05                1331
memcached.sessions.php                             24-Jun-2024 06:05                2604
memcached.set.php                                  24-Jun-2024 06:05                9285
memcached.setbykey.php                             24-Jun-2024 06:05                7142
memcached.setmulti.php                             24-Jun-2024 06:05                6356
memcached.setmultibykey.php                        24-Jun-2024 06:05                5064
memcached.setoption.php                            24-Jun-2024 06:05                7462
memcached.setoptions.php                           24-Jun-2024 06:05                7065
memcached.setsaslauthdata.php                      24-Jun-2024 06:05                3608
memcached.setup.php                                24-Jun-2024 06:05                1766
memcached.touch.php                                24-Jun-2024 06:05                3859
memcached.touchbykey.php                           24-Jun-2024 06:05                4776
messageformatter.create.php                        24-Jun-2024 06:05               11228
messageformatter.format.php                        24-Jun-2024 06:05                9858
messageformatter.formatmessage.php                 24-Jun-2024 06:05               14651
messageformatter.geterrorcode.php                  24-Jun-2024 06:05                4111
messageformatter.geterrormessage.php               24-Jun-2024 06:05                7750
messageformatter.getlocale.php                     24-Jun-2024 06:05                5559
messageformatter.getpattern.php                    24-Jun-2024 06:05               10165
messageformatter.parse.php                         24-Jun-2024 06:05                9939
messageformatter.parsemessage.php                  24-Jun-2024 06:05               10192
messageformatter.setpattern.php                    24-Jun-2024 06:05               10712
mhash.configuration.php                            24-Jun-2024 06:05                1365
mhash.constants.php                                24-Jun-2024 06:05                7229
mhash.examples.php                                 24-Jun-2024 06:05                3352
mhash.installation.php                             24-Jun-2024 06:05                1709
mhash.requirements.php                             24-Jun-2024 06:05                1447
mhash.resources.php                                24-Jun-2024 06:05                1303
mhash.setup.php                                    24-Jun-2024 06:05                1714
migration56.changed-functions.php                  24-Jun-2024 06:06                7060
migration56.constants.php                          24-Jun-2024 06:06                6832
migration56.deprecated.php                         24-Jun-2024 06:06                6389
migration56.extensions.php                         24-Jun-2024 06:06                4516
migration56.incompatible.php                       24-Jun-2024 06:06                9026
migration56.new-features.php                       24-Jun-2024 06:06               29392
migration56.new-functions.php                      24-Jun-2024 06:06                7604
migration56.openssl.php                            24-Jun-2024 06:06               27551
migration56.php                                    24-Jun-2024 06:06                2638
migration70.changed-functions.php                  24-Jun-2024 06:06                5514
migration70.classes.php                            24-Jun-2024 06:06                3972
migration70.constants.php                          24-Jun-2024 06:06                9578
migration70.deprecated.php                         24-Jun-2024 06:06                5833
migration70.incompatible.php                       24-Jun-2024 06:06               63644
migration70.new-features.php                       24-Jun-2024 06:06               42042
migration70.new-functions.php                      24-Jun-2024 06:06                7446
migration70.other-changes.php                      24-Jun-2024 06:06                3577
migration70.php                                    24-Jun-2024 06:06                3032
migration70.removed-exts-sapis.php                 24-Jun-2024 06:06                3242
migration70.sapi-changes.php                       24-Jun-2024 06:06                2118
migration71.changed-functions.php                  24-Jun-2024 06:06                7852
migration71.constants.php                          24-Jun-2024 06:06                8895
migration71.deprecated.php                         24-Jun-2024 06:06                2429
migration71.incompatible.php                       24-Jun-2024 06:06               33508
migration71.new-features.php                       24-Jun-2024 06:06               27794
migration71.new-functions.php                      24-Jun-2024 06:06                5145
migration71.other-changes.php                      24-Jun-2024 06:06                8992
migration71.php                                    24-Jun-2024 06:06                2641
migration71.windows-support.php                    24-Jun-2024 06:06                7897
migration72.constants.php                          24-Jun-2024 06:06               32085
migration72.deprecated.php                         24-Jun-2024 06:06               10721
migration72.incompatible.php                       24-Jun-2024 06:06               20339
migration72.new-features.php                       24-Jun-2024 06:06               19471
migration72.new-functions.php                      24-Jun-2024 06:06               24476
migration72.other-changes.php                      24-Jun-2024 06:06                6159
migration72.php                                    24-Jun-2024 06:06                2499
migration73.constants.php                          24-Jun-2024 06:06               26247
migration73.deprecated.php                         24-Jun-2024 06:06                9014
migration73.incompatible.php                       24-Jun-2024 06:06               18867
migration73.new-features.php                       24-Jun-2024 06:06               17314
migration73.new-functions.php                      24-Jun-2024 06:06                7502
migration73.other-changes.php                      24-Jun-2024 06:06               16924
migration73.php                                    24-Jun-2024 06:06                2610
migration73.windows-support.php                    24-Jun-2024 06:06                1974
migration74.constants.php                          24-Jun-2024 06:06                7892
migration74.deprecated.php                         24-Jun-2024 06:06               15860
migration74.incompatible.php                       24-Jun-2024 06:06               19130
migration74.new-classes.php                        24-Jun-2024 06:06                1564
migration74.new-features.php                       24-Jun-2024 06:06               22474
migration74.new-functions.php                      24-Jun-2024 06:06                3742
migration74.other-changes.php                      24-Jun-2024 06:06               21722
migration74.php                                    24-Jun-2024 06:06                2820
migration74.removed-extensions.php                 24-Jun-2024 06:06                2002
migration74.windows-support.php                    24-Jun-2024 06:06                3946
migration80.deprecated.php                         24-Jun-2024 06:06               19178
migration80.incompatible.php                       24-Jun-2024 06:06              101748
migration80.new-features.php                       24-Jun-2024 06:06               33339
migration80.other-changes.php                      24-Jun-2024 06:06               15435
migration80.php                                    24-Jun-2024 06:06                2457
migration81.constants.php                          24-Jun-2024 06:06                8425
migration81.deprecated.php                         24-Jun-2024 06:06               19899
migration81.incompatible.php                       24-Jun-2024 06:06               24026
migration81.new-classes.php                        24-Jun-2024 06:06                2207
migration81.new-features.php                       24-Jun-2024 06:06               24557
migration81.new-functions.php                      24-Jun-2024 06:06                8559
migration81.other-changes.php                      24-Jun-2024 06:06               10111
migration81.php                                    24-Jun-2024 06:06                2702
migration82.constants.php                          24-Jun-2024 06:06               22283
migration82.deprecated.php                         24-Jun-2024 06:06                6167
migration82.incompatible.php                       24-Jun-2024 06:06               10161
migration82.new-features.php                       24-Jun-2024 06:06                7457
migration82.new-functions.php                      24-Jun-2024 06:06                4364
migration82.other-changes.php                      24-Jun-2024 06:06               26428
migration82.php                                    24-Jun-2024 06:06                2744
migration82.windows-support.php                    24-Jun-2024 06:06                2427
migration83.constants.php                          24-Jun-2024 06:06               15632
migration83.deprecated.php                         24-Jun-2024 06:06                8033
migration83.incompatible.php                       24-Jun-2024 06:06               15724
migration83.new-classes.php                        24-Jun-2024 06:06                3459
migration83.new-features.php                       24-Jun-2024 06:06                7794
migration83.new-functions.php                      24-Jun-2024 06:06                7320
migration83.other-changes.php                      24-Jun-2024 06:06               33919
migration83.php                                    24-Jun-2024 06:06                2913
migration83.windows-support.php                    24-Jun-2024 06:06                1458
misc.configuration.php                             24-Jun-2024 06:05                6188
misc.constants.php                                 24-Jun-2024 06:05                2681
misc.requirements.php                              24-Jun-2024 06:05                1333
misc.resources.php                                 24-Jun-2024 06:05                1296
misc.setup.php                                     24-Jun-2024 06:05                1614
mongodb-bson-binary.construct.php                  24-Jun-2024 06:05                8012
mongodb-bson-binary.getdata.php                    24-Jun-2024 06:05                4476
mongodb-bson-binary.gettype.php                    24-Jun-2024 06:05                4458
mongodb-bson-binary.jsonserialize.php              24-Jun-2024 06:05                5490
mongodb-bson-binary.serialize.php                  24-Jun-2024 06:05                3570
mongodb-bson-binary.tostring.php                   24-Jun-2024 06:05                4239
mongodb-bson-binary.unserialize.php                24-Jun-2024 06:05                4400
mongodb-bson-binaryinterface.getdata.php           24-Jun-2024 06:05                2881
mongodb-bson-binaryinterface.gettype.php           24-Jun-2024 06:05                2891
mongodb-bson-binaryinterface.tostring.php          24-Jun-2024 06:05                3349
mongodb-bson-dbpointer.construct.php               24-Jun-2024 06:05                2706
mongodb-bson-dbpointer.jsonserialize.php           24-Jun-2024 06:05                5559
mongodb-bson-dbpointer.serialize.php               24-Jun-2024 06:05                3645
mongodb-bson-dbpointer.tostring.php                24-Jun-2024 06:05                2723
mongodb-bson-dbpointer.unserialize.php             24-Jun-2024 06:05                3899
mongodb-bson-decimal128.construct.php              24-Jun-2024 06:05                5830
mongodb-bson-decimal128.jsonserialize.php          24-Jun-2024 06:05                5580
mongodb-bson-decimal128.serialize.php              24-Jun-2024 06:05                3670
mongodb-bson-decimal128.tostring.php               24-Jun-2024 06:05                4586
mongodb-bson-decimal128.unserialize.php            24-Jun-2024 06:05                4492
mongodb-bson-decimal128interface.tostring.php      24-Jun-2024 06:05                3044
mongodb-bson-document.construct.php                24-Jun-2024 06:05                3320
mongodb-bson-document.frombson.php                 24-Jun-2024 06:05                4114
mongodb-bson-document.fromjson.php                 24-Jun-2024 06:05                4627
mongodb-bson-document.fromphp.php                  24-Jun-2024 06:05                4349
mongodb-bson-document.get.php                      24-Jun-2024 06:05                4319
mongodb-bson-document.getiterator.php              24-Jun-2024 06:05                3587
mongodb-bson-document.has.php                      24-Jun-2024 06:05                3851
mongodb-bson-document.offsetexists.php             24-Jun-2024 06:05                3561
mongodb-bson-document.offsetget.php                24-Jun-2024 06:05                4412
mongodb-bson-document.offsetset.php                24-Jun-2024 06:05                3623
mongodb-bson-document.offsetunset.php              24-Jun-2024 06:05                3232
mongodb-bson-document.serialize.php                24-Jun-2024 06:05                3650
mongodb-bson-document.tocanonicalextendedjson.php  24-Jun-2024 06:05               12760
mongodb-bson-document.tophp.php                    24-Jun-2024 06:05                5596
mongodb-bson-document.torelaxedextendedjson.php    24-Jun-2024 06:05               12477
mongodb-bson-document.tostring.php                 24-Jun-2024 06:05                2797
mongodb-bson-document.unserialize.php              24-Jun-2024 06:05                4448
mongodb-bson-int64.construct.php                   24-Jun-2024 06:05                4839
mongodb-bson-int64.jsonserialize.php               24-Jun-2024 06:05                5219
mongodb-bson-int64.serialize.php                   24-Jun-2024 06:05                3547
mongodb-bson-int64.tostring.php                    24-Jun-2024 06:05                3904
mongodb-bson-int64.unserialize.php                 24-Jun-2024 06:05                4371
mongodb-bson-iterator.construct.php                24-Jun-2024 06:05                3408
mongodb-bson-iterator.current.php                  24-Jun-2024 06:05                3678
mongodb-bson-iterator.key.php                      24-Jun-2024 06:05                3673
mongodb-bson-iterator.next.php                     24-Jun-2024 06:05                2446
mongodb-bson-iterator.rewind.php                   24-Jun-2024 06:05                2485
mongodb-bson-iterator.valid.php                    24-Jun-2024 06:05                2889
mongodb-bson-javascript.construct.php              24-Jun-2024 06:05                7323
mongodb-bson-javascript.getcode.php                24-Jun-2024 06:05                4448
mongodb-bson-javascript.getscope.php               24-Jun-2024 06:05                5424
mongodb-bson-javascript.jsonserialize.php          24-Jun-2024 06:05                5576
mongodb-bson-javascript.serialize.php              24-Jun-2024 06:05                3670
mongodb-bson-javascript.tostring.php               24-Jun-2024 06:05                4233
mongodb-bson-javascript.unserialize.php            24-Jun-2024 06:05                4484
mongodb-bson-javascriptinterface.getcode.php       24-Jun-2024 06:05                2975
mongodb-bson-javascriptinterface.getscope.php      24-Jun-2024 06:05                3140
mongodb-bson-javascriptinterface.tostring.php      24-Jun-2024 06:05                3447
mongodb-bson-maxkey.construct.php                  24-Jun-2024 06:05                3703
mongodb-bson-maxkey.jsonserialize.php              24-Jun-2024 06:05                5496
mongodb-bson-maxkey.serialize.php                  24-Jun-2024 06:05                3574
mongodb-bson-maxkey.unserialize.php                24-Jun-2024 06:05                3832
mongodb-bson-minkey.construct.php                  24-Jun-2024 06:05                3703
mongodb-bson-minkey.jsonserialize.php              24-Jun-2024 06:05                5496
mongodb-bson-minkey.serialize.php                  24-Jun-2024 06:05                3574
mongodb-bson-minkey.unserialize.php                24-Jun-2024 06:05                3836
mongodb-bson-objectid.construct.php                24-Jun-2024 06:05                5334
mongodb-bson-objectid.gettimestamp.php             24-Jun-2024 06:05                5585
mongodb-bson-objectid.jsonserialize.php            24-Jun-2024 06:05                5542
mongodb-bson-objectid.serialize.php                24-Jun-2024 06:05                3622
mongodb-bson-objectid.tostring.php                 24-Jun-2024 06:05                4232
mongodb-bson-objectid.unserialize.php              24-Jun-2024 06:05                4438
mongodb-bson-objectidinterface.gettimestamp.php    24-Jun-2024 06:05                3044
mongodb-bson-objectidinterface.tostring.php        24-Jun-2024 06:05                3028
mongodb-bson-packedarray.construct.php             24-Jun-2024 06:05                2940
mongodb-bson-packedarray.fromphp.php               24-Jun-2024 06:05                4030
mongodb-bson-packedarray.get.php                   24-Jun-2024 06:05                4367
mongodb-bson-packedarray.getiterator.php           24-Jun-2024 06:05                3641
mongodb-bson-packedarray.has.php                   24-Jun-2024 06:05                3905
mongodb-bson-packedarray.offsetexists.php          24-Jun-2024 06:05                3617
mongodb-bson-packedarray.offsetget.php             24-Jun-2024 06:05                4578
mongodb-bson-packedarray.offsetset.php             24-Jun-2024 06:05                3677
mongodb-bson-packedarray.offsetunset.php           24-Jun-2024 06:05                3286
mongodb-bson-packedarray.serialize.php             24-Jun-2024 06:05                3682
mongodb-bson-packedarray.tophp.php                 24-Jun-2024 06:05                4705
mongodb-bson-packedarray.tostring.php              24-Jun-2024 06:05                2813
mongodb-bson-packedarray.unserialize.php           24-Jun-2024 06:05                4504
mongodb-bson-persistable.bsonserialize.php         24-Jun-2024 06:05                6232
mongodb-bson-regex.construct.php                   24-Jun-2024 06:05                7084
mongodb-bson-regex.getflags.php                    24-Jun-2024 06:05                4567
mongodb-bson-regex.getpattern.php                  24-Jun-2024 06:05                4429
mongodb-bson-regex.jsonserialize.php               24-Jun-2024 06:05                5475
mongodb-bson-regex.serialize.php                   24-Jun-2024 06:05                3545
mongodb-bson-regex.tostring.php                    24-Jun-2024 06:05                3931
mongodb-bson-regex.unserialize.php                 24-Jun-2024 06:05                4375
mongodb-bson-regexinterface.getflags.php           24-Jun-2024 06:05                2880
mongodb-bson-regexinterface.getpattern.php         24-Jun-2024 06:05                2923
mongodb-bson-regexinterface.tostring.php           24-Jun-2024 06:05                2954
mongodb-bson-serializable.bsonserialize.php        24-Jun-2024 06:05               16660
mongodb-bson-symbol.construct.php                  24-Jun-2024 06:05                2646
mongodb-bson-symbol.jsonserialize.php              24-Jun-2024 06:05                5496
mongodb-bson-symbol.serialize.php                  24-Jun-2024 06:05                3570
mongodb-bson-symbol.tostring.php                   24-Jun-2024 06:05                2701
mongodb-bson-symbol.unserialize.php                24-Jun-2024 06:05                3838
mongodb-bson-timestamp.construct.php               24-Jun-2024 06:05                4881
mongodb-bson-timestamp.getincrement.php            24-Jun-2024 06:05                4401
mongodb-bson-timestamp.gettimestamp.php            24-Jun-2024 06:05                4386
mongodb-bson-timestamp.jsonserialize.php           24-Jun-2024 06:05                5563
mongodb-bson-timestamp.serialize.php               24-Jun-2024 06:05                3645
mongodb-bson-timestamp.tostring.php                24-Jun-2024 06:05                4074
mongodb-bson-timestamp.unserialize.php             24-Jun-2024 06:05                4471
mongodb-bson-timestampinterface.getincrement.php   24-Jun-2024 06:05                3406
mongodb-bson-timestampinterface.gettimestamp.php   24-Jun-2024 06:05                3421
mongodb-bson-timestampinterface.tostring.php       24-Jun-2024 06:05                3046
mongodb-bson-undefined.construct.php               24-Jun-2024 06:05                2706
mongodb-bson-undefined.jsonserialize.php           24-Jun-2024 06:05                5559
mongodb-bson-undefined.serialize.php               24-Jun-2024 06:05                3645
mongodb-bson-undefined.tostring.php                24-Jun-2024 06:05                2723
mongodb-bson-undefined.unserialize.php             24-Jun-2024 06:05                3900
mongodb-bson-unserializable.bsonunserialize.php    24-Jun-2024 06:05                7104
mongodb-bson-utcdatetime.construct.php             24-Jun-2024 06:05                8235
mongodb-bson-utcdatetime.jsonserialize.php         24-Jun-2024 06:05                5601
mongodb-bson-utcdatetime.serialize.php             24-Jun-2024 06:05                3697
mongodb-bson-utcdatetime.todatetime.php            24-Jun-2024 06:05                5898
mongodb-bson-utcdatetime.tostring.php              24-Jun-2024 06:05                4029
mongodb-bson-utcdatetime.unserialize.php           24-Jun-2024 06:05                4503
mongodb-bson-utcdatetimeinterface.todatetime.php   24-Jun-2024 06:05                3323
mongodb-bson-utcdatetimeinterface.tostring.php     24-Jun-2024 06:05                3062
mongodb-driver-bulkwrite.construct.php             24-Jun-2024 06:05               18805
mongodb-driver-bulkwrite.count.php                 24-Jun-2024 06:05                7007
mongodb-driver-bulkwrite.delete.php                24-Jun-2024 06:05               12312
mongodb-driver-bulkwrite.insert.php                24-Jun-2024 06:05                9682
mongodb-driver-bulkwrite.update.php                24-Jun-2024 06:05               15922
mongodb-driver-clientencryption.addkeyaltname.php  24-Jun-2024 06:05                5665
mongodb-driver-clientencryption.construct.php      24-Jun-2024 06:05               11479
mongodb-driver-clientencryption.createdatakey.php  24-Jun-2024 06:05               11268
mongodb-driver-clientencryption.decrypt.php        24-Jun-2024 06:05                4264
mongodb-driver-clientencryption.deletekey.php      24-Jun-2024 06:05                4407
mongodb-driver-clientencryption.encrypt.php        24-Jun-2024 06:05               13643
mongodb-driver-clientencryption.encryptexpressi..> 24-Jun-2024 06:05               15338
mongodb-driver-clientencryption.getkey.php         24-Jun-2024 06:05                4540
mongodb-driver-clientencryption.getkeybyaltname..> 24-Jun-2024 06:05                5135
mongodb-driver-clientencryption.getkeys.php        24-Jun-2024 06:05                3970
mongodb-driver-clientencryption.removekeyaltnam..> 24-Jun-2024 06:05                5730
mongodb-driver-clientencryption.rewrapmanydatak..> 24-Jun-2024 06:05               12510
mongodb-driver-command.construct.php               24-Jun-2024 06:05               14302
mongodb-driver-commandexception.getresultdocume..> 24-Jun-2024 06:05                3296
mongodb-driver-cursor.construct.php                24-Jun-2024 06:05                3380
mongodb-driver-cursor.current.php                  24-Jun-2024 06:05                3140
mongodb-driver-cursor.getid.php                    24-Jun-2024 06:05                7669
mongodb-driver-cursor.getserver.php                24-Jun-2024 06:05                7562
mongodb-driver-cursor.isdead.php                   24-Jun-2024 06:05               10685
mongodb-driver-cursor.key.php                      24-Jun-2024 06:05                2693
mongodb-driver-cursor.next.php                     24-Jun-2024 06:05                3620
mongodb-driver-cursor.rewind.php                   24-Jun-2024 06:05                4075
mongodb-driver-cursor.settypemap.php               24-Jun-2024 06:05                8047
mongodb-driver-cursor.toarray.php                  24-Jun-2024 06:05                7755
mongodb-driver-cursor.valid.php                    24-Jun-2024 06:05                2914
mongodb-driver-cursorid.construct.php              24-Jun-2024 06:05                2868
mongodb-driver-cursorid.serialize.php              24-Jun-2024 06:05                3668
mongodb-driver-cursorid.tostring.php               24-Jun-2024 06:05                7028
mongodb-driver-cursorid.unserialize.php            24-Jun-2024 06:05                4510
mongodb-driver-cursorinterface.getid.php           24-Jun-2024 06:05                4081
mongodb-driver-cursorinterface.getserver.php       24-Jun-2024 06:05                4182
mongodb-driver-cursorinterface.isdead.php          24-Jun-2024 06:05                4145
mongodb-driver-cursorinterface.settypemap.php      24-Jun-2024 06:05                4193
mongodb-driver-cursorinterface.toarray.php         24-Jun-2024 06:05                4044
mongodb-driver-manager.addsubscriber.php           24-Jun-2024 06:05                5605
mongodb-driver-manager.construct.php               24-Jun-2024 06:05               80322
mongodb-driver-manager.createclientencryption.php  24-Jun-2024 06:05               12829
mongodb-driver-manager.executebulkwrite.php        24-Jun-2024 06:05               23424
mongodb-driver-manager.executecommand.php          24-Jun-2024 06:05               25218
mongodb-driver-manager.executequery.php            24-Jun-2024 06:05               16688
mongodb-driver-manager.executereadcommand.php      24-Jun-2024 06:05               10388
mongodb-driver-manager.executereadwritecommand.php 24-Jun-2024 06:05               11483
mongodb-driver-manager.executewritecommand.php     24-Jun-2024 06:05               11537
mongodb-driver-manager.getencryptedfieldsmap.php   24-Jun-2024 06:05                3979
mongodb-driver-manager.getreadconcern.php          24-Jun-2024 06:05                5966
mongodb-driver-manager.getreadpreference.php       24-Jun-2024 06:05                6561
mongodb-driver-manager.getservers.php              24-Jun-2024 06:05                8002
mongodb-driver-manager.getwriteconcern.php         24-Jun-2024 06:05                6019
mongodb-driver-manager.removesubscriber.php        24-Jun-2024 06:05                4997
mongodb-driver-manager.selectserver.php            24-Jun-2024 06:05                7321
mongodb-driver-manager.startsession.php            24-Jun-2024 06:05               12769
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                3779
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                3706
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                3878
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                3707
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                4908
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                4098
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                4337
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                4260
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                4101
mongodb-driver-monitoring-commandfailedevent.ge..> 24-Jun-2024 06:05                3885
mongodb-driver-monitoring-commandstartedevent.g..> 24-Jun-2024 06:05                4105
mongodb-driver-monitoring-commandstartedevent.g..> 24-Jun-2024 06:05                3815
mongodb-driver-monitoring-commandstartedevent.g..> 24-Jun-2024 06:05                3717
mongodb-driver-monitoring-commandstartedevent.g..> 24-Jun-2024 06:05                5217
mongodb-driver-monitoring-commandstartedevent.g..> 24-Jun-2024 06:05                4798
mongodb-driver-monitoring-commandstartedevent.g..> 24-Jun-2024 06:05                4551
mongodb-driver-monitoring-commandstartedevent.g..> 24-Jun-2024 06:05                4121
mongodb-driver-monitoring-commandstartedevent.g..> 24-Jun-2024 06:05                3905
mongodb-driver-monitoring-commandsubscriber.com..> 24-Jun-2024 06:05                4954
mongodb-driver-monitoring-commandsubscriber.com..> 24-Jun-2024 06:05                5022
mongodb-driver-monitoring-commandsubscriber.com..> 24-Jun-2024 06:05                5020
mongodb-driver-monitoring-commandsucceededevent..> 24-Jun-2024 06:05                3836
mongodb-driver-monitoring-commandsucceededevent..> 24-Jun-2024 06:05                3763
mongodb-driver-monitoring-commandsucceededevent..> 24-Jun-2024 06:05                3947
mongodb-driver-monitoring-commandsucceededevent..> 24-Jun-2024 06:05                4995
mongodb-driver-monitoring-commandsucceededevent..> 24-Jun-2024 06:05                4155
mongodb-driver-monitoring-commandsucceededevent..> 24-Jun-2024 06:05                4400
mongodb-driver-monitoring-commandsucceededevent..> 24-Jun-2024 06:05                4765
mongodb-driver-monitoring-commandsucceededevent..> 24-Jun-2024 06:05                4161
mongodb-driver-monitoring-commandsucceededevent..> 24-Jun-2024 06:05                3931
mongodb-driver-monitoring-logsubscriber.log.php    24-Jun-2024 06:05                4692
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Jun-2024 06:05                4841
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Jun-2024 06:05                4815
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Jun-2024 06:05                5377
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Jun-2024 06:05                5440
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Jun-2024 06:05                5450
mongodb-driver-monitoring-sdamsubscriber.server..> 24-Jun-2024 06:05                4845
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-Jun-2024 06:05                4916
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-Jun-2024 06:05                4857
mongodb-driver-monitoring-sdamsubscriber.topolo..> 24-Jun-2024 06:05                4840
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Jun-2024 06:05                3250
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Jun-2024 06:05                3566
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Jun-2024 06:05                3318
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Jun-2024 06:05                3643
mongodb-driver-monitoring-serverchangedevent.ge..> 24-Jun-2024 06:05                3366
mongodb-driver-monitoring-serverclosedevent.get..> 24-Jun-2024 06:05                3212
mongodb-driver-monitoring-serverclosedevent.get..> 24-Jun-2024 06:05                3262
mongodb-driver-monitoring-serverclosedevent.get..> 24-Jun-2024 06:05                3322
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Jun-2024 06:05                3698
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Jun-2024 06:05                3550
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Jun-2024 06:05                3387
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Jun-2024 06:05                3416
mongodb-driver-monitoring-serverheartbeatfailed..> 24-Jun-2024 06:05                3771
mongodb-driver-monitoring-serverheartbeatstarte..> 24-Jun-2024 06:05                3392
mongodb-driver-monitoring-serverheartbeatstarte..> 24-Jun-2024 06:05                3434
mongodb-driver-monitoring-serverheartbeatstarte..> 24-Jun-2024 06:05                3791
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Jun-2024 06:05                3750
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Jun-2024 06:05                3459
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Jun-2024 06:05                3468
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Jun-2024 06:05                4292
mongodb-driver-monitoring-serverheartbeatsuccee..> 24-Jun-2024 06:05                3807
mongodb-driver-monitoring-serveropeningevent.ge..> 24-Jun-2024 06:05                3230
mongodb-driver-monitoring-serveropeningevent.ge..> 24-Jun-2024 06:05                3280
mongodb-driver-monitoring-serveropeningevent.ge..> 24-Jun-2024 06:05                3354
mongodb-driver-monitoring-topologychangedevent...> 24-Jun-2024 06:05                3635
mongodb-driver-monitoring-topologychangedevent...> 24-Jun-2024 06:05                3713
mongodb-driver-monitoring-topologychangedevent...> 24-Jun-2024 06:05                3374
mongodb-driver-monitoring-topologyclosedevent.g..> 24-Jun-2024 06:05                3319
mongodb-driver-monitoring-topologyopeningevent...> 24-Jun-2024 06:05                3329
mongodb-driver-query.construct.php                 24-Jun-2024 06:05               33190
mongodb-driver-readconcern.bsonserialize.php       24-Jun-2024 06:05                6838
mongodb-driver-readconcern.construct.php           24-Jun-2024 06:05                5786
mongodb-driver-readconcern.getlevel.php            24-Jun-2024 06:05                5853
mongodb-driver-readconcern.isdefault.php           24-Jun-2024 06:05                8127
mongodb-driver-readconcern.serialize.php           24-Jun-2024 06:05                3745
mongodb-driver-readconcern.unserialize.php         24-Jun-2024 06:05                4561
mongodb-driver-readpreference.bsonserialize.php    24-Jun-2024 06:05               10471
mongodb-driver-readpreference.construct.php        24-Jun-2024 06:05               18509
mongodb-driver-readpreference.gethedge.php         24-Jun-2024 06:05                3491
mongodb-driver-readpreference.getmaxstalenessse..> 24-Jun-2024 06:05                8225
mongodb-driver-readpreference.getmode.php          24-Jun-2024 06:05                7549
mongodb-driver-readpreference.getmodestring.php    24-Jun-2024 06:05                7755
mongodb-driver-readpreference.gettagsets.php       24-Jun-2024 06:05                8110
mongodb-driver-readpreference.serialize.php        24-Jun-2024 06:05                3822
mongodb-driver-readpreference.unserialize.php      24-Jun-2024 06:05                4640
mongodb-driver-runtimeexception.haserrorlabel.php  24-Jun-2024 06:05                4257
mongodb-driver-server.construct.php                24-Jun-2024 06:05                3412
mongodb-driver-server.executebulkwrite.php         24-Jun-2024 06:05               11734
mongodb-driver-server.executecommand.php           24-Jun-2024 06:05               13632
mongodb-driver-server.executequery.php             24-Jun-2024 06:05                9142
mongodb-driver-server.executereadcommand.php       24-Jun-2024 06:05               11020
mongodb-driver-server.executereadwritecommand.php  24-Jun-2024 06:05               12013
mongodb-driver-server.executewritecommand.php      24-Jun-2024 06:05               12033
mongodb-driver-server.gethost.php                  24-Jun-2024 06:05                5516
mongodb-driver-server.getinfo.php                  24-Jun-2024 06:05               10681
mongodb-driver-server.getlatency.php               24-Jun-2024 06:05                7196
mongodb-driver-server.getport.php                  24-Jun-2024 06:05                5558
mongodb-driver-server.getserverdescription.php     24-Jun-2024 06:05                3490
mongodb-driver-server.gettags.php                  24-Jun-2024 06:05                3852
mongodb-driver-server.gettype.php                  24-Jun-2024 06:05                3888
mongodb-driver-server.isarbiter.php                24-Jun-2024 06:05                3705
mongodb-driver-server.ishidden.php                 24-Jun-2024 06:05                3699
mongodb-driver-server.ispassive.php                24-Jun-2024 06:05                3767
mongodb-driver-server.isprimary.php                24-Jun-2024 06:05                3712
mongodb-driver-server.issecondary.php              24-Jun-2024 06:05                3747
mongodb-driver-serverapi.bsonserialize.php         24-Jun-2024 06:05                3374
mongodb-driver-serverapi.construct.php             24-Jun-2024 06:05                5252
mongodb-driver-serverapi.serialize.php             24-Jun-2024 06:05                3698
mongodb-driver-serverapi.unserialize.php           24-Jun-2024 06:05                4528
mongodb-driver-serverdescription.gethellorespon..> 24-Jun-2024 06:05                5263
mongodb-driver-serverdescription.gethost.php       24-Jun-2024 06:05                3514
mongodb-driver-serverdescription.getlastupdatet..> 24-Jun-2024 06:05                3665
mongodb-driver-serverdescription.getport.php       24-Jun-2024 06:05                3569
mongodb-driver-serverdescription.getroundtripti..> 24-Jun-2024 06:05                3968
mongodb-driver-serverdescription.gettype.php       24-Jun-2024 06:05                3904
mongodb-driver-session.aborttransaction.php        24-Jun-2024 06:05                4271
mongodb-driver-session.advanceclustertime.php      24-Jun-2024 06:05                4946
mongodb-driver-session.advanceoperationtime.php    24-Jun-2024 06:05                4886
mongodb-driver-session.committransaction.php       24-Jun-2024 06:05                5630
mongodb-driver-session.construct.php               24-Jun-2024 06:05                2935
mongodb-driver-session.endsession.php              24-Jun-2024 06:05                4403
mongodb-driver-session.getclustertime.php          24-Jun-2024 06:05                4042
mongodb-driver-session.getlogicalsessionid.php     24-Jun-2024 06:05                3200
mongodb-driver-session.getoperationtime.php        24-Jun-2024 06:05                4122
mongodb-driver-session.getserver.php               24-Jun-2024 06:05                4015
mongodb-driver-session.gettransactionoptions.php   24-Jun-2024 06:05                3897
mongodb-driver-session.gettransactionstate.php     24-Jun-2024 06:05                3801
mongodb-driver-session.isdirty.php                 24-Jun-2024 06:05                3085
mongodb-driver-session.isintransaction.php         24-Jun-2024 06:05                3863
mongodb-driver-session.starttransaction.php        24-Jun-2024 06:05                9253
mongodb-driver-topologydescription.getservers.php  24-Jun-2024 06:05                3527
mongodb-driver-topologydescription.gettype.php     24-Jun-2024 06:05                3575
mongodb-driver-topologydescription.hasreadables..> 24-Jun-2024 06:05                4014
mongodb-driver-topologydescription.haswritables..> 24-Jun-2024 06:05                3295
mongodb-driver-writeconcern.bsonserialize.php      24-Jun-2024 06:05                7283
mongodb-driver-writeconcern.construct.php          24-Jun-2024 06:05               10597
mongodb-driver-writeconcern.getjournal.php         24-Jun-2024 06:05                6039
mongodb-driver-writeconcern.getw.php               24-Jun-2024 06:05                5329
mongodb-driver-writeconcern.getwtimeout.php        24-Jun-2024 06:05                5965
mongodb-driver-writeconcern.isdefault.php          24-Jun-2024 06:05                7914
mongodb-driver-writeconcern.serialize.php          24-Jun-2024 06:05                3770
mongodb-driver-writeconcern.unserialize.php        24-Jun-2024 06:05                4600
mongodb-driver-writeconcernerror.getcode.php       24-Jun-2024 06:05                6376
mongodb-driver-writeconcernerror.getinfo.php       24-Jun-2024 06:05                6702
mongodb-driver-writeconcernerror.getmessage.php    24-Jun-2024 06:05                6467
mongodb-driver-writeerror.getcode.php              24-Jun-2024 06:05                5719
mongodb-driver-writeerror.getindex.php             24-Jun-2024 06:05                6247
mongodb-driver-writeerror.getinfo.php              24-Jun-2024 06:05                3197
mongodb-driver-writeerror.getmessage.php           24-Jun-2024 06:05                5855
mongodb-driver-writeexception.getwriteresult.php   24-Jun-2024 06:05                7953
mongodb-driver-writeresult.getdeletedcount.php     24-Jun-2024 06:05                8208
mongodb-driver-writeresult.getinsertedcount.php    24-Jun-2024 06:05                8290
mongodb-driver-writeresult.getmatchedcount.php     24-Jun-2024 06:05                8853
mongodb-driver-writeresult.getmodifiedcount.php    24-Jun-2024 06:05                9151
mongodb-driver-writeresult.getserver.php           24-Jun-2024 06:05                6583
mongodb-driver-writeresult.getupsertedcount.php    24-Jun-2024 06:05                8379
mongodb-driver-writeresult.getupsertedids.php      24-Jun-2024 06:05                8864
mongodb-driver-writeresult.getwriteconcernerror..> 24-Jun-2024 06:05                7254
mongodb-driver-writeresult.getwriteerrors.php      24-Jun-2024 06:05               13066
mongodb-driver-writeresult.isacknowledged.php      24-Jun-2024 06:05                8224
mongodb.architecture.php                           24-Jun-2024 06:05                1985
mongodb.configuration.php                          24-Jun-2024 06:05                4115
mongodb.connection-handling.php                    24-Jun-2024 06:05                8785
mongodb.constants.php                              24-Jun-2024 06:05                2256
mongodb.exceptions.php                             24-Jun-2024 06:05                5212
mongodb.exceptions.tree.php                        24-Jun-2024 06:05                5636
mongodb.installation.homebrew.php                  24-Jun-2024 06:05                2062
mongodb.installation.manual.php                    24-Jun-2024 06:05                6223
mongodb.installation.pecl.php                      24-Jun-2024 06:05                5048
mongodb.installation.php                           24-Jun-2024 06:05                1894
mongodb.installation.windows.php                   24-Jun-2024 06:05                4409
mongodb.monitoring.php                             24-Jun-2024 06:05               19473
mongodb.overview.php                               24-Jun-2024 06:05                4682
mongodb.persistence.deserialization.php            24-Jun-2024 06:05               21945
mongodb.persistence.php                            24-Jun-2024 06:05                1832
mongodb.persistence.serialization.php              24-Jun-2024 06:05               23144
mongodb.requirements.php                           24-Jun-2024 06:05                3275
mongodb.security.php                               24-Jun-2024 06:05                1547
mongodb.security.request_injection.php             24-Jun-2024 06:05                3047
mongodb.security.script_injection.php              24-Jun-2024 06:05                9236
mongodb.setup.php                                  24-Jun-2024 06:05                2181
mongodb.tutorial.apm.php                           24-Jun-2024 06:05               18803
mongodb.tutorial.library.php                       24-Jun-2024 06:05               10961
mongodb.tutorial.php                               24-Jun-2024 06:05                1768
mqseries.configure.php                             24-Jun-2024 06:05                2922
mqseries.constants.php                             24-Jun-2024 06:05                2742
mqseries.ini.php                                   24-Jun-2024 06:05                1427
mqseries.requirements.php                          24-Jun-2024 06:05                1720
mqseries.resources.php                             24-Jun-2024 06:05                1766
mqseries.setup.php                                 24-Jun-2024 06:05                1748