Index of /php/manual/ja/


../
feeds/                                             13-Apr-2024 02:05                   -
images/                                            13-Apr-2024 02:05                   -
styles/                                            13-Apr-2024 02:05                   -
toc/                                               13-Apr-2024 02:05                   -
about.formats.php                                  13-Apr-2024 02:05                5192
about.generate.php                                 13-Apr-2024 02:05                3080
about.howtohelp.php                                13-Apr-2024 02:05                3946
about.more.php                                     13-Apr-2024 02:05                2192
about.notes.php                                    13-Apr-2024 02:05                2658
about.php                                          13-Apr-2024 02:05                1939
about.phpversions.php                              13-Apr-2024 02:05                4102
about.prototypes.php                               13-Apr-2024 02:05                7904
about.translations.php                             13-Apr-2024 02:05                3555
aliases.php                                        13-Apr-2024 02:05               29646
allowdynamicproperties.construct.php               13-Apr-2024 02:05                2258
apache.configuration.php                           13-Apr-2024 02:05                5643
apache.constants.php                               13-Apr-2024 02:05                1109
apache.installation.php                            13-Apr-2024 02:05                1279
apache.requirements.php                            13-Apr-2024 02:05                1157
apache.resources.php                               13-Apr-2024 02:05                1158
apache.setup.php                                   13-Apr-2024 02:05                1545
apcu.configuration.php                             13-Apr-2024 02:05               18549
apcu.constants.php                                 13-Apr-2024 02:05                7396
apcu.installation.php                              13-Apr-2024 02:05                3608
apcu.requirements.php                              13-Apr-2024 02:05                1143
apcu.resources.php                                 13-Apr-2024 02:05                1144
apcu.setup.php                                     13-Apr-2024 02:05                1503
apcuiterator.construct.php                         13-Apr-2024 02:05                6937
apcuiterator.current.php                           13-Apr-2024 02:05                3053
apcuiterator.gettotalcount.php                     13-Apr-2024 02:05                3275
apcuiterator.gettotalhits.php                      13-Apr-2024 02:05                3445
apcuiterator.gettotalsize.php                      13-Apr-2024 02:05                3318
apcuiterator.key.php                               13-Apr-2024 02:05                2836
apcuiterator.next.php                              13-Apr-2024 02:05                3101
apcuiterator.rewind.php                            13-Apr-2024 02:05                2705
apcuiterator.valid.php                             13-Apr-2024 02:05                2981
appendices.php                                     13-Apr-2024 02:05               13127
appenditerator.append.php                          13-Apr-2024 02:05                5412
appenditerator.construct.php                       13-Apr-2024 02:05               10228
appenditerator.current.php                         13-Apr-2024 02:05                3499
appenditerator.getarrayiterator.php                13-Apr-2024 02:05                3093
appenditerator.getiteratorindex.php                13-Apr-2024 02:05                6714
appenditerator.key.php                             13-Apr-2024 02:05                7205
appenditerator.next.php                            13-Apr-2024 02:05                3378
appenditerator.rewind.php                          13-Apr-2024 02:05                3370
appenditerator.valid.php                           13-Apr-2024 02:05                3398
array.configuration.php                            13-Apr-2024 02:05                1176
array.constants.php                                13-Apr-2024 02:05               12252
array.installation.php                             13-Apr-2024 02:05                1210
array.requirements.php                             13-Apr-2024 02:05                1150
array.resources.php                                13-Apr-2024 02:05                1151
array.setup.php                                    13-Apr-2024 02:05                1510
array.sorting.php                                  13-Apr-2024 02:05                7027
arrayaccess.offsetexists.php                       13-Apr-2024 02:05                9232
arrayaccess.offsetget.php                          13-Apr-2024 02:05                5095
arrayaccess.offsetset.php                          13-Apr-2024 02:05                5318
arrayaccess.offsetunset.php                        13-Apr-2024 02:05                2871
arrayiterator.append.php                           13-Apr-2024 02:05                3495
arrayiterator.asort.php                            13-Apr-2024 02:05                7557
arrayiterator.construct.php                        13-Apr-2024 02:05                3779
arrayiterator.count.php                            13-Apr-2024 02:05                2959
arrayiterator.current.php                          13-Apr-2024 02:05                5039
arrayiterator.getarraycopy.php                     13-Apr-2024 02:05                3050
arrayiterator.getflags.php                         13-Apr-2024 02:05                3141
arrayiterator.key.php                              13-Apr-2024 02:05                3921
arrayiterator.ksort.php                            13-Apr-2024 02:05                7514
arrayiterator.natcasesort.php                      13-Apr-2024 02:05                4997
arrayiterator.natsort.php                          13-Apr-2024 02:05                4873
arrayiterator.next.php                             13-Apr-2024 02:05                4645
arrayiterator.offsetexists.php                     13-Apr-2024 02:05                3468
arrayiterator.offsetget.php                        13-Apr-2024 02:05                3416
arrayiterator.offsetset.php                        13-Apr-2024 02:05                3691
arrayiterator.offsetunset.php                      13-Apr-2024 02:05                3903
arrayiterator.rewind.php                           13-Apr-2024 02:05                4567
arrayiterator.seek.php                             13-Apr-2024 02:05                2606
arrayiterator.serialize.php                        13-Apr-2024 02:05                2964
arrayiterator.setflags.php                         13-Apr-2024 02:05                4231
arrayiterator.uasort.php                           13-Apr-2024 02:05                6686
arrayiterator.uksort.php                           13-Apr-2024 02:05                6592
arrayiterator.unserialize.php                      13-Apr-2024 02:05                3171
arrayiterator.valid.php                            13-Apr-2024 02:05                4666
arrayobject.append.php                             13-Apr-2024 02:05                5496
arrayobject.asort.php                              13-Apr-2024 02:05               10145
arrayobject.construct.php                          13-Apr-2024 02:05                6149
arrayobject.count.php                              13-Apr-2024 02:05                5411
arrayobject.exchangearray.php                      13-Apr-2024 02:05                5983
arrayobject.getarraycopy.php                       13-Apr-2024 02:05                5315
arrayobject.getflags.php                           13-Apr-2024 02:05                6201
arrayobject.getiterator.php                        13-Apr-2024 02:05                5312
arrayobject.getiteratorclass.php                   13-Apr-2024 02:05                6651
arrayobject.ksort.php                              13-Apr-2024 02:05               10102
arrayobject.natcasesort.php                        13-Apr-2024 02:05                8521
arrayobject.natsort.php                            13-Apr-2024 02:05                8227
arrayobject.offsetexists.php                       13-Apr-2024 02:05                4998
arrayobject.offsetget.php                          13-Apr-2024 02:05                5157
arrayobject.offsetset.php                          13-Apr-2024 02:05                6749
arrayobject.offsetunset.php                        13-Apr-2024 02:05                4249
arrayobject.serialize.php                          13-Apr-2024 02:05                5171
arrayobject.setflags.php                           13-Apr-2024 02:05                6797
arrayobject.setiteratorclass.php                   13-Apr-2024 02:05                5862
arrayobject.uasort.php                             13-Apr-2024 02:05               11229
arrayobject.uksort.php                             13-Apr-2024 02:05               10651
arrayobject.unserialize.php                        13-Apr-2024 02:05                3626
attribute.construct.php                            13-Apr-2024 02:05                2344
backedenum.from.php                                13-Apr-2024 02:05                6110
backedenum.tryfrom.php                             13-Apr-2024 02:05                6722
bc.configuration.php                               13-Apr-2024 02:05                2487
bc.constants.php                                   13-Apr-2024 02:05                1083
bc.installation.php                                13-Apr-2024 02:05                1568
bc.requirements.php                                13-Apr-2024 02:05                1129
bc.resources.php                                   13-Apr-2024 02:05                1130
bc.setup.php                                       13-Apr-2024 02:05                1505
book.apache.php                                    13-Apr-2024 02:05                3364
book.apcu.php                                      13-Apr-2024 02:05                4736
book.array.php                                     13-Apr-2024 02:05               12370
book.bc.php                                        13-Apr-2024 02:05                2850
book.bson.php                                      13-Apr-2024 02:05               24502
book.bzip2.php                                     13-Apr-2024 02:05                2946
book.calendar.php                                  13-Apr-2024 02:05                4137
book.classobj.php                                  13-Apr-2024 02:05                4773
book.cmark.php                                     13-Apr-2024 02:05                8732
book.com.php                                       13-Apr-2024 02:05                8424
book.componere.php                                 13-Apr-2024 02:05                6122
book.ctype.php                                     13-Apr-2024 02:05                3056
book.cubrid.php                                    13-Apr-2024 02:05               13777
book.curl.php                                      13-Apr-2024 02:05                7415
book.datetime.php                                  13-Apr-2024 02:05               18305
book.dba.php                                       13-Apr-2024 02:05                3645
book.dbase.php                                     13-Apr-2024 02:05                3159
book.dio.php                                       13-Apr-2024 02:05                3091
book.dir.php                                       13-Apr-2024 02:05                3327
book.dom.php                                       13-Apr-2024 02:05               22856
book.ds.php                                        13-Apr-2024 02:05               25089
book.eio.php                                       13-Apr-2024 02:05                8893
book.enchant.php                                   13-Apr-2024 02:05                5582
book.errorfunc.php                                 13-Apr-2024 02:05                3555
book.ev.php                                        13-Apr-2024 02:05               13856
book.event.php                                     13-Apr-2024 02:05               23117
book.exec.php                                      13-Apr-2024 02:05                3350
book.exif.php                                      13-Apr-2024 02:05                2485
book.expect.php                                    13-Apr-2024 02:05                2503
book.fann.php                                      13-Apr-2024 02:05               23042
book.fdf.php                                       13-Apr-2024 02:05                6213
book.ffi.php                                       13-Apr-2024 02:05                5580
book.fileinfo.php                                  13-Apr-2024 02:05                3096
book.filesystem.php                                13-Apr-2024 02:05               11152
book.filter.php                                    13-Apr-2024 02:05                3565
book.fpm.php                                       13-Apr-2024 02:05                2021
book.ftp.php                                       13-Apr-2024 02:05                6546
book.funchand.php                                  13-Apr-2024 02:05                3684
book.gearman.php                                   13-Apr-2024 02:05               14750
book.gender.php                                    13-Apr-2024 02:05                2584
book.geoip.php                                     13-Apr-2024 02:05                4548
book.gettext.php                                   13-Apr-2024 02:05                2961
book.gmagick.php                                   13-Apr-2024 02:05               24393
book.gmp.php                                       13-Apr-2024 02:05                6901
book.gnupg.php                                     13-Apr-2024 02:05                5211
book.hash.php                                      13-Apr-2024 02:05                4515
book.hrtime.php                                    13-Apr-2024 02:05                3468
book.ibase.php                                     13-Apr-2024 02:05               13181
book.ibm-db2.php                                   13-Apr-2024 02:05                9281
book.iconv.php                                     13-Apr-2024 02:05                3333
book.igbinary.php                                  13-Apr-2024 02:05                2136
book.image.php                                     13-Apr-2024 02:05               17168
book.imagick.php                                   13-Apr-2024 02:05               68631
book.imap.php                                      13-Apr-2024 02:05               11697
book.info.php                                      13-Apr-2024 02:05                8766
book.inotify.php                                   13-Apr-2024 02:05                2555
book.intl.php                                      13-Apr-2024 02:05               50780
book.json.php                                      13-Apr-2024 02:05                2918
book.ldap.php                                      13-Apr-2024 02:05                9873
book.libxml.php                                    13-Apr-2024 02:05                3372
book.lua.php                                       13-Apr-2024 02:05                2653
book.luasandbox.php                                13-Apr-2024 02:05                5516
book.lzf.php                                       13-Apr-2024 02:05                2153
book.mail.php                                      13-Apr-2024 02:05                2052
book.mailparse.php                                 13-Apr-2024 02:05                4200
book.math.php                                      13-Apr-2024 02:05                5784
book.mbstring.php                                  13-Apr-2024 02:05               11055
book.mcrypt.php                                    13-Apr-2024 02:05                6837
book.memcache.php                                  13-Apr-2024 02:05                4471
book.memcached.php                                 13-Apr-2024 02:05                8964
book.mhash.php                                     13-Apr-2024 02:05                2461
book.misc.php                                      13-Apr-2024 02:05                5727
book.mongodb.php                                   13-Apr-2024 02:05               26800
book.mqseries.php                                  13-Apr-2024 02:05                3137
book.mysql-xdevapi.php                             13-Apr-2024 02:05               32770
book.mysql.php                                     13-Apr-2024 02:05                8351
book.mysqli.php                                    13-Apr-2024 02:05               19890
book.mysqlnd.php                                   13-Apr-2024 02:05                2454
book.network.php                                   13-Apr-2024 02:05                6462
book.oauth.php                                     13-Apr-2024 02:05                7770
book.oci8.php                                      13-Apr-2024 02:05               18537
book.opcache.php                                   13-Apr-2024 02:05                2798
book.openal.php                                    13-Apr-2024 02:05                4747
book.openssl.php                                   13-Apr-2024 02:05               11806
book.outcontrol.php                                13-Apr-2024 02:05                5474
book.parallel.php                                  13-Apr-2024 02:05                5662
book.parle.php                                     13-Apr-2024 02:05                9211
book.password.php                                  13-Apr-2024 02:05                2645
book.pcntl.php                                     13-Apr-2024 02:05                5393
book.pcre.php                                      13-Apr-2024 02:05                3813
book.pdo.php                                       13-Apr-2024 02:05                8454
book.pgsql.php                                     13-Apr-2024 02:05               13739
book.phar.php                                      13-Apr-2024 02:05               17978
book.phpdbg.php                                    13-Apr-2024 02:05                2990
book.posix.php                                     13-Apr-2024 02:05                7192
book.ps.php                                        13-Apr-2024 02:05               10105
book.pspell.php                                    13-Apr-2024 02:05                4641
book.pthreads.php                                  13-Apr-2024 02:05                5382
book.quickhash.php                                 13-Apr-2024 02:05                8829
book.radius.php                                    13-Apr-2024 02:05                5654
book.random.php                                    13-Apr-2024 02:05                9678
book.rar.php                                       13-Apr-2024 02:05                5786
book.readline.php                                  13-Apr-2024 02:05                3757
book.recode.php                                    13-Apr-2024 02:05                2299
book.reflection.php                                13-Apr-2024 02:05               41131
book.rnp.php                                       13-Apr-2024 02:05                5963
book.rpminfo.php                                   13-Apr-2024 02:05                2430
book.rrd.php                                       13-Apr-2024 02:05                5042
book.runkit7.php                                   13-Apr-2024 02:05                4160
book.scoutapm.php                                  13-Apr-2024 02:05                2156
book.seaslog.php                                   13-Apr-2024 02:05                5131
book.sem.php                                       13-Apr-2024 02:05                4371
book.session.php                                   13-Apr-2024 02:05                8684
book.shmop.php                                     13-Apr-2024 02:05                2862
book.simdjson.php                                  13-Apr-2024 02:05                2611
book.simplexml.php                                 13-Apr-2024 02:05                5628
book.snmp.php                                      13-Apr-2024 02:05                6398
book.soap.php                                      13-Apr-2024 02:05                6438
book.sockets.php                                   13-Apr-2024 02:05                7783
book.sodium.php                                    13-Apr-2024 02:05               19028
book.solr.php                                      13-Apr-2024 02:05               53932
book.spl.php                                       13-Apr-2024 02:05               10336
book.sqlite3.php                                   13-Apr-2024 02:05                7508
book.sqlsrv.php                                    13-Apr-2024 02:05                5276
book.ssdeep.php                                    13-Apr-2024 02:05                2258
book.ssh2.php                                      13-Apr-2024 02:05                6018
book.stats.php                                     13-Apr-2024 02:05               11729
book.stomp.php                                     13-Apr-2024 02:05                4083
book.stream.php                                    13-Apr-2024 02:05               13680
book.strings.php                                   13-Apr-2024 02:05               14273
book.svm.php                                       13-Apr-2024 02:05                3716
book.svn.php                                       13-Apr-2024 02:05                8375
book.swoole.php                                    13-Apr-2024 02:05               37265
book.sync.php                                      13-Apr-2024 02:05                4697
book.taint.php                                     13-Apr-2024 02:05                2497
book.tcpwrap.php                                   13-Apr-2024 02:05                2013
book.tidy.php                                      13-Apr-2024 02:05                7283
book.tokenizer.php                                 13-Apr-2024 02:05                3143
book.trader.php                                    13-Apr-2024 02:05               17429
book.ui.php                                        13-Apr-2024 02:05               27896
book.uodbc.php                                     13-Apr-2024 02:05                7601
book.uopz.php                                      13-Apr-2024 02:05                5170
book.url.php                                       13-Apr-2024 02:05                3141
book.v8js.php                                      13-Apr-2024 02:05                3082
book.var.php                                       13-Apr-2024 02:05                5831
book.var_representation.php                        13-Apr-2024 02:05                2090
book.varnish.php                                   13-Apr-2024 02:05                5764
book.wddx.php                                      13-Apr-2024 02:05                2826
book.win32service.php                              13-Apr-2024 02:05                5355
book.wincache.php                                  13-Apr-2024 02:05                6173
book.wkhtmltox.php                                 13-Apr-2024 02:05                3253
book.xattr.php                                     13-Apr-2024 02:05                2414
book.xdiff.php                                     13-Apr-2024 02:05                4431
book.xhprof.php                                    13-Apr-2024 02:05                2484
book.xlswriter.php                                 13-Apr-2024 02:05                4366
book.xml.php                                       13-Apr-2024 02:05                5690
book.xmldiff.php                                   13-Apr-2024 02:05                3063
book.xmlreader.php                                 13-Apr-2024 02:05                5204
book.xmlrpc.php                                    13-Apr-2024 02:05                3925
book.xmlwriter.php                                 13-Apr-2024 02:05                7122
book.xsl.php                                       13-Apr-2024 02:05                3895
book.yac.php                                       13-Apr-2024 02:05                2523
book.yaconf.php                                    13-Apr-2024 02:05                2087
book.yaf.php                                       13-Apr-2024 02:05               36984
book.yaml.php                                      13-Apr-2024 02:05                2815
book.yar.php                                       13-Apr-2024 02:05                3620
book.yaz.php                                       13-Apr-2024 02:05                4530
book.zip.php                                       13-Apr-2024 02:05               11581
book.zlib.php                                      13-Apr-2024 02:05                5626
book.zmq.php                                       13-Apr-2024 02:05                5460
book.zookeeper.php                                 13-Apr-2024 02:05                6593
bzip2.configuration.php                            13-Apr-2024 02:05                1176
bzip2.constants.php                                13-Apr-2024 02:05                1096
bzip2.examples.php                                 13-Apr-2024 02:05                4105
bzip2.installation.php                             13-Apr-2024 02:05                1428
bzip2.requirements.php                             13-Apr-2024 02:05                1419
bzip2.resources.php                                13-Apr-2024 02:05                1256
bzip2.setup.php                                    13-Apr-2024 02:05                1531
cachingiterator.construct.php                      13-Apr-2024 02:05                2862
cachingiterator.count.php                          13-Apr-2024 02:05                2520
cachingiterator.current.php                        13-Apr-2024 02:05                2814
cachingiterator.getcache.php                       13-Apr-2024 02:05                5817
cachingiterator.getflags.php                       13-Apr-2024 02:05                2567
cachingiterator.hasnext.php                        13-Apr-2024 02:05                2679
cachingiterator.key.php                            13-Apr-2024 02:05                2226
cachingiterator.next.php                           13-Apr-2024 02:05                2463
cachingiterator.offsetexists.php                   13-Apr-2024 02:05                3012
cachingiterator.offsetget.php                      13-Apr-2024 02:05                2702
cachingiterator.offsetset.php                      13-Apr-2024 02:05                3077
cachingiterator.offsetunset.php                    13-Apr-2024 02:05                2761
cachingiterator.rewind.php                         13-Apr-2024 02:05                2476
cachingiterator.setflags.php                       13-Apr-2024 02:05                2818
cachingiterator.tostring.php                       13-Apr-2024 02:05                2546
cachingiterator.valid.php                          13-Apr-2024 02:05                2735
calendar.configuration.php                         13-Apr-2024 02:05                1197
calendar.constants.php                             13-Apr-2024 02:05               13119
calendar.installation.php                          13-Apr-2024 02:05                1596
calendar.requirements.php                          13-Apr-2024 02:05                1171
calendar.resources.php                             13-Apr-2024 02:05                1172
calendar.setup.php                                 13-Apr-2024 02:05                1576
callbackfilteriterator.accept.php                  13-Apr-2024 02:05                3712
callbackfilteriterator.construct.php               13-Apr-2024 02:05                4089
cc.license.php                                     13-Apr-2024 02:05               20672
changelog.misc.php                                 13-Apr-2024 02:05                1277
changelog.mysql.php                                13-Apr-2024 02:05                2581
changelog.mysql_xdevapi.php                        13-Apr-2024 02:05                2353
changelog.mysqli.php                               13-Apr-2024 02:05                1315
changelog.strings.php                              13-Apr-2024 02:05                1324
class.addressinfo.php                              13-Apr-2024 02:05                1740
class.allowdynamicproperties.php                   13-Apr-2024 02:05                5195
class.apcuiterator.php                             13-Apr-2024 02:05                7668
class.appenditerator.php                           13-Apr-2024 02:05                7953
class.argumentcounterror.php                       13-Apr-2024 02:05                8643
class.arithmeticerror.php                          13-Apr-2024 02:05                8809
class.arrayaccess.php                              13-Apr-2024 02:05               11810
class.arrayiterator.php                            13-Apr-2024 02:05               17361
class.arrayobject.php                              13-Apr-2024 02:05               17150
class.assertionerror.php                           13-Apr-2024 02:05                8496
class.attribute.php                                13-Apr-2024 02:05                8824
class.backedenum.php                               13-Apr-2024 02:05                4524
class.badfunctioncallexception.php                 13-Apr-2024 02:05                8580
class.badmethodcallexception.php                   13-Apr-2024 02:05                8610
class.cachingiterator.php                          13-Apr-2024 02:05               17536
class.callbackfilteriterator.php                   13-Apr-2024 02:05               11775
class.closedgeneratorexception.php                 13-Apr-2024 02:05                8729
class.closure.php                                  13-Apr-2024 02:05                7222
class.collator.php                                 13-Apr-2024 02:05               37045
class.collectable.php                              13-Apr-2024 02:05                2514
class.com-exception.php                            13-Apr-2024 02:05                8376
class.com-safearray-proxy.php                      13-Apr-2024 02:05                1891
class.com.php                                      13-Apr-2024 02:05               12854
class.commonmark-cql.php                           13-Apr-2024 02:05                7296
class.commonmark-interfaces-ivisitable.php         13-Apr-2024 02:05                2939
class.commonmark-interfaces-ivisitor.php           13-Apr-2024 02:05                4534
class.commonmark-node-blockquote.php               13-Apr-2024 02:05                8413
class.commonmark-node-bulletlist.php               13-Apr-2024 02:05               10582
class.commonmark-node-code.php                     13-Apr-2024 02:05                9407
class.commonmark-node-codeblock.php                13-Apr-2024 02:05               10786
class.commonmark-node-customblock.php              13-Apr-2024 02:05                9166
class.commonmark-node-custominline.php             13-Apr-2024 02:05                9146
class.commonmark-node-document.php                 13-Apr-2024 02:05                8368
class.commonmark-node-heading.php                  13-Apr-2024 02:05                9763
class.commonmark-node-htmlblock.php                13-Apr-2024 02:05                9465
class.commonmark-node-htmlinline.php               13-Apr-2024 02:05                9441
class.commonmark-node-image.php                    13-Apr-2024 02:05               10671
class.commonmark-node-item.php                     13-Apr-2024 02:05                8380
class.commonmark-node-linebreak.php                13-Apr-2024 02:05                8394
class.commonmark-node-link.php                     13-Apr-2024 02:05               10664
class.commonmark-node-orderedlist.php              13-Apr-2024 02:05               11548
class.commonmark-node-paragraph.php                13-Apr-2024 02:05                8419
class.commonmark-node-softbreak.php                13-Apr-2024 02:05                8412
class.commonmark-node-text-emphasis.php            13-Apr-2024 02:05                8441
class.commonmark-node-text-strong.php              13-Apr-2024 02:05                8430
class.commonmark-node-text.php                     13-Apr-2024 02:05                9801
class.commonmark-node-thematicbreak.php            13-Apr-2024 02:05                8441
class.commonmark-node.php                          13-Apr-2024 02:05                9318
class.commonmark-parser.php                        13-Apr-2024 02:05                3796
class.compersisthelper.php                         13-Apr-2024 02:05                7704
class.compileerror.php                             13-Apr-2024 02:05                8429
class.componere-abstract-definition.php            13-Apr-2024 02:05                4708
class.componere-definition.php                     13-Apr-2024 02:05               10213
class.componere-method.php                         13-Apr-2024 02:05                4288
class.componere-patch.php                          13-Apr-2024 02:05                8308
class.componere-value.php                          13-Apr-2024 02:05                5391
class.countable.php                                13-Apr-2024 02:05                2612
class.curlfile.php                                 13-Apr-2024 02:05                8505
class.curlhandle.php                               13-Apr-2024 02:05                1746
class.curlmultihandle.php                          13-Apr-2024 02:05                1785
class.curlsharehandle.php                          13-Apr-2024 02:05                1781
class.curlstringfile.php                           13-Apr-2024 02:05                5787
class.dateerror.php                                13-Apr-2024 02:05                9205
class.dateexception.php                            13-Apr-2024 02:05                9701
class.dateinterval.php                             13-Apr-2024 02:05               14480
class.dateinvalidoperationexception.php            13-Apr-2024 02:05                9213
class.dateinvalidtimezoneexception.php             13-Apr-2024 02:05                8705
class.datemalformedintervalstringexception.php     13-Apr-2024 02:05                8801
class.datemalformedperiodstringexception.php       13-Apr-2024 02:05                8783
class.datemalformedstringexception.php             13-Apr-2024 02:05                9134
class.dateobjecterror.php                          13-Apr-2024 02:05                8958
class.dateperiod.php                               13-Apr-2024 02:05               22819
class.daterangeerror.php                           13-Apr-2024 02:05                9132
class.datetime.php                                 13-Apr-2024 02:05               23824
class.datetimeimmutable.php                        13-Apr-2024 02:05               23761
class.datetimeinterface.php                        13-Apr-2024 02:05               20388
class.datetimezone.php                             13-Apr-2024 02:05               15824
class.deflatecontext.php                           13-Apr-2024 02:05                1800
class.directory.php                                13-Apr-2024 02:05                5611
class.directoryiterator.php                        13-Apr-2024 02:05               20252
class.divisionbyzeroerror.php                      13-Apr-2024 02:05                8449
class.domainexception.php                          13-Apr-2024 02:05                8497
class.domattr.php                                  13-Apr-2024 02:05               28465
class.domcdatasection.php                          13-Apr-2024 02:05               32010
class.domcharacterdata.php                         13-Apr-2024 02:05               33503
class.domchildnode.php                             13-Apr-2024 02:05                4270
class.domcomment.php                               13-Apr-2024 02:05               30688
class.domdocument.php                              13-Apr-2024 02:05               69830
class.domdocumentfragment.php                      13-Apr-2024 02:05               29185
class.domdocumenttype.php                          13-Apr-2024 02:05               27112
class.domelement.php                               13-Apr-2024 02:05               53482
class.domentity.php                                13-Apr-2024 02:05               28224
class.domentityreference.php                       13-Apr-2024 02:05               23268
class.domexception.php                             13-Apr-2024 02:05                9336
class.domimplementation.php                        13-Apr-2024 02:05                6076
class.domnamednodemap.php                          13-Apr-2024 02:05                7594
class.domnamespacenode.php                         13-Apr-2024 02:05                9510
class.domnode.php                                  13-Apr-2024 02:05               32946
class.domnodelist.php                              13-Apr-2024 02:05                6113
class.domnotation.php                              13-Apr-2024 02:05               23531
class.domparentnode.php                            13-Apr-2024 02:05                3917
class.domprocessinginstruction.php                 13-Apr-2024 02:05               24807
class.domtext.php                                  13-Apr-2024 02:05               33781
class.domxpath.php                                 13-Apr-2024 02:05                8776
class.dotnet.php                                   13-Apr-2024 02:05                7590
class.ds-collection.php                            13-Apr-2024 02:05                5973
class.ds-deque.php                                 13-Apr-2024 02:05               22057
class.ds-hashable.php                              13-Apr-2024 02:05                4079
class.ds-map.php                                   13-Apr-2024 02:05               22997
class.ds-pair.php                                  13-Apr-2024 02:05                4540
class.ds-priorityqueue.php                         13-Apr-2024 02:05                8311
class.ds-queue.php                                 13-Apr-2024 02:05                7800
class.ds-sequence.php                              13-Apr-2024 02:05               23587
class.ds-set.php                                   13-Apr-2024 02:05               18528
class.ds-stack.php                                 13-Apr-2024 02:05                7138
class.ds-vector.php                                13-Apr-2024 02:05               21593
class.emptyiterator.php                            13-Apr-2024 02:05                4034
class.enchantbroker.php                            13-Apr-2024 02:05                1812
class.enchantdictionary.php                        13-Apr-2024 02:05                1802
class.error.php                                    13-Apr-2024 02:05               10919
class.errorexception.php                           13-Apr-2024 02:05               14570
class.ev.php                                       13-Apr-2024 02:05               45159
class.evcheck.php                                  13-Apr-2024 02:05               11365
class.evchild.php                                  13-Apr-2024 02:05               12895
class.evembed.php                                  13-Apr-2024 02:05               10103
class.event.php                                    13-Apr-2024 02:05               18423
class.eventbase.php                                13-Apr-2024 02:05               14846
class.eventbuffer.php                              13-Apr-2024 02:05               23337
class.eventbufferevent.php                         13-Apr-2024 02:05               37839
class.eventconfig.php                              13-Apr-2024 02:05                7781
class.eventdnsbase.php                             13-Apr-2024 02:05               14216
class.eventexception.php                           13-Apr-2024 02:05                8503
class.eventhttp.php                                13-Apr-2024 02:05                9654
class.eventhttpconnection.php                      13-Apr-2024 02:05               10470
class.eventhttprequest.php                         13-Apr-2024 02:05               22802
class.eventlistener.php                            13-Apr-2024 02:05               12743
class.eventsslcontext.php                          13-Apr-2024 02:05               19108
class.eventutil.php                                13-Apr-2024 02:05               25501
class.evfork.php                                   13-Apr-2024 02:05                9156
class.evidle.php                                   13-Apr-2024 02:05                9798
class.evio.php                                     13-Apr-2024 02:05               12593
class.evloop.php                                   13-Apr-2024 02:05               31484
class.evperiodic.php                               13-Apr-2024 02:05               14908
class.evprepare.php                                13-Apr-2024 02:05               11507
class.evsignal.php                                 13-Apr-2024 02:05               11897
class.evstat.php                                   13-Apr-2024 02:05               14373
class.evtimer.php                                  13-Apr-2024 02:05               14286
class.evwatcher.php                                13-Apr-2024 02:05                9945
class.exception.php                                13-Apr-2024 02:05               11022
class.fannconnection.php                           13-Apr-2024 02:05                6516
class.ffi-cdata.php                                13-Apr-2024 02:05                6120
class.ffi-ctype.php                                13-Apr-2024 02:05               31199
class.ffi-exception.php                            13-Apr-2024 02:05                8189
class.ffi-parserexception.php                      13-Apr-2024 02:05                8244
class.ffi.php                                      13-Apr-2024 02:05               18331
class.fiber.php                                    13-Apr-2024 02:05                7967
class.fibererror.php                               13-Apr-2024 02:05                8161
class.filesystemiterator.php                       13-Apr-2024 02:05               32124
class.filteriterator.php                           13-Apr-2024 02:05                7490
class.finfo.php                                    13-Apr-2024 02:05                6272
class.ftp-connection.php                           13-Apr-2024 02:05                1780
class.gdfont.php                                   13-Apr-2024 02:05                1698
class.gdimage.php                                  13-Apr-2024 02:05                1695
class.gearmanclient.php                            13-Apr-2024 02:05               37730
class.gearmanexception.php                         13-Apr-2024 02:05                7193
class.gearmanjob.php                               13-Apr-2024 02:05                9192
class.gearmantask.php                              13-Apr-2024 02:05                8835
class.gearmanworker.php                            13-Apr-2024 02:05               13406
class.gender.php                                   13-Apr-2024 02:05               42226
class.generator.php                                13-Apr-2024 02:05                6652
class.globiterator.php                             13-Apr-2024 02:05               26515
class.gmagick.php                                  13-Apr-2024 02:05               88692
class.gmagickdraw.php                              13-Apr-2024 02:05               24772
class.gmagickpixel.php                             13-Apr-2024 02:05                5898
class.gmp.php                                      13-Apr-2024 02:05                4295
class.hashcontext.php                              13-Apr-2024 02:05                3359
class.hrtime-performancecounter.php                13-Apr-2024 02:05                3790
class.hrtime-stopwatch.php                         13-Apr-2024 02:05                7012
class.hrtime-unit.php                              13-Apr-2024 02:05                4369
class.imagick.php                                  13-Apr-2024 02:05              290496
class.imagickdraw.php                              13-Apr-2024 02:05               84170
class.imagickkernel.php                            13-Apr-2024 02:05                6502
class.imagickpixel.php                             13-Apr-2024 02:05               13970
class.imagickpixeliterator.php                     13-Apr-2024 02:05                9691
class.imap-connection.php                          13-Apr-2024 02:05                1785
class.infiniteiterator.php                         13-Apr-2024 02:05                5325
class.inflatecontext.php                           13-Apr-2024 02:05                1768
class.internaliterator.php                         13-Apr-2024 02:05                4806
class.intlbreakiterator.php                        13-Apr-2024 02:05               31165
class.intlcalendar.php                             13-Apr-2024 02:05               73837
class.intlchar.php                                 13-Apr-2024 02:05              474585
class.intlcodepointbreakiterator.php               13-Apr-2024 02:05               21567
class.intldateformatter.php                        13-Apr-2024 02:05               33187
class.intldatepatterngenerator.php                 13-Apr-2024 02:05                4772
class.intlexception.php                            13-Apr-2024 02:05                8659
class.intlgregoriancalendar.php                    13-Apr-2024 02:05               53053
class.intliterator.php                             13-Apr-2024 02:05                5298
class.intlpartsiterator.php                        13-Apr-2024 02:05                7214
class.intlrulebasedbreakiterator.php               13-Apr-2024 02:05               24612
class.intltimezone.php                             13-Apr-2024 02:05               28904
class.invalidargumentexception.php                 13-Apr-2024 02:05                8535
class.iterator.php                                 13-Apr-2024 02:05               11548
class.iteratoraggregate.php                        13-Apr-2024 02:05                6224
class.iteratoriterator.php                         13-Apr-2024 02:05                6538
class.jsonexception.php                            13-Apr-2024 02:05                9034
class.jsonserializable.php                         13-Apr-2024 02:05                2831
class.ldap-connection.php                          13-Apr-2024 02:05                1799
class.ldap-result-entry.php                        13-Apr-2024 02:05                1818
class.ldap-result.php                              13-Apr-2024 02:05                1792
class.lengthexception.php                          13-Apr-2024 02:05                8445
class.libxmlerror.php                              13-Apr-2024 02:05                5820
class.limititerator.php                            13-Apr-2024 02:05               11449
class.locale.php                                   13-Apr-2024 02:05               29222
class.logicexception.php                           13-Apr-2024 02:05                8531
class.lua.php                                      13-Apr-2024 02:05                7755
class.luaclosure.php                               13-Apr-2024 02:05                2682
class.luasandbox.php                               13-Apr-2024 02:05               14108
class.luasandboxerror.php                          13-Apr-2024 02:05               10059
class.luasandboxerrorerror.php                     13-Apr-2024 02:05                7602
class.luasandboxfatalerror.php                     13-Apr-2024 02:05                7724
class.luasandboxfunction.php                       13-Apr-2024 02:05                3899
class.luasandboxmemoryerror.php                    13-Apr-2024 02:05                7909
class.luasandboxruntimeerror.php                   13-Apr-2024 02:05                7744
class.luasandboxsyntaxerror.php                    13-Apr-2024 02:05                7606
class.luasandboxtimeouterror.php                   13-Apr-2024 02:05                7897
class.memcache.php                                 13-Apr-2024 02:05               19418
class.memcached.php                                13-Apr-2024 02:05               48415
class.memcachedexception.php                       13-Apr-2024 02:05                7485
class.messageformatter.php                         13-Apr-2024 02:05               12782
class.mongodb-bson-binary.php                      13-Apr-2024 02:05               16857
class.mongodb-bson-binaryinterface.php             13-Apr-2024 02:05                4690
class.mongodb-bson-dbpointer.php                   13-Apr-2024 02:05                6011
class.mongodb-bson-decimal128.php                  13-Apr-2024 02:05                7792
class.mongodb-bson-decimal128interface.php         13-Apr-2024 02:05                3817
class.mongodb-bson-document.php                    13-Apr-2024 02:05               11286
class.mongodb-bson-int64.php                       13-Apr-2024 02:05                7481
class.mongodb-bson-iterator.php                    13-Apr-2024 02:05                4964
class.mongodb-bson-javascript.php                  13-Apr-2024 02:05                8740
class.mongodb-bson-javascriptinterface.php         13-Apr-2024 02:05                4920
class.mongodb-bson-maxkey.php                      13-Apr-2024 02:05                5839
class.mongodb-bson-maxkeyinterface.php             13-Apr-2024 02:05                2184
class.mongodb-bson-minkey.php                      13-Apr-2024 02:05                5830
class.mongodb-bson-minkeyinterface.php             13-Apr-2024 02:05                2165
class.mongodb-bson-objectid.php                    13-Apr-2024 02:05                9202
class.mongodb-bson-objectidinterface.php           13-Apr-2024 02:05                4307
class.mongodb-bson-packedarray.php                 13-Apr-2024 02:05                9072
class.mongodb-bson-persistable.php                 13-Apr-2024 02:05                6139
class.mongodb-bson-regex.php                       13-Apr-2024 02:05                8171
class.mongodb-bson-regexinterface.php              13-Apr-2024 02:05                4709
class.mongodb-bson-serializable.php                13-Apr-2024 02:05                4219
class.mongodb-bson-symbol.php                      13-Apr-2024 02:05                5899
class.mongodb-bson-timestamp.php                   13-Apr-2024 02:05                8418
class.mongodb-bson-timestampinterface.php          13-Apr-2024 02:05                4867
class.mongodb-bson-type.php                        13-Apr-2024 02:05                2025
class.mongodb-bson-undefined.php                   13-Apr-2024 02:05                5987
class.mongodb-bson-unserializable.php              13-Apr-2024 02:05                3962
class.mongodb-bson-utcdatetime.php                 13-Apr-2024 02:05                8021
class.mongodb-bson-utcdatetimeinterface.php        13-Apr-2024 02:05                4380
class.mongodb-driver-bulkwrite.php                 13-Apr-2024 02:05               24098
class.mongodb-driver-clientencryption.php          13-Apr-2024 02:05               23424
class.mongodb-driver-command.php                   13-Apr-2024 02:05               14207
class.mongodb-driver-cursor.php                    13-Apr-2024 02:05               25790
class.mongodb-driver-cursorid.php                  13-Apr-2024 02:05                5530
class.mongodb-driver-cursorinterface.php           13-Apr-2024 02:05                6168
class.mongodb-driver-exception-authenticationex..> 13-Apr-2024 02:05                9156
class.mongodb-driver-exception-bulkwriteexcepti..> 13-Apr-2024 02:05               10010
class.mongodb-driver-exception-commandexception..> 13-Apr-2024 02:05               10915
class.mongodb-driver-exception-connectionexcept..> 13-Apr-2024 02:05                9225
class.mongodb-driver-exception-connectiontimeou..> 13-Apr-2024 02:05                9613
class.mongodb-driver-exception-encryptionexcept..> 13-Apr-2024 02:05                9159
class.mongodb-driver-exception-exception.php       13-Apr-2024 02:05                2179
class.mongodb-driver-exception-executiontimeout..> 13-Apr-2024 02:05               10269
class.mongodb-driver-exception-invalidargumente..> 13-Apr-2024 02:05                8185
class.mongodb-driver-exception-logicexception.php  13-Apr-2024 02:05                8069
class.mongodb-driver-exception-runtimeexception..> 13-Apr-2024 02:05               11669
class.mongodb-driver-exception-serverexception.php 13-Apr-2024 02:05                9236
class.mongodb-driver-exception-sslconnectionexc..> 13-Apr-2024 02:05                9502
class.mongodb-driver-exception-unexpectedvaluee..> 13-Apr-2024 02:05                8202
class.mongodb-driver-exception-writeexception.php  13-Apr-2024 02:05               12187
class.mongodb-driver-manager.php                   13-Apr-2024 02:05               21799
class.mongodb-driver-monitoring-commandfailedev..> 13-Apr-2024 02:05                8037
class.mongodb-driver-monitoring-commandstartede..> 13-Apr-2024 02:05                7541
class.mongodb-driver-monitoring-commandsubscrib..> 13-Apr-2024 02:05                6268
class.mongodb-driver-monitoring-commandsucceede..> 13-Apr-2024 02:05                7619
class.mongodb-driver-monitoring-logsubscriber.php  13-Apr-2024 02:05               10106
class.mongodb-driver-monitoring-sdamsubscriber.php 13-Apr-2024 02:05               11618
class.mongodb-driver-monitoring-serverchangedev..> 13-Apr-2024 02:05                5731
class.mongodb-driver-monitoring-serverclosedeve..> 13-Apr-2024 02:05                4378
class.mongodb-driver-monitoring-serverheartbeat..> 13-Apr-2024 02:05                5729
class.mongodb-driver-monitoring-serverheartbeat..> 13-Apr-2024 02:05                4556
class.mongodb-driver-monitoring-serverheartbeat..> 13-Apr-2024 02:05                5801
class.mongodb-driver-monitoring-serveropeningev..> 13-Apr-2024 02:05                4398
class.mongodb-driver-monitoring-subscriber.php     13-Apr-2024 02:05                2640
class.mongodb-driver-monitoring-topologychanged..> 13-Apr-2024 02:05                4726
class.mongodb-driver-monitoring-topologyclosede..> 13-Apr-2024 02:05                3337
class.mongodb-driver-monitoring-topologyopening..> 13-Apr-2024 02:05                3351
class.mongodb-driver-query.php                     13-Apr-2024 02:05                3410
class.mongodb-driver-readconcern.php               13-Apr-2024 02:05               17678
class.mongodb-driver-readpreference.php            13-Apr-2024 02:05               21888
class.mongodb-driver-server.php                    13-Apr-2024 02:05               27158
class.mongodb-driver-serverapi.php                 13-Apr-2024 02:05               14069
class.mongodb-driver-serverdescription.php         13-Apr-2024 02:05               16857
class.mongodb-driver-session.php                   13-Apr-2024 02:05               15516
class.mongodb-driver-topologydescription.php       13-Apr-2024 02:05               11621
class.mongodb-driver-writeconcern.php              13-Apr-2024 02:05               10273
class.mongodb-driver-writeconcernerror.php         13-Apr-2024 02:05                4369
class.mongodb-driver-writeerror.php                13-Apr-2024 02:05                4693
class.mongodb-driver-writeresult.php               13-Apr-2024 02:05                8671
class.multipleiterator.php                         13-Apr-2024 02:05               11959
class.mysql-xdevapi-baseresult.php                 13-Apr-2024 02:05                3062
class.mysql-xdevapi-client.php                     13-Apr-2024 02:05                3234
class.mysql-xdevapi-collection.php                 13-Apr-2024 02:05               11216
class.mysql-xdevapi-collectionadd.php              13-Apr-2024 02:05                2969
class.mysql-xdevapi-collectionfind.php             13-Apr-2024 02:05                9010
class.mysql-xdevapi-collectionmodify.php           13-Apr-2024 02:05               10505
class.mysql-xdevapi-collectionremove.php           13-Apr-2024 02:05                5282
class.mysql-xdevapi-columnresult.php               13-Apr-2024 02:05                7017
class.mysql-xdevapi-crudoperationbindable.php      13-Apr-2024 02:05                3013
class.mysql-xdevapi-crudoperationlimitable.php     13-Apr-2024 02:05                2998
class.mysql-xdevapi-crudoperationskippable.php     13-Apr-2024 02:05                3006
class.mysql-xdevapi-crudoperationsortable.php      13-Apr-2024 02:05                2992
class.mysql-xdevapi-databaseobject.php             13-Apr-2024 02:05                3647
class.mysql-xdevapi-docresult.php                  13-Apr-2024 02:05                4123
class.mysql-xdevapi-exception.php                  13-Apr-2024 02:05                2199
class.mysql-xdevapi-executable.php                 13-Apr-2024 02:05                2648
class.mysql-xdevapi-executionstatus.php            13-Apr-2024 02:05                4875
class.mysql-xdevapi-expression.php                 13-Apr-2024 02:05                3268
class.mysql-xdevapi-result.php                     13-Apr-2024 02:05                4543
class.mysql-xdevapi-rowresult.php                  13-Apr-2024 02:05                5295
class.mysql-xdevapi-schema.php                     13-Apr-2024 02:05                7961
class.mysql-xdevapi-schemaobject.php               13-Apr-2024 02:05                2836
class.mysql-xdevapi-session.php                    13-Apr-2024 02:05               10126
class.mysql-xdevapi-sqlstatement.php               13-Apr-2024 02:05                6758
class.mysql-xdevapi-sqlstatementresult.php         13-Apr-2024 02:05                7557
class.mysql-xdevapi-statement.php                  13-Apr-2024 02:05                5071
class.mysql-xdevapi-table.php                      13-Apr-2024 02:05                7714
class.mysql-xdevapi-tabledelete.php                13-Apr-2024 02:05                5326
class.mysql-xdevapi-tableinsert.php                13-Apr-2024 02:05                3591
class.mysql-xdevapi-tableselect.php                13-Apr-2024 02:05                8555
class.mysql-xdevapi-tableupdate.php                13-Apr-2024 02:05                6271
class.mysql-xdevapi-warning.php                    13-Apr-2024 02:05                3765
class.mysqli-driver.php                            13-Apr-2024 02:05                8450
class.mysqli-result.php                            13-Apr-2024 02:05               16495
class.mysqli-sql-exception.php                     13-Apr-2024 02:05               10069
class.mysqli-stmt.php                              13-Apr-2024 02:05               19401
class.mysqli-warning.php                           13-Apr-2024 02:05                4442
class.mysqli.php                                   13-Apr-2024 02:05               45710
class.norewinditerator.php                         13-Apr-2024 02:05                6856
class.normalizer.php                               13-Apr-2024 02:05               13747
class.numberformatter.php                          13-Apr-2024 02:05               75835
class.oauth.php                                    13-Apr-2024 02:05               20145
class.oauthexception.php                           13-Apr-2024 02:05                8609
class.oauthprovider.php                            13-Apr-2024 02:05               13268
class.ocicollection.php                            13-Apr-2024 02:05                7226
class.ocilob.php                                   13-Apr-2024 02:05               15914
class.opensslasymmetrickey.php                     13-Apr-2024 02:05                1889
class.opensslcertificate.php                       13-Apr-2024 02:05                1879
class.opensslcertificatesigningrequest.php         13-Apr-2024 02:05                1966
class.outeriterator.php                            13-Apr-2024 02:05                4393
class.outofboundsexception.php                     13-Apr-2024 02:05                8574
class.outofrangeexception.php                      13-Apr-2024 02:05                8576
class.overflowexception.php                        13-Apr-2024 02:05                8503
class.override.php                                 13-Apr-2024 02:05                4082
class.parallel-channel.php                         13-Apr-2024 02:05                8185
class.parallel-events-event-type.php               13-Apr-2024 02:05                3355
class.parallel-events-event.php                    13-Apr-2024 02:05                3508
class.parallel-events-input.php                    13-Apr-2024 02:05                4733
class.parallel-events.php                          13-Apr-2024 02:05                7105
class.parallel-future.php                          13-Apr-2024 02:05                7798
class.parallel-runtime.php                         13-Apr-2024 02:05                6382
class.parallel-sync.php                            13-Apr-2024 02:05                5206
class.parentiterator.php                           13-Apr-2024 02:05                9740
class.parle-errorinfo.php                          13-Apr-2024 02:05                3855
class.parle-lexer.php                              13-Apr-2024 02:05               13172
class.parle-lexerexception.php                     13-Apr-2024 02:05                7743
class.parle-parser.php                             13-Apr-2024 02:05               18100
class.parle-parserexception.php                    13-Apr-2024 02:05                7725
class.parle-rlexer.php                             13-Apr-2024 02:05               15407
class.parle-rparser.php                            13-Apr-2024 02:05               18273
class.parle-stack.php                              13-Apr-2024 02:05                4812
class.parle-token.php                              13-Apr-2024 02:05                4913
class.parseerror.php                               13-Apr-2024 02:05                9029
class.pdo.php                                      13-Apr-2024 02:05               42909
class.pdoexception.php                             13-Apr-2024 02:05               10502
class.pdorow.php                                   13-Apr-2024 02:05                4566
class.pdostatement.php                             13-Apr-2024 02:05               23383
class.pgsql-connection.php                         13-Apr-2024 02:05                1822
class.pgsql-lob.php                                13-Apr-2024 02:05                1763
class.pgsql-result.php                             13-Apr-2024 02:05                1795
class.phar.php                                     13-Apr-2024 02:05               75503
class.phardata.php                                 13-Apr-2024 02:05               50317
class.pharexception.php                            13-Apr-2024 02:05                8457
class.pharfileinfo.php                             13-Apr-2024 02:05               22034
class.php-user-filter.php                          13-Apr-2024 02:05                6592
class.phptoken.php                                 13-Apr-2024 02:05                9139
class.pool.php                                     13-Apr-2024 02:05                7698
class.pspell-config.php                            13-Apr-2024 02:05                1794
class.pspell-dictionary.php                        13-Apr-2024 02:05                1831
class.quickhashinthash.php                         13-Apr-2024 02:05               15073
class.quickhashintset.php                          13-Apr-2024 02:05               12846
class.quickhashintstringhash.php                   13-Apr-2024 02:05               15969
class.quickhashstringinthash.php                   13-Apr-2024 02:05               13638
class.random-brokenrandomengineerror.php           13-Apr-2024 02:05                8607
class.random-cryptosafeengine.php                  13-Apr-2024 02:05                2529
class.random-engine-mt19937.php                    13-Apr-2024 02:05                5465
class.random-engine-pcgoneseq128xslrr64.php        13-Apr-2024 02:05                6341
class.random-engine-secure.php                     13-Apr-2024 02:05                3594
class.random-engine-xoshiro256starstar.php         13-Apr-2024 02:05                6507
class.random-engine.php                            13-Apr-2024 02:05                4308
class.random-randomerror.php                       13-Apr-2024 02:05                8483
class.random-randomexception.php                   13-Apr-2024 02:05                8597
class.random-randomizer.php                        13-Apr-2024 02:05               10848
class.rangeexception.php                           13-Apr-2024 02:05                8767
class.rararchive.php                               13-Apr-2024 02:05                8138
class.rarentry.php                                 13-Apr-2024 02:05               50091
class.rarexception.php                             13-Apr-2024 02:05                8510
class.recursivearrayiterator.php                   13-Apr-2024 02:05               16079
class.recursivecachingiterator.php                 13-Apr-2024 02:05               14142
class.recursivecallbackfilteriterator.php          13-Apr-2024 02:05               13609
class.recursivedirectoryiterator.php               13-Apr-2024 02:05               30016
class.recursivefilteriterator.php                  13-Apr-2024 02:05                8329
class.recursiveiterator.php                        13-Apr-2024 02:05                4958
class.recursiveiteratoriterator.php                13-Apr-2024 02:05               14872
class.recursiveregexiterator.php                   13-Apr-2024 02:05               14817
class.recursivetreeiterator.php                    13-Apr-2024 02:05               25845
class.reflection.php                               13-Apr-2024 02:05                3472
class.reflectionattribute.php                      13-Apr-2024 02:05                6615
class.reflectionclass.php                          13-Apr-2024 02:05               38809
class.reflectionclassconstant.php                  13-Apr-2024 02:05               16867
class.reflectionenum.php                           13-Apr-2024 02:05               31592
class.reflectionenumbackedcase.php                 13-Apr-2024 02:05               13036
class.reflectionenumunitcase.php                   13-Apr-2024 02:05               12711
class.reflectionexception.php                      13-Apr-2024 02:05                8415
class.reflectionextension.php                      13-Apr-2024 02:05               10945
class.reflectionfiber.php                          13-Apr-2024 02:05                5063
class.reflectionfunction.php                       13-Apr-2024 02:05               21389
class.reflectionfunctionabstract.php               13-Apr-2024 02:05               20425
class.reflectiongenerator.php                      13-Apr-2024 02:05                6526
class.reflectionintersectiontype.php               13-Apr-2024 02:05                3427
class.reflectionmethod.php                         13-Apr-2024 02:05               33599
class.reflectionnamedtype.php                      13-Apr-2024 02:05                3764
class.reflectionobject.php                         13-Apr-2024 02:05               29259
class.reflectionparameter.php                      13-Apr-2024 02:05               17045
class.reflectionproperty.php                       13-Apr-2024 02:05               23120
class.reflectionreference.php                      13-Apr-2024 02:05                4215
class.reflectiontype.php                           13-Apr-2024 02:05                4618
class.reflectionuniontype.php                      13-Apr-2024 02:05                3315
class.reflectionzendextension.php                  13-Apr-2024 02:05                8053
class.reflector.php                                13-Apr-2024 02:05                4106
class.regexiterator.php                            13-Apr-2024 02:05               17975
class.resourcebundle.php                           13-Apr-2024 02:05               11260
class.returntypewillchange.php                     13-Apr-2024 02:05                3295
class.rnpffi.php                                   13-Apr-2024 02:05                1628
class.rrdcreator.php                               13-Apr-2024 02:05                4479
class.rrdgraph.php                                 13-Apr-2024 02:05                3926
class.rrdupdater.php                               13-Apr-2024 02:05                3296
class.runtimeexception.php                         13-Apr-2024 02:05                8452
class.seaslog.php                                  13-Apr-2024 02:05               21925
class.seekableiterator.php                         13-Apr-2024 02:05               11380
class.sensitiveparameter.php                       13-Apr-2024 02:05                6421
class.sensitiveparametervalue.php                  13-Apr-2024 02:05                5075
class.serializable.php                             13-Apr-2024 02:05                8405
class.sessionhandler.php                           13-Apr-2024 02:05               26438
class.sessionhandlerinterface.php                  13-Apr-2024 02:05               16133
class.sessionidinterface.php                       13-Apr-2024 02:05                3329
class.sessionupdatetimestamphandlerinterface.php   13-Apr-2024 02:05                4593
class.shmop.php                                    13-Apr-2024 02:05                1696
class.simdjsonexception.php                        13-Apr-2024 02:05                5009
class.simdjsonvalueerror.php                       13-Apr-2024 02:05                8323
class.simplexmlelement.php                         13-Apr-2024 02:05               18811
class.simplexmliterator.php                        13-Apr-2024 02:05               16706
class.snmp.php                                     13-Apr-2024 02:05               29235
class.snmpexception.php                            13-Apr-2024 02:05                9127
class.soapclient.php                               13-Apr-2024 02:05               34463
class.soapfault.php                                13-Apr-2024 02:05               14327
class.soapheader.php                               13-Apr-2024 02:05                6044
class.soapparam.php                                13-Apr-2024 02:05                3729
class.soapserver.php                               13-Apr-2024 02:05               10125
class.soapvar.php                                  13-Apr-2024 02:05                7857
class.socket.php                                   13-Apr-2024 02:05                1763
class.sodiumexception.php                          13-Apr-2024 02:05                8395
class.solrclient.php                               13-Apr-2024 02:05               24710
class.solrclientexception.php                      13-Apr-2024 02:05                9688
class.solrcollapsefunction.php                     13-Apr-2024 02:05               11743
class.solrdismaxquery.php                          13-Apr-2024 02:05              111859
class.solrdocument.php                             13-Apr-2024 02:05               23567
class.solrdocumentfield.php                        13-Apr-2024 02:05                4678
class.solrexception.php                            13-Apr-2024 02:05               10157
class.solrgenericresponse.php                      13-Apr-2024 02:05               12729
class.solrillegalargumentexception.php             13-Apr-2024 02:05                9844
class.solrillegaloperationexception.php            13-Apr-2024 02:05                9911
class.solrinputdocument.php                        13-Apr-2024 02:05               19592
class.solrmissingmandatoryparameterexception.php   13-Apr-2024 02:05                8977
class.solrmodifiableparams.php                     13-Apr-2024 02:05                8983
class.solrobject.php                               13-Apr-2024 02:05                5975
class.solrparams.php                               13-Apr-2024 02:05                9279
class.solrpingresponse.php                         13-Apr-2024 02:05               11368
class.solrquery.php                                13-Apr-2024 02:05              118987
class.solrqueryresponse.php                        13-Apr-2024 02:05               12663
class.solrresponse.php                             13-Apr-2024 02:05               14661
class.solrserverexception.php                      13-Apr-2024 02:05                9728
class.solrupdateresponse.php                       13-Apr-2024 02:05               12703
class.solrutils.php                                13-Apr-2024 02:05                5017
class.spldoublylinkedlist.php                      13-Apr-2024 02:05               17758
class.splfileinfo.php                              13-Apr-2024 02:05               18639
class.splfileobject.php                            13-Apr-2024 02:05               38014
class.splfixedarray.php                            13-Apr-2024 02:05               20251
class.splheap.php                                  13-Apr-2024 02:05                7805
class.splmaxheap.php                               13-Apr-2024 02:05                7152
class.splminheap.php                               13-Apr-2024 02:05                7162
class.splobjectstorage.php                         13-Apr-2024 02:05               21657
class.splobserver.php                              13-Apr-2024 02:05                2875
class.splpriorityqueue.php                         13-Apr-2024 02:05               11934
class.splqueue.php                                 13-Apr-2024 02:05               17201
class.splstack.php                                 13-Apr-2024 02:05               14399
class.splsubject.php                               13-Apr-2024 02:05                3771
class.spltempfileobject.php                        13-Apr-2024 02:05               31841
class.spoofchecker.php                             13-Apr-2024 02:05               17969
class.sqlite3.php                                  13-Apr-2024 02:05               40007
class.sqlite3exception.php                         13-Apr-2024 02:05                8371
class.sqlite3result.php                            13-Apr-2024 02:05                5830
class.sqlite3stmt.php                              13-Apr-2024 02:05                8476
class.stdclass.php                                 13-Apr-2024 02:05                7037
class.stomp.php                                    13-Apr-2024 02:05               21631
class.stompexception.php                           13-Apr-2024 02:05                5831
class.stompframe.php                               13-Apr-2024 02:05                4322
class.streamwrapper.php                            13-Apr-2024 02:05               21043
class.stringable.php                               13-Apr-2024 02:05                8604
class.svm.php                                      13-Apr-2024 02:05               18426
class.svmmodel.php                                 13-Apr-2024 02:05                6988
class.swoole-async.php                             13-Apr-2024 02:05                7979
class.swoole-atomic.php                            13-Apr-2024 02:05                5008
class.swoole-buffer.php                            13-Apr-2024 02:05                7463
class.swoole-channel.php                           13-Apr-2024 02:05                3906
class.swoole-client.php                            13-Apr-2024 02:05               16475
class.swoole-connection-iterator.php               13-Apr-2024 02:05                7459
class.swoole-coroutine.php                         13-Apr-2024 02:05               18595
class.swoole-event.php                             13-Apr-2024 02:05                7402
class.swoole-exception.php                         13-Apr-2024 02:05                4524
class.swoole-http-client.php                       13-Apr-2024 02:05               14730
class.swoole-http-request.php                      13-Apr-2024 02:05                2971
class.swoole-http-response.php                     13-Apr-2024 02:05               10847
class.swoole-http-server.php                       13-Apr-2024 02:05               26381
class.swoole-lock.php                              13-Apr-2024 02:05                4616
class.swoole-mmap.php                              13-Apr-2024 02:05                3017
class.swoole-mysql-exception.php                   13-Apr-2024 02:05                4565
class.swoole-mysql.php                             13-Apr-2024 02:05                5355
class.swoole-process.php                           13-Apr-2024 02:05               13599
class.swoole-redis-server.php                      13-Apr-2024 02:05               32008
class.swoole-serialize.php                         13-Apr-2024 02:05                3549
class.swoole-server.php                            13-Apr-2024 02:05               29514
class.swoole-table.php                             13-Apr-2024 02:05               12657
class.swoole-timer.php                             13-Apr-2024 02:05                4937
class.swoole-websocket-frame.php                   13-Apr-2024 02:05                1897
class.swoole-websocket-server.php                  13-Apr-2024 02:05                7774
class.syncevent.php                                13-Apr-2024 02:05                4835
class.syncmutex.php                                13-Apr-2024 02:05                4154
class.syncreaderwriter.php                         13-Apr-2024 02:05                5144
class.syncsemaphore.php                            13-Apr-2024 02:05                4592
class.syncsharedmemory.php                         13-Apr-2024 02:05                5442
class.sysvmessagequeue.php                         13-Apr-2024 02:05                1813
class.sysvsemaphore.php                            13-Apr-2024 02:05                1799
class.sysvsharedmemory.php                         13-Apr-2024 02:05                1804
class.thread.php                                   13-Apr-2024 02:05               11502
class.threaded.php                                 13-Apr-2024 02:05                8776
class.throwable.php                                13-Apr-2024 02:05                7464
class.tidy.php                                     13-Apr-2024 02:05               19274
class.tidynode.php                                 13-Apr-2024 02:05               11869
class.transliterator.php                           13-Apr-2024 02:05               10330
class.traversable.php                              13-Apr-2024 02:05                4783
class.typeerror.php                                13-Apr-2024 02:05                9586
class.uconverter.php                               13-Apr-2024 02:05               41327
class.ui-area.php                                  13-Apr-2024 02:05               12189
class.ui-control.php                               13-Apr-2024 02:05                5414
class.ui-controls-box.php                          13-Apr-2024 02:05               10064
class.ui-controls-button.php                       13-Apr-2024 02:05                6622
class.ui-controls-check.php                        13-Apr-2024 02:05                7466
class.ui-controls-colorbutton.php                  13-Apr-2024 02:05                6501
class.ui-controls-combo.php                        13-Apr-2024 02:05                6590
class.ui-controls-editablecombo.php                13-Apr-2024 02:05                6702
class.ui-controls-entry.php                        13-Apr-2024 02:05                9579
class.ui-controls-form.php                         13-Apr-2024 02:05                7998
class.ui-controls-grid.php                         13-Apr-2024 02:05               13095
class.ui-controls-group.php                        13-Apr-2024 02:05                8306
class.ui-controls-label.php                        13-Apr-2024 02:05                6373
class.ui-controls-multilineentry.php               13-Apr-2024 02:05                9822
class.ui-controls-picker.php                       13-Apr-2024 02:05                7505
class.ui-controls-progress.php                     13-Apr-2024 02:05                5874
class.ui-controls-radio.php                        13-Apr-2024 02:05                6569
class.ui-controls-separator.php                    13-Apr-2024 02:05                7009
class.ui-controls-slider.php                       13-Apr-2024 02:05                6957
class.ui-controls-spin.php                         13-Apr-2024 02:05                6827
class.ui-controls-tab.php                          13-Apr-2024 02:05                9104
class.ui-draw-brush-gradient.php                   13-Apr-2024 02:05                7282
class.ui-draw-brush-lineargradient.php             13-Apr-2024 02:05                6530
class.ui-draw-brush-radialgradient.php             13-Apr-2024 02:05                6716
class.ui-draw-brush.php                            13-Apr-2024 02:05                4374
class.ui-draw-color.php                            13-Apr-2024 02:05                8525
class.ui-draw-line-cap.php                         13-Apr-2024 02:05                3678
class.ui-draw-line-join.php                        13-Apr-2024 02:05                3662
class.ui-draw-matrix.php                           13-Apr-2024 02:05                5564
class.ui-draw-path.php                             13-Apr-2024 02:05               10695
class.ui-draw-pen.php                              13-Apr-2024 02:05                8071
class.ui-draw-stroke.php                           13-Apr-2024 02:05                6822
class.ui-draw-text-font-descriptor.php             13-Apr-2024 02:05                5984
class.ui-draw-text-font-italic.php                 13-Apr-2024 02:05                4037
class.ui-draw-text-font-stretch.php                13-Apr-2024 02:05                8233
class.ui-draw-text-font-weight.php                 13-Apr-2024 02:05                8835
class.ui-draw-text-font.php                        13-Apr-2024 02:05                4813
class.ui-draw-text-layout.php                      13-Apr-2024 02:05                5223
class.ui-exception-invalidargumentexception.php    13-Apr-2024 02:05                7755
class.ui-exception-runtimeexception.php            13-Apr-2024 02:05                7678
class.ui-executor.php                              13-Apr-2024 02:05                5374
class.ui-key.php                                   13-Apr-2024 02:05               21277
class.ui-menu.php                                  13-Apr-2024 02:05                6232
class.ui-menuitem.php                              13-Apr-2024 02:05                3702
class.ui-point.php                                 13-Apr-2024 02:05                6267
class.ui-size.php                                  13-Apr-2024 02:05                6351
class.ui-window.php                                13-Apr-2024 02:05               13048
class.underflowexception.php                       13-Apr-2024 02:05                8535
class.unexpectedvalueexception.php                 13-Apr-2024 02:05                8807
class.unhandledmatcherror.php                      13-Apr-2024 02:05                8499
class.unitenum.php                                 13-Apr-2024 02:05                2967
class.v8js.php                                     13-Apr-2024 02:05                9234
class.v8jsexception.php                            13-Apr-2024 02:05               11272
class.valueerror.php                               13-Apr-2024 02:05                8529
class.variant.php                                  13-Apr-2024 02:05                5832
class.varnishadmin.php                             13-Apr-2024 02:05               11828
class.varnishlog.php                               13-Apr-2024 02:05               34777
class.varnishstat.php                              13-Apr-2024 02:05                2998
class.volatile.php                                 13-Apr-2024 02:05               11712
class.vtiful-kernel-excel.php                      13-Apr-2024 02:05               11977
class.vtiful-kernel-format.php                     13-Apr-2024 02:05               16012
class.weakmap.php                                  13-Apr-2024 02:05                9526
class.weakreference.php                            13-Apr-2024 02:05                5758
class.win32serviceexception.php                    13-Apr-2024 02:05                7832
class.wkhtmltox-image-converter.php                13-Apr-2024 02:05                4117
class.wkhtmltox-pdf-converter.php                  13-Apr-2024 02:05                4431
class.wkhtmltox-pdf-object.php                     13-Apr-2024 02:05                2935
class.worker.php                                   13-Apr-2024 02:05                8676
class.xmldiff-base.php                             13-Apr-2024 02:05                4075
class.xmldiff-dom.php                              13-Apr-2024 02:05                5025
class.xmldiff-file.php                             13-Apr-2024 02:05                5001
class.xmldiff-memory.php                           13-Apr-2024 02:05                5033
class.xmlparser.php                                13-Apr-2024 02:05                1778
class.xmlreader.php                                13-Apr-2024 02:05               39728
class.xmlwriter.php                                13-Apr-2024 02:05               33056
class.xsltprocessor.php                            13-Apr-2024 02:05               11702
class.yac.php                                      13-Apr-2024 02:05                9505
class.yaconf.php                                   13-Apr-2024 02:05                3426
class.yaf-action-abstract.php                      13-Apr-2024 02:05               12831
class.yaf-application.php                          13-Apr-2024 02:05               13143
class.yaf-bootstrap-abstract.php                   13-Apr-2024 02:05                5688
class.yaf-config-abstract.php                      13-Apr-2024 02:05                5227
class.yaf-config-ini.php                           13-Apr-2024 02:05               18020
class.yaf-config-simple.php                        13-Apr-2024 02:05               13210
class.yaf-controller-abstract.php                  13-Apr-2024 02:05               19852
class.yaf-dispatcher.php                           13-Apr-2024 02:05               20828
class.yaf-exception-dispatchfailed.php             13-Apr-2024 02:05                2618
class.yaf-exception-loadfailed-action.php          13-Apr-2024 02:05                2689
class.yaf-exception-loadfailed-controller.php      13-Apr-2024 02:05                2714
class.yaf-exception-loadfailed-module.php          13-Apr-2024 02:05                2678
class.yaf-exception-loadfailed-view.php            13-Apr-2024 02:05                2618
class.yaf-exception-loadfailed.php                 13-Apr-2024 02:05                2592
class.yaf-exception-routerfailed.php               13-Apr-2024 02:05                2603
class.yaf-exception-startuperror.php               13-Apr-2024 02:05                2601
class.yaf-exception-typeerror.php                  13-Apr-2024 02:05                2572
class.yaf-exception.php                            13-Apr-2024 02:05                8451
class.yaf-loader.php                               13-Apr-2024 02:05               20014
class.yaf-plugin-abstract.php                      13-Apr-2024 02:05               16251
class.yaf-registry.php                             13-Apr-2024 02:05                6206
class.yaf-request-abstract.php                     13-Apr-2024 02:05               24009
class.yaf-request-http.php                         13-Apr-2024 02:05               23598
class.yaf-request-simple.php                       13-Apr-2024 02:05               22799
class.yaf-response-abstract.php                    13-Apr-2024 02:05               11946
class.yaf-route-interface.php                      13-Apr-2024 02:05                3773
class.yaf-route-map.php                            13-Apr-2024 02:05                6721
class.yaf-route-regex.php                          13-Apr-2024 02:05                8423
class.yaf-route-rewrite.php                        13-Apr-2024 02:05                7517
class.yaf-route-simple.php                         13-Apr-2024 02:05                6746
class.yaf-route-static.php                         13-Apr-2024 02:05                5178
class.yaf-route-supervar.php                       13-Apr-2024 02:05                4713
class.yaf-router.php                               13-Apr-2024 02:05               12985
class.yaf-session.php                              13-Apr-2024 02:05               12632
class.yaf-view-interface.php                       13-Apr-2024 02:05                6114
class.yaf-view-simple.php                          13-Apr-2024 02:05               11511
class.yar-client-exception.php                     13-Apr-2024 02:05                6594
class.yar-client.php                               13-Apr-2024 02:05                5791
class.yar-concurrent-client.php                    13-Apr-2024 02:05                6591
class.yar-server-exception.php                     13-Apr-2024 02:05                7051
class.yar-server.php                               13-Apr-2024 02:05                3436
class.ziparchive.php                               13-Apr-2024 02:05               91307
class.zmq.php                                      13-Apr-2024 02:05               41034
class.zmqcontext.php                               13-Apr-2024 02:05                5561
class.zmqdevice.php                                13-Apr-2024 02:05                7010
class.zmqpoll.php                                  13-Apr-2024 02:05                5146
class.zmqsocket.php                                13-Apr-2024 02:05               11441
class.zookeeper.php                                13-Apr-2024 02:05               56050
class.zookeeperauthenticationexception.php         13-Apr-2024 02:05                7685
class.zookeeperconfig.php                          13-Apr-2024 02:05                6394
class.zookeeperconnectionexception.php             13-Apr-2024 02:05                7680
class.zookeeperexception.php                       13-Apr-2024 02:05                7546
class.zookeepermarshallingexception.php            13-Apr-2024 02:05                7701
class.zookeepernonodeexception.php                 13-Apr-2024 02:05                7668
class.zookeeperoperationtimeoutexception.php       13-Apr-2024 02:05                7711
class.zookeepersessionexception.php                13-Apr-2024 02:05                7649
classobj.configuration.php                         13-Apr-2024 02:05                1197
classobj.constants.php                             13-Apr-2024 02:05                1140
classobj.examples.php                              13-Apr-2024 02:05               13602
classobj.installation.php                          13-Apr-2024 02:05                1231
classobj.requirements.php                          13-Apr-2024 02:05                1171
classobj.resources.php                             13-Apr-2024 02:05                1172
classobj.setup.php                                 13-Apr-2024 02:05                1568
closure.bind.php                                   13-Apr-2024 02:05                8319
closure.bindto.php                                 13-Apr-2024 02:05               10117
closure.call.php                                   13-Apr-2024 02:05                6272
closure.construct.php                              13-Apr-2024 02:05                2515
closure.fromcallable.php                           13-Apr-2024 02:05                3935
cmark.constants.php                                13-Apr-2024 02:05                4200
cmark.installation.php                             13-Apr-2024 02:05                1934
cmark.requirements.php                             13-Apr-2024 02:05                1269
cmark.setup.php                                    13-Apr-2024 02:05                1388
collator.asort.php                                 13-Apr-2024 02:05                9625
collator.compare.php                               13-Apr-2024 02:05               10731
collator.construct.php                             13-Apr-2024 02:05                5719
collator.create.php                                13-Apr-2024 02:05                5500
collator.getattribute.php                          13-Apr-2024 02:05                6080
collator.geterrorcode.php                          13-Apr-2024 02:05                5301
collator.geterrormessage.php                       13-Apr-2024 02:05                5378
collator.getlocale.php                             13-Apr-2024 02:05                6895
collator.getsortkey.php                            13-Apr-2024 02:05                7155
collator.getstrength.php                           13-Apr-2024 02:05                4866
collator.setattribute.php                          13-Apr-2024 02:05                6672
collator.setstrength.php                           13-Apr-2024 02:05               14611
collator.sort.php                                  13-Apr-2024 02:05                8452
collator.sortwithsortkeys.php                      13-Apr-2024 02:05                6627
collectable.isgarbage.php                          13-Apr-2024 02:05                3459
com.configuration.php                              13-Apr-2024 02:05                8907
com.constants.php                                  13-Apr-2024 02:05               27409
com.construct.php                                  13-Apr-2024 02:05               10268
com.error-handling.php                             13-Apr-2024 02:05                1601
com.examples.arrays.php                            13-Apr-2024 02:05                2354
com.examples.foreach.php                           13-Apr-2024 02:05                2920
com.examples.php                                   13-Apr-2024 02:05                1394
com.installation.php                               13-Apr-2024 02:05                1572
com.requirements.php                               13-Apr-2024 02:05                1253
com.resources.php                                  13-Apr-2024 02:05                1137
com.setup.php                                      13-Apr-2024 02:05                1507
commonmark-cql.construct.php                       13-Apr-2024 02:05                2176
commonmark-cql.invoke.php                          13-Apr-2024 02:05                3852
commonmark-interfaces-ivisitable.accept.php        13-Apr-2024 02:05                3088
commonmark-interfaces-ivisitor.enter.php           13-Apr-2024 02:05                4113
commonmark-interfaces-ivisitor.leave.php           13-Apr-2024 02:05                4115
commonmark-node-bulletlist.construct.php           13-Apr-2024 02:05                3214
commonmark-node-codeblock.construct.php            13-Apr-2024 02:05                2847
commonmark-node-heading.construct.php              13-Apr-2024 02:05                2655
commonmark-node-image.construct.php                13-Apr-2024 02:05                3290
commonmark-node-link.construct.php                 13-Apr-2024 02:05                3287
commonmark-node-orderedlist.construct.php          13-Apr-2024 02:05                4175
commonmark-node-text.construct.php                 13-Apr-2024 02:05                2675
commonmark-node.accept.php                         13-Apr-2024 02:05                2828
commonmark-node.appendchild.php                    13-Apr-2024 02:05                2711
commonmark-node.insertafter.php                    13-Apr-2024 02:05                2736
commonmark-node.insertbefore.php                   13-Apr-2024 02:05                2734
commonmark-node.prependchild.php                   13-Apr-2024 02:05                2738
commonmark-node.replace.php                        13-Apr-2024 02:05                2682
commonmark-node.unlink.php                         13-Apr-2024 02:05                2401
commonmark-parser.construct.php                    13-Apr-2024 02:05                3820
commonmark-parser.finish.php                       13-Apr-2024 02:05                2431
commonmark-parser.parse.php                        13-Apr-2024 02:05                2641
compersisthelper.construct.php                     13-Apr-2024 02:05                3762
compersisthelper.getcurfilename.php                13-Apr-2024 02:05                3243
compersisthelper.getmaxstreamsize.php              13-Apr-2024 02:05                3317
compersisthelper.initnew.php                       13-Apr-2024 02:05                3218
compersisthelper.loadfromfile.php                  13-Apr-2024 02:05                4508
compersisthelper.loadfromstream.php                13-Apr-2024 02:05                3657
compersisthelper.savetofile.php                    13-Apr-2024 02:05                6572
compersisthelper.savetostream.php                  13-Apr-2024 02:05                3683
componere-abstract-definition.addinterface.php     13-Apr-2024 02:05                3220
componere-abstract-definition.addmethod.php        13-Apr-2024 02:05                3946
componere-abstract-definition.addtrait.php         13-Apr-2024 02:05                3172
componere-abstract-definition.getreflector.php     13-Apr-2024 02:05                2349
componere-definition.addconstant.php               13-Apr-2024 02:05                4269
componere-definition.addproperty.php               13-Apr-2024 02:05                3678
componere-definition.construct.php                 13-Apr-2024 02:05                5915
componere-definition.getclosure.php                13-Apr-2024 02:05                3384
componere-definition.getclosures.php               13-Apr-2024 02:05                2631
componere-definition.isregistered.php              13-Apr-2024 02:05                2231
componere-definition.register.php                  13-Apr-2024 02:05                2384
componere-method.construct.php                     13-Apr-2024 02:05                2172
componere-method.getreflector.php                  13-Apr-2024 02:05                2152
componere-method.setprivate.php                    13-Apr-2024 02:05                2380
componere-method.setprotected.php                  13-Apr-2024 02:05                2395
componere-method.setstatic.php                     13-Apr-2024 02:05                1977
componere-patch.apply.php                          13-Apr-2024 02:05                1842
componere-patch.construct.php                      13-Apr-2024 02:05                3584
componere-patch.derive.php                         13-Apr-2024 02:05                3077
componere-patch.getclosure.php                     13-Apr-2024 02:05                3014
componere-patch.getclosures.php                    13-Apr-2024 02:05                2152
componere-patch.isapplied.php                      13-Apr-2024 02:05                1796
componere-patch.revert.php                         13-Apr-2024 02:05                1839
componere-value.construct.php                      13-Apr-2024 02:05                2605
componere-value.hasdefault.php                     13-Apr-2024 02:05                1840
componere-value.isprivate.php                      13-Apr-2024 02:05                1861
componere-value.isprotected.php                    13-Apr-2024 02:05                1871
componere-value.isstatic.php                       13-Apr-2024 02:05                1855
componere-value.setprivate.php                     13-Apr-2024 02:05                2403
componere-value.setprotected.php                   13-Apr-2024 02:05                2417
componere-value.setstatic.php                      13-Apr-2024 02:05                1994
componere.cast.php                                 13-Apr-2024 02:05                4835
componere.cast_by_ref.php                          13-Apr-2024 02:05                5011
componere.installation.php                         13-Apr-2024 02:05                1329
componere.requirements.php                         13-Apr-2024 02:05                1159
componere.setup.php                                13-Apr-2024 02:05                1427
configuration.changes.modes.php                    13-Apr-2024 02:05                4344
configuration.changes.php                          13-Apr-2024 02:05                9864
configuration.file.per-user.php                    13-Apr-2024 02:05                3428
configuration.file.php                             13-Apr-2024 02:05               11575
configuration.php                                  13-Apr-2024 02:05                1591
configure.about.php                                13-Apr-2024 02:05               14054
configure.php                                      13-Apr-2024 02:05                1421
context.ftp.php                                    13-Apr-2024 02:05                4701
context.http.php                                   13-Apr-2024 02:05               16895
context.params.php                                 13-Apr-2024 02:05                2626
context.phar.php                                   13-Apr-2024 02:05                2908
context.php                                        13-Apr-2024 02:05                3316
context.socket.php                                 13-Apr-2024 02:05               10141
context.ssl.php                                    13-Apr-2024 02:05               13683
context.zip.php                                    13-Apr-2024 02:05                4361
context.zlib.php                                   13-Apr-2024 02:05                2570
control-structures.alternative-syntax.php          13-Apr-2024 02:05                6986
control-structures.break.php                       13-Apr-2024 02:05                4662
control-structures.continue.php                    13-Apr-2024 02:05                8269
control-structures.declare.php                     13-Apr-2024 02:05               10617
control-structures.do.while.php                    13-Apr-2024 02:05                5133
control-structures.else.php                        13-Apr-2024 02:05                5059
control-structures.elseif.php                      13-Apr-2024 02:05                7683
control-structures.for.php                         13-Apr-2024 02:05               12152
control-structures.foreach.php                     13-Apr-2024 02:05               21202
control-structures.goto.php                        13-Apr-2024 02:05                7151
control-structures.if.php                          13-Apr-2024 02:05                4842
control-structures.intro.php                       13-Apr-2024 02:05                2493
control-structures.match.php                       13-Apr-2024 02:05               17970
control-structures.switch.php                      13-Apr-2024 02:05               19359
control-structures.while.php                       13-Apr-2024 02:05                4580
copyright.php                                      13-Apr-2024 02:05                2379
countable.count.php                                13-Apr-2024 02:05                5450
ctype.configuration.php                            13-Apr-2024 02:05                1176
ctype.constants.php                                13-Apr-2024 02:05                1100
ctype.installation.php                             13-Apr-2024 02:05                1628
ctype.requirements.php                             13-Apr-2024 02:05                1184
ctype.resources.php                                13-Apr-2024 02:05                1151
ctype.setup.php                                    13-Apr-2024 02:05                1515
cubrid.configuration.php                           13-Apr-2024 02:05                1169
cubrid.constants.php                               13-Apr-2024 02:05               13793
cubrid.examples.php                                13-Apr-2024 02:05               13756
cubrid.installation.php                            13-Apr-2024 02:05                2190
cubrid.requirements.php                            13-Apr-2024 02:05                1235
cubrid.resources.php                               13-Apr-2024 02:05                3049
cubrid.setup.php                                   13-Apr-2024 02:05                1528
cubridmysql.cubrid.php                             13-Apr-2024 02:05                4873
curl.configuration.php                             13-Apr-2024 02:05                2530
curl.constants.php                                 13-Apr-2024 02:05              191616
curl.examples-basic.php                            13-Apr-2024 02:05                4599
curl.examples.php                                  13-Apr-2024 02:05                1329
curl.installation.php                              13-Apr-2024 02:05                2810
curl.requirements.php                              13-Apr-2024 02:05                1467
curl.resources.php                                 13-Apr-2024 02:05                1327
curl.setup.php                                     13-Apr-2024 02:05                1524
curlfile.construct.php                             13-Apr-2024 02:05               21487
curlfile.getfilename.php                           13-Apr-2024 02:05                2147
curlfile.getmimetype.php                           13-Apr-2024 02:05                2151
curlfile.getpostfilename.php                       13-Apr-2024 02:05                2207
curlfile.setmimetype.php                           13-Apr-2024 02:05                2414
curlfile.setpostfilename.php                       13-Apr-2024 02:05                2459
curlstringfile.construct.php                       13-Apr-2024 02:05                7113
dateinterval.construct.php                         13-Apr-2024 02:05               13965
dateinterval.createfromdatestring.php              13-Apr-2024 02:05               15822
dateinterval.format.php                            13-Apr-2024 02:05               14730
dateperiod.construct.php                           13-Apr-2024 02:05               20404
dateperiod.createfromiso8601string.php             13-Apr-2024 02:05                8337
dateperiod.getdateinterval.php                     13-Apr-2024 02:05                4752
dateperiod.getenddate.php                          13-Apr-2024 02:05                7572
dateperiod.getrecurrences.php                      13-Apr-2024 02:05                8909
dateperiod.getstartdate.php                        13-Apr-2024 02:05                5254
datetime.add.php                                   13-Apr-2024 02:05                4958
datetime.configuration.php                         13-Apr-2024 02:05                6559
datetime.constants.php                             13-Apr-2024 02:05                2845
datetime.construct.php                             13-Apr-2024 02:05                6590
datetime.createfromformat.php                      13-Apr-2024 02:05                7631
datetime.createfromimmutable.php                   13-Apr-2024 02:05                5066
datetime.createfrominterface.php                   13-Apr-2024 02:05                4928
datetime.diff.php                                  13-Apr-2024 02:05               17322
datetime.error.tree.php                            13-Apr-2024 02:05                3292
datetime.examples-arithmetic.php                   13-Apr-2024 02:05               15490
datetime.examples.php                              13-Apr-2024 02:05                1367
datetime.format.php                                13-Apr-2024 02:05               27782
datetime.formats.php                               13-Apr-2024 02:05               59225
datetime.getlasterrors.php                         13-Apr-2024 02:05                1856
datetime.getoffset.php                             13-Apr-2024 02:05                7868
datetime.gettimestamp.php                          13-Apr-2024 02:05               10367
datetime.gettimezone.php                           13-Apr-2024 02:05                7809
datetime.installation.php                          13-Apr-2024 02:05                1648
datetime.modify.php                                13-Apr-2024 02:05               14499
datetime.requirements.php                          13-Apr-2024 02:05                1171
datetime.resources.php                             13-Apr-2024 02:05                1172
datetime.set-state.php                             13-Apr-2024 02:05                2893
datetime.setdate.php                               13-Apr-2024 02:05                5666
datetime.setisodate.php                            13-Apr-2024 02:05                5816
datetime.settime.php                               13-Apr-2024 02:05                7293
datetime.settimestamp.php                          13-Apr-2024 02:05                5082
datetime.settimezone.php                           13-Apr-2024 02:05                9447
datetime.setup.php                                 13-Apr-2024 02:05                1580
datetime.sub.php                                   13-Apr-2024 02:05                6393
datetime.wakeup.php                                13-Apr-2024 02:05                3030
datetimeimmutable.add.php                          13-Apr-2024 02:05               10486
datetimeimmutable.construct.php                    13-Apr-2024 02:05               18917
datetimeimmutable.createfromformat.php             13-Apr-2024 02:05               49837
datetimeimmutable.createfrominterface.php          13-Apr-2024 02:05                5182
datetimeimmutable.createfrommutable.php            13-Apr-2024 02:05                5222
datetimeimmutable.getlasterrors.php                13-Apr-2024 02:05                5777
datetimeimmutable.modify.php                       13-Apr-2024 02:05                9481
datetimeimmutable.set-state.php                    13-Apr-2024 02:05                2773
datetimeimmutable.setdate.php                      13-Apr-2024 02:05                9253
datetimeimmutable.setisodate.php                   13-Apr-2024 02:05               12792
datetimeimmutable.settime.php                      13-Apr-2024 02:05               12146
datetimeimmutable.settimestamp.php                 13-Apr-2024 02:05                5679
datetimeimmutable.settimezone.php                  13-Apr-2024 02:05                6116
datetimeimmutable.sub.php                          13-Apr-2024 02:05               12122
datetimezone.construct.php                         13-Apr-2024 02:05               11149
datetimezone.getlocation.php                       13-Apr-2024 02:05                5859
datetimezone.getname.php                           13-Apr-2024 02:05                3796
datetimezone.getoffset.php                         13-Apr-2024 02:05                7307
datetimezone.gettransitions.php                    13-Apr-2024 02:05               12377
datetimezone.listabbreviations.php                 13-Apr-2024 02:05                6313
datetimezone.listidentifiers.php                   13-Apr-2024 02:05               14872
dba.configuration.php                              13-Apr-2024 02:05                2266
dba.constants.php                                  13-Apr-2024 02:05                2229
dba.example.php                                    13-Apr-2024 02:05                6436
dba.examples.php                                   13-Apr-2024 02:05                1274
dba.installation.php                               13-Apr-2024 02:05               10873
dba.requirements.php                               13-Apr-2024 02:05                8153
dba.resources.php                                  13-Apr-2024 02:05                1504
dba.setup.php                                      13-Apr-2024 02:05                1510
dbase.configuration.php                            13-Apr-2024 02:05                1176
dbase.constants.php                                13-Apr-2024 02:05                3640
dbase.installation.php                             13-Apr-2024 02:05                1638
dbase.requirements.php                             13-Apr-2024 02:05                1150
dbase.resources.php                                13-Apr-2024 02:05                1425
dbase.setup.php                                    13-Apr-2024 02:05                1532
debugger-about.php                                 13-Apr-2024 02:05                1625
debugger.php                                       13-Apr-2024 02:05                1363
dio.configuration.php                              13-Apr-2024 02:05                1162
dio.constants.php                                  13-Apr-2024 02:05               11019
dio.installation.php                               13-Apr-2024 02:05                2101
dio.requirements.php                               13-Apr-2024 02:05                1136
dio.resources.php                                  13-Apr-2024 02:05                1343
dio.setup.php                                      13-Apr-2024 02:05                1520
dir.configuration.php                              13-Apr-2024 02:05                1162
dir.constants.php                                  13-Apr-2024 02:05                2780
dir.installation.php                               13-Apr-2024 02:05                1196
dir.requirements.php                               13-Apr-2024 02:05                1136
dir.resources.php                                  13-Apr-2024 02:05                1137
dir.setup.php                                      13-Apr-2024 02:05                1519
directory.close.php                                13-Apr-2024 02:05                2259
directory.read.php                                 13-Apr-2024 02:05                2395
directory.rewind.php                               13-Apr-2024 02:05                2270
directoryiterator.construct.php                    13-Apr-2024 02:05                5946
directoryiterator.current.php                      13-Apr-2024 02:05                6156
directoryiterator.getbasename.php                  13-Apr-2024 02:05                6472
directoryiterator.getextension.php                 13-Apr-2024 02:05                6033
directoryiterator.getfilename.php                  13-Apr-2024 02:05                5172
directoryiterator.isdot.php                        13-Apr-2024 02:05                5469
directoryiterator.key.php                          13-Apr-2024 02:05                6606
directoryiterator.next.php                         13-Apr-2024 02:05                5465
directoryiterator.rewind.php                       13-Apr-2024 02:05                5360
directoryiterator.seek.php                         13-Apr-2024 02:05                5302
directoryiterator.tostring.php                     13-Apr-2024 02:05                4697
directoryiterator.valid.php                        13-Apr-2024 02:05                5866
doc.changelog.php                                  13-Apr-2024 02:05                1249
dom.configuration.php                              13-Apr-2024 02:05                1162
dom.constants.php                                  13-Apr-2024 02:05               19873
dom.examples.php                                   13-Apr-2024 02:05                2933
dom.installation.php                               13-Apr-2024 02:05                1341
dom.requirements.php                               13-Apr-2024 02:05                1610
dom.resources.php                                  13-Apr-2024 02:05                1137
dom.setup.php                                      13-Apr-2024 02:05                1499
domattr.construct.php                              13-Apr-2024 02:05                5746
domattr.isid.php                                   13-Apr-2024 02:05                5135
domcdatasection.construct.php                      13-Apr-2024 02:05                5243
domcharacterdata.after.php                         13-Apr-2024 02:05                8182
domcharacterdata.appenddata.php                    13-Apr-2024 02:05                4438
domcharacterdata.before.php                        13-Apr-2024 02:05                7634
domcharacterdata.deletedata.php                    13-Apr-2024 02:05                5202
domcharacterdata.insertdata.php                    13-Apr-2024 02:05                4897
domcharacterdata.remove.php                        13-Apr-2024 02:05                5423
domcharacterdata.replacedata.php                   13-Apr-2024 02:05                5556
domcharacterdata.replacewith.php                   13-Apr-2024 02:05                8095
domcharacterdata.substringdata.php                 13-Apr-2024 02:05                5051
domchildnode.after.php                             13-Apr-2024 02:05                6113
domchildnode.before.php                            13-Apr-2024 02:05                5352
domchildnode.remove.php                            13-Apr-2024 02:05                3136
domchildnode.replacewith.php                       13-Apr-2024 02:05                5542
domcomment.construct.php                           13-Apr-2024 02:05                5137
domdocument.adoptnode.php                          13-Apr-2024 02:05                6770
domdocument.append.php                             13-Apr-2024 02:05                7121
domdocument.construct.php                          13-Apr-2024 02:05                4412
domdocument.createattribute.php                    13-Apr-2024 02:05                6097
domdocument.createattributens.php                  13-Apr-2024 02:05                8843
domdocument.createcdatasection.php                 13-Apr-2024 02:05                5685
domdocument.createcomment.php                      13-Apr-2024 02:05                6145
domdocument.createdocumentfragment.php             13-Apr-2024 02:05                5997
domdocument.createelement.php                      13-Apr-2024 02:05               11815
domdocument.createelementns.php                    13-Apr-2024 02:05               14365
domdocument.createentityreference.php              13-Apr-2024 02:05                6449
domdocument.createprocessinginstruction.php        13-Apr-2024 02:05                6711
domdocument.createtextnode.php                     13-Apr-2024 02:05                6136
domdocument.getelementbyid.php                     13-Apr-2024 02:05                7748
domdocument.getelementsbytagname.php               13-Apr-2024 02:05                6112
domdocument.getelementsbytagnamens.php             13-Apr-2024 02:05                7827
domdocument.importnode.php                         13-Apr-2024 02:05                9270
domdocument.load.php                               13-Apr-2024 02:05                6913
domdocument.loadhtml.php                           13-Apr-2024 02:05                8079
domdocument.loadhtmlfile.php                       13-Apr-2024 02:05                8277
domdocument.loadxml.php                            13-Apr-2024 02:05                6530
domdocument.normalizedocument.php                  13-Apr-2024 02:05                3029
domdocument.prepend.php                            13-Apr-2024 02:05                7184
domdocument.registernodeclass.php                  13-Apr-2024 02:05               21315
domdocument.relaxngvalidate.php                    13-Apr-2024 02:05                4077
domdocument.relaxngvalidatesource.php              13-Apr-2024 02:05                4126
domdocument.replacechildren.php                    13-Apr-2024 02:05                7423
domdocument.save.php                               13-Apr-2024 02:05                7727
domdocument.savehtml.php                           13-Apr-2024 02:05                7604
domdocument.savehtmlfile.php                       13-Apr-2024 02:05                8068
domdocument.savexml.php                            13-Apr-2024 02:05               10041
domdocument.schemavalidate.php                     13-Apr-2024 02:05                4524
domdocument.schemavalidatesource.php               13-Apr-2024 02:05                4588
domdocument.validate.php                           13-Apr-2024 02:05                6212
domdocument.xinclude.php                           13-Apr-2024 02:05                7315
domdocumentfragment.append.php                     13-Apr-2024 02:05                7783
domdocumentfragment.appendxml.php                  13-Apr-2024 02:05                5631
domdocumentfragment.construct.php                  13-Apr-2024 02:05                2123
domdocumentfragment.prepend.php                    13-Apr-2024 02:05                7863
domdocumentfragment.replacechildren.php            13-Apr-2024 02:05                8146
domelement.after.php                               13-Apr-2024 02:05                7844
domelement.append.php                              13-Apr-2024 02:05                7397
domelement.before.php                              13-Apr-2024 02:05                7250
domelement.construct.php                           13-Apr-2024 02:05                6873
domelement.getattribute.php                        13-Apr-2024 02:05                3543
domelement.getattributenames.php                   13-Apr-2024 02:05                3958
domelement.getattributenode.php                    13-Apr-2024 02:05                4120
domelement.getattributenodens.php                  13-Apr-2024 02:05                4635
domelement.getattributens.php                      13-Apr-2024 02:05                4113
domelement.getelementsbytagname.php                13-Apr-2024 02:05                3722
domelement.getelementsbytagnamens.php              13-Apr-2024 02:05                4844
domelement.hasattribute.php                        13-Apr-2024 02:05                3847
domelement.hasattributens.php                      13-Apr-2024 02:05                4330
domelement.insertadjacentelement.php               13-Apr-2024 02:05                6708
domelement.insertadjacenttext.php                  13-Apr-2024 02:05                6496
domelement.prepend.php                             13-Apr-2024 02:05                7460
domelement.remove.php                              13-Apr-2024 02:05                5039
domelement.removeattribute.php                     13-Apr-2024 02:05                4067
domelement.removeattributenode.php                 13-Apr-2024 02:05                4432
domelement.removeattributens.php                   13-Apr-2024 02:05                4360
domelement.replacechildren.php                     13-Apr-2024 02:05                7971
domelement.replacewith.php                         13-Apr-2024 02:05                8057
domelement.setattribute.php                        13-Apr-2024 02:05                6260
domelement.setattributenode.php                    13-Apr-2024 02:05                4849
domelement.setattributenodens.php                  13-Apr-2024 02:05                4924
domelement.setattributens.php                      13-Apr-2024 02:05                5321
domelement.setidattribute.php                      13-Apr-2024 02:05                4756
domelement.setidattributenode.php                  13-Apr-2024 02:05                4738
domelement.setidattributens.php                    13-Apr-2024 02:05                5201
domelement.toggleattribute.php                     13-Apr-2024 02:05                6507
domentityreference.construct.php                   13-Apr-2024 02:05                4851
domimplementation.construct.php                    13-Apr-2024 02:05                2170
domimplementation.createdocument.php               13-Apr-2024 02:05                7693
domimplementation.createdocumenttype.php           13-Apr-2024 02:05               10207
domimplementation.hasfeature.php                   13-Apr-2024 02:05                9324
domnamednodemap.count.php                          13-Apr-2024 02:05                2453
domnamednodemap.getiterator.php                    13-Apr-2024 02:05                3271
domnamednodemap.getnameditem.php                   13-Apr-2024 02:05                3481
domnamednodemap.getnameditemns.php                 13-Apr-2024 02:05                3988
domnamednodemap.item.php                           13-Apr-2024 02:05                3107
domnode.appendchild.php                            13-Apr-2024 02:05                9015
domnode.c14n.php                                   13-Apr-2024 02:05                5014
domnode.c14nfile.php                               13-Apr-2024 02:05                5361
domnode.clonenode.php                              13-Apr-2024 02:05                2882
domnode.contains.php                               13-Apr-2024 02:05                5422
domnode.getlineno.php                              13-Apr-2024 02:05                4965
domnode.getnodepath.php                            13-Apr-2024 02:05                5177
domnode.getrootnode.php                            13-Apr-2024 02:05                4327
domnode.hasattributes.php                          13-Apr-2024 02:05                3081
domnode.haschildnodes.php                          13-Apr-2024 02:05                2907
domnode.insertbefore.php                           13-Apr-2024 02:05                5735
domnode.isdefaultnamespace.php                     13-Apr-2024 02:05                2968
domnode.isequalnode.php                            13-Apr-2024 02:05                4705
domnode.issamenode.php                             13-Apr-2024 02:05                2834
domnode.issupported.php                            13-Apr-2024 02:05                3901
domnode.lookupnamespaceuri.php                     13-Apr-2024 02:05                3724
domnode.lookupprefix.php                           13-Apr-2024 02:05                3313
domnode.normalize.php                              13-Apr-2024 02:05                2834
domnode.removechild.php                            13-Apr-2024 02:05                7084
domnode.replacechild.php                           13-Apr-2024 02:05                6032
domnodelist.count.php                              13-Apr-2024 02:05                2383
domnodelist.getiterator.php                        13-Apr-2024 02:05                3161
domnodelist.item.php                               13-Apr-2024 02:05                7131
domparentnode.append.php                           13-Apr-2024 02:05                5012
domparentnode.prepend.php                          13-Apr-2024 02:05                5067
domparentnode.replacechildren.php                  13-Apr-2024 02:05                6809
domprocessinginstruction.construct.php             13-Apr-2024 02:05                6831
domtext.construct.php                              13-Apr-2024 02:05                4828
domtext.iselementcontentwhitespace.php             13-Apr-2024 02:05                2662
domtext.iswhitespaceinelementcontent.php           13-Apr-2024 02:05                2920
domtext.splittext.php                              13-Apr-2024 02:05                3429
domxpath.construct.php                             13-Apr-2024 02:05                3619
domxpath.evaluate.php                              13-Apr-2024 02:05                8139
domxpath.query.php                                 13-Apr-2024 02:05               12598
domxpath.registernamespace.php                     13-Apr-2024 02:05                3311
domxpath.registerphpfunctions.php                  13-Apr-2024 02:05               13744
dotnet.construct.php                               13-Apr-2024 02:05                3202
ds-collection.clear.php                            13-Apr-2024 02:05                3880
ds-collection.copy.php                             13-Apr-2024 02:05                4287
ds-collection.isempty.php                          13-Apr-2024 02:05                4215
ds-collection.toarray.php                          13-Apr-2024 02:05                4206
ds-deque.allocate.php                              13-Apr-2024 02:05                4617
ds-deque.apply.php                                 13-Apr-2024 02:05                4913
ds-deque.capacity.php                              13-Apr-2024 02:05                3914
ds-deque.clear.php                                 13-Apr-2024 02:05                3797
ds-deque.construct.php                             13-Apr-2024 02:05                4270
ds-deque.contains.php                              13-Apr-2024 02:05                7033
ds-deque.copy.php                                  13-Apr-2024 02:05                4153
ds-deque.count.php                                 13-Apr-2024 02:05                1533
ds-deque.filter.php                                13-Apr-2024 02:05                7572
ds-deque.find.php                                  13-Apr-2024 02:05                5372
ds-deque.first.php                                 13-Apr-2024 02:05                3724
ds-deque.get.php                                   13-Apr-2024 02:05                6548
ds-deque.insert.php                                13-Apr-2024 02:05                6613
ds-deque.isempty.php                               13-Apr-2024 02:05                4101
ds-deque.join.php                                  13-Apr-2024 02:05                5697
ds-deque.jsonserialize.php                         13-Apr-2024 02:05                1815
ds-deque.last.php                                  13-Apr-2024 02:05                3712
ds-deque.map.php                                   13-Apr-2024 02:05                5268
ds-deque.merge.php                                 13-Apr-2024 02:05                4818
ds-deque.pop.php                                   13-Apr-2024 02:05                4209
ds-deque.push.php                                  13-Apr-2024 02:05                4617
ds-deque.reduce.php                                13-Apr-2024 02:05                7943
ds-deque.remove.php                                13-Apr-2024 02:05                4815
ds-deque.reverse.php                               13-Apr-2024 02:05                3633
ds-deque.reversed.php                              13-Apr-2024 02:05                3980
ds-deque.rotate.php                                13-Apr-2024 02:05                5003
ds-deque.set.php                                   13-Apr-2024 02:05                6021
ds-deque.shift.php                                 13-Apr-2024 02:05                4310
ds-deque.slice.php                                 13-Apr-2024 02:05                7094
ds-deque.sort.php                                  13-Apr-2024 02:05                7470
ds-deque.sorted.php                                13-Apr-2024 02:05                7491
ds-deque.sum.php                                   13-Apr-2024 02:05                5239
ds-deque.toarray.php                               13-Apr-2024 02:05                4092
ds-deque.unshift.php                               13-Apr-2024 02:05                4698
ds-hashable.equals.php                             13-Apr-2024 02:05                3638
ds-hashable.hash.php                               13-Apr-2024 02:05                7408
ds-map.allocate.php                                13-Apr-2024 02:05                4483
ds-map.apply.php                                   13-Apr-2024 02:05                5609
ds-map.capacity.php                                13-Apr-2024 02:05                3204
ds-map.clear.php                                   13-Apr-2024 02:05                4273
ds-map.construct.php                               13-Apr-2024 02:05                4772
ds-map.copy.php                                    13-Apr-2024 02:05                4013
ds-map.count.php                                   13-Apr-2024 02:05                1494
ds-map.diff.php                                    13-Apr-2024 02:05                5390
ds-map.filter.php                                  13-Apr-2024 02:05                8356
ds-map.first.php                                   13-Apr-2024 02:05                4023
ds-map.get.php                                     13-Apr-2024 02:05                8372
ds-map.haskey.php                                  13-Apr-2024 02:05                4629
ds-map.hasvalue.php                                13-Apr-2024 02:05                4673
ds-map.intersect.php                               13-Apr-2024 02:05                5913
ds-map.isempty.php                                 13-Apr-2024 02:05                4323
ds-map.jsonserialize.php                           13-Apr-2024 02:05                1793
ds-map.keys.php                                    13-Apr-2024 02:05                3914
ds-map.ksort.php                                   13-Apr-2024 02:05                8157
ds-map.ksorted.php                                 13-Apr-2024 02:05                8240
ds-map.last.php                                    13-Apr-2024 02:05                4008
ds-map.map.php                                     13-Apr-2024 02:05                6249
ds-map.merge.php                                   13-Apr-2024 02:05                5800
ds-map.pairs.php                                   13-Apr-2024 02:05                4329
ds-map.put.php                                     13-Apr-2024 02:05               13897
ds-map.putall.php                                  13-Apr-2024 02:05                5484
ds-map.reduce.php                                  13-Apr-2024 02:05                8878
ds-map.remove.php                                  13-Apr-2024 02:05                6914
ds-map.reverse.php                                 13-Apr-2024 02:05                4085
ds-map.reversed.php                                13-Apr-2024 02:05                4190
ds-map.skip.php                                    13-Apr-2024 02:05                4565
ds-map.slice.php                                   13-Apr-2024 02:05                7946
ds-map.sort.php                                    13-Apr-2024 02:05                8080
ds-map.sorted.php                                  13-Apr-2024 02:05                8219
ds-map.sum.php                                     13-Apr-2024 02:05                5706
ds-map.toarray.php                                 13-Apr-2024 02:05                5087
ds-map.union.php                                   13-Apr-2024 02:05                5897
ds-map.values.php                                  13-Apr-2024 02:05                3913
ds-map.xor.php                                     13-Apr-2024 02:05                5456
ds-pair.clear.php                                  13-Apr-2024 02:05                3702
ds-pair.construct.php                              13-Apr-2024 02:05                2543
ds-pair.copy.php                                   13-Apr-2024 02:05                4067
ds-pair.isempty.php                                13-Apr-2024 02:05                4051
ds-pair.jsonserialize.php                          13-Apr-2024 02:05                1813
ds-pair.toarray.php                                13-Apr-2024 02:05                4026
ds-priorityqueue.allocate.php                      13-Apr-2024 02:05                4783
ds-priorityqueue.capacity.php                      13-Apr-2024 02:05                3413
ds-priorityqueue.clear.php                         13-Apr-2024 02:05                4454
ds-priorityqueue.construct.php                     13-Apr-2024 02:05                2873
ds-priorityqueue.copy.php                          13-Apr-2024 02:05                4456
ds-priorityqueue.count.php                         13-Apr-2024 02:05                1642
ds-priorityqueue.isempty.php                       13-Apr-2024 02:05                5011
ds-priorityqueue.jsonserialize.php                 13-Apr-2024 02:05                1933
ds-priorityqueue.peek.php                          13-Apr-2024 02:05                4702
ds-priorityqueue.pop.php                           13-Apr-2024 02:05                5474
ds-priorityqueue.push.php                          13-Apr-2024 02:05                5543
ds-priorityqueue.toarray.php                       13-Apr-2024 02:05                5193
ds-queue.allocate.php                              13-Apr-2024 02:05                4812
ds-queue.capacity.php                              13-Apr-2024 02:05                3920
ds-queue.clear.php                                 13-Apr-2024 02:05                3782
ds-queue.construct.php                             13-Apr-2024 02:05                4268
ds-queue.copy.php                                  13-Apr-2024 02:05                4255
ds-queue.count.php                                 13-Apr-2024 02:05                1530
ds-queue.isempty.php                               13-Apr-2024 02:05                4117
ds-queue.jsonserialize.php                         13-Apr-2024 02:05                1821
ds-queue.peek.php                                  13-Apr-2024 02:05                4306
ds-queue.pop.php                                   13-Apr-2024 02:05                4840
ds-queue.push.php                                  13-Apr-2024 02:05                4652
ds-queue.toarray.php                               13-Apr-2024 02:05                4258
ds-sequence.allocate.php                           13-Apr-2024 02:05                4519
ds-sequence.apply.php                              13-Apr-2024 02:05                5028
ds-sequence.capacity.php                           13-Apr-2024 02:05                4469
ds-sequence.contains.php                           13-Apr-2024 02:05                7160
ds-sequence.filter.php                             13-Apr-2024 02:05                7711
ds-sequence.find.php                               13-Apr-2024 02:05                5484
ds-sequence.first.php                              13-Apr-2024 02:05                3839
ds-sequence.get.php                                13-Apr-2024 02:05                6676
ds-sequence.insert.php                             13-Apr-2024 02:05                6732
ds-sequence.join.php                               13-Apr-2024 02:05                5793
ds-sequence.last.php                               13-Apr-2024 02:05                3806
ds-sequence.map.php                                13-Apr-2024 02:05                5397
ds-sequence.merge.php                              13-Apr-2024 02:05                4944
ds-sequence.pop.php                                13-Apr-2024 02:05                4321
ds-sequence.push.php                               13-Apr-2024 02:05                4739
ds-sequence.reduce.php                             13-Apr-2024 02:05                8062
ds-sequence.remove.php                             13-Apr-2024 02:05                4927
ds-sequence.reverse.php                            13-Apr-2024 02:05                3746
ds-sequence.reversed.php                           13-Apr-2024 02:05                4103
ds-sequence.rotate.php                             13-Apr-2024 02:05                5140
ds-sequence.set.php                                13-Apr-2024 02:05                6145
ds-sequence.shift.php                              13-Apr-2024 02:05                4422
ds-sequence.slice.php                              13-Apr-2024 02:05                7259
ds-sequence.sort.php                               13-Apr-2024 02:05                7597
ds-sequence.sorted.php                             13-Apr-2024 02:05                7618
ds-sequence.sum.php                                13-Apr-2024 02:05                5364
ds-sequence.unshift.php                            13-Apr-2024 02:05                4809
ds-set.add.php                                     13-Apr-2024 02:05               12128
ds-set.allocate.php                                13-Apr-2024 02:05                4492
ds-set.capacity.php                                13-Apr-2024 02:05                3872
ds-set.clear.php                                   13-Apr-2024 02:05                3728
ds-set.construct.php                               13-Apr-2024 02:05                4222
ds-set.contains.php                                13-Apr-2024 02:05                7227
ds-set.copy.php                                    13-Apr-2024 02:05                4194
ds-set.count.php                                   13-Apr-2024 02:05                1494
ds-set.diff.php                                    13-Apr-2024 02:05                4680
ds-set.filter.php                                  13-Apr-2024 02:05                7520
ds-set.first.php                                   13-Apr-2024 02:05                3677
ds-set.get.php                                     13-Apr-2024 02:05                6492
ds-set.intersect.php                               13-Apr-2024 02:05                4911
ds-set.isempty.php                                 13-Apr-2024 02:05                4059
ds-set.join.php                                    13-Apr-2024 02:05                5643
ds-set.jsonserialize.php                           13-Apr-2024 02:05                1787
ds-set.last.php                                    13-Apr-2024 02:05                3678
ds-set.merge.php                                   13-Apr-2024 02:05                4744
ds-set.reduce.php                                  13-Apr-2024 02:05                7889
ds-set.remove.php                                  13-Apr-2024 02:05                4923
ds-set.reverse.php                                 13-Apr-2024 02:05                3581
ds-set.reversed.php                                13-Apr-2024 02:05                3918
ds-set.slice.php                                   13-Apr-2024 02:05                7008
ds-set.sort.php                                    13-Apr-2024 02:05                7406
ds-set.sorted.php                                  13-Apr-2024 02:05                7427
ds-set.sum.php                                     13-Apr-2024 02:05                5179
ds-set.toarray.php                                 13-Apr-2024 02:05                4038
ds-set.union.php                                   13-Apr-2024 02:05                4874
ds-set.xor.php                                     13-Apr-2024 02:05                4850
ds-stack.allocate.php                              13-Apr-2024 02:05                2795
ds-stack.capacity.php                              13-Apr-2024 02:05                2147
ds-stack.clear.php                                 13-Apr-2024 02:05                3778
ds-stack.construct.php                             13-Apr-2024 02:05                4234
ds-stack.copy.php                                  13-Apr-2024 02:05                4255
ds-stack.count.php                                 13-Apr-2024 02:05                1530
ds-stack.isempty.php                               13-Apr-2024 02:05                4117
ds-stack.jsonserialize.php                         13-Apr-2024 02:05                1821
ds-stack.peek.php                                  13-Apr-2024 02:05                4300
ds-stack.pop.php                                   13-Apr-2024 02:05                4834
ds-stack.push.php                                  13-Apr-2024 02:05                4652
ds-stack.toarray.php                               13-Apr-2024 02:05                4083
ds-vector.allocate.php                             13-Apr-2024 02:05                4436
ds-vector.apply.php                                13-Apr-2024 02:05                4939
ds-vector.capacity.php                             13-Apr-2024 02:05                4374
ds-vector.clear.php                                13-Apr-2024 02:05                3809
ds-vector.construct.php                            13-Apr-2024 02:05                4302
ds-vector.contains.php                             13-Apr-2024 02:05                7063
ds-vector.copy.php                                 13-Apr-2024 02:05                4279
ds-vector.count.php                                13-Apr-2024 02:05                1547
ds-vector.filter.php                               13-Apr-2024 02:05                7606
ds-vector.find.php                                 13-Apr-2024 02:05                5397
ds-vector.first.php                                13-Apr-2024 02:05                3750
ds-vector.get.php                                  13-Apr-2024 02:05                6579
ds-vector.insert.php                               13-Apr-2024 02:05                6643
ds-vector.isempty.php                              13-Apr-2024 02:05                4125
ds-vector.join.php                                 13-Apr-2024 02:05                5724
ds-vector.jsonserialize.php                        13-Apr-2024 02:05                1829
ds-vector.last.php                                 13-Apr-2024 02:05                3737
ds-vector.map.php                                  13-Apr-2024 02:05                5300
ds-vector.merge.php                                13-Apr-2024 02:05                4849
ds-vector.pop.php                                  13-Apr-2024 02:05                4234
ds-vector.push.php                                 13-Apr-2024 02:05                4646
ds-vector.reduce.php                               13-Apr-2024 02:05                7971
ds-vector.remove.php                               13-Apr-2024 02:05                4840
ds-vector.reverse.php                              13-Apr-2024 02:05                3659
ds-vector.reversed.php                             13-Apr-2024 02:05                4010
ds-vector.rotate.php                               13-Apr-2024 02:05                5037
ds-vector.set.php                                  13-Apr-2024 02:05                6052
ds-vector.shift.php                                13-Apr-2024 02:05                4335
ds-vector.slice.php                                13-Apr-2024 02:05                7140
ds-vector.sort.php                                 13-Apr-2024 02:05                7502
ds-vector.sorted.php                               13-Apr-2024 02:05                7523
ds-vector.sum.php                                  13-Apr-2024 02:05                5269
ds-vector.toarray.php                              13-Apr-2024 02:05                4117
ds-vector.unshift.php                              13-Apr-2024 02:05                4728
ds.constants.php                                   13-Apr-2024 02:05                1097
ds.examples.php                                    13-Apr-2024 02:05                4666
ds.installation.php                                13-Apr-2024 02:05                2482
ds.requirements.php                                13-Apr-2024 02:05                1160
ds.setup.php                                       13-Apr-2024 02:05                1364
eio.configuration.php                              13-Apr-2024 02:05                1160
eio.constants.php                                  13-Apr-2024 02:05               22051
eio.examples.php                                   13-Apr-2024 02:05               27697
eio.installation.php                               13-Apr-2024 02:05                1804
eio.requirements.php                               13-Apr-2024 02:05                1347
eio.resources.php                                  13-Apr-2024 02:05                1237
eio.setup.php                                      13-Apr-2024 02:05                1512
emptyiterator.current.php                          13-Apr-2024 02:05                2811
emptyiterator.key.php                              13-Apr-2024 02:05                2775
emptyiterator.next.php                             13-Apr-2024 02:05                2397
emptyiterator.rewind.php                           13-Apr-2024 02:05                2419
emptyiterator.valid.php                            13-Apr-2024 02:05                2507
enchant.configuration.php                          13-Apr-2024 02:05                1190
enchant.constants.php                              13-Apr-2024 02:05                2948
enchant.examples.php                               13-Apr-2024 02:05                5368
enchant.installation.php                           13-Apr-2024 02:05                3659
enchant.requirements.php                           13-Apr-2024 02:05                1872
enchant.resources.php                              13-Apr-2024 02:05                1365
enchant.setup.php                                  13-Apr-2024 02:05                1558
error.clone.php                                    13-Apr-2024 02:05                2886
error.construct.php                                13-Apr-2024 02:05                3465
error.getcode.php                                  13-Apr-2024 02:05                4050
error.getfile.php                                  13-Apr-2024 02:05                3768
error.getline.php                                  13-Apr-2024 02:05                3977
error.getmessage.php                               13-Apr-2024 02:05                3857
error.getprevious.php                              13-Apr-2024 02:05                6632
error.gettrace.php                                 13-Apr-2024 02:05                4348
error.gettraceasstring.php                         13-Apr-2024 02:05                4151
error.tostring.php                                 13-Apr-2024 02:05                3983
errorexception.construct.php                       13-Apr-2024 02:05                6242
errorexception.getseverity.php                     13-Apr-2024 02:05                4346
errorfunc.configuration.php                        13-Apr-2024 02:05               27301
errorfunc.constants.php                            13-Apr-2024 02:05               12022
errorfunc.examples.php                             13-Apr-2024 02:05               19173
errorfunc.installation.php                         13-Apr-2024 02:05                1238
errorfunc.requirements.php                         13-Apr-2024 02:05                1178
errorfunc.resources.php                            13-Apr-2024 02:05                1179
errorfunc.setup.php                                13-Apr-2024 02:05                1574
ev.backend.php                                     13-Apr-2024 02:05                3484
ev.configuration.php                               13-Apr-2024 02:05                1155
ev.depth.php                                       13-Apr-2024 02:05                3396
ev.embeddablebackends.php                          13-Apr-2024 02:05                6668
ev.examples.php                                    13-Apr-2024 02:05               42841
ev.feedsignal.php                                  13-Apr-2024 02:05                3565
ev.feedsignalevent.php                             13-Apr-2024 02:05                3240
ev.global.constants.php                            13-Apr-2024 02:05                1275
ev.installation.php                                13-Apr-2024 02:05                1798
ev.iteration.php                                   13-Apr-2024 02:05                2700
ev.now.php                                         13-Apr-2024 02:05                3087
ev.nowupdate.php                                   13-Apr-2024 02:05                3280
ev.periodic-modes.php                              13-Apr-2024 02:05                8444
ev.recommendedbackends.php                         13-Apr-2024 02:05                7666
ev.requirements.php                                13-Apr-2024 02:05                1271
ev.resources.php                                   13-Apr-2024 02:05                1137
ev.resume.php                                      13-Apr-2024 02:05                3856
ev.run.php                                         13-Apr-2024 02:05                5308
ev.setup.php                                       13-Apr-2024 02:05                1466
ev.sleep.php                                       13-Apr-2024 02:05                2391
ev.stop.php                                        13-Apr-2024 02:05                2911
ev.supportedbackends.php                           13-Apr-2024 02:05                6651
ev.suspend.php                                     13-Apr-2024 02:05                3565
ev.time.php                                        13-Apr-2024 02:05                2647
ev.verify.php                                      13-Apr-2024 02:05                2262
ev.watcher-callbacks.php                           13-Apr-2024 02:05                5045
ev.watchers.php                                    13-Apr-2024 02:05                3854
evcheck.construct.php                              13-Apr-2024 02:05                3721
evcheck.createstopped.php                          13-Apr-2024 02:05                3877
evchild.construct.php                              13-Apr-2024 02:05                7268
evchild.createstopped.php                          13-Apr-2024 02:05                5192
evchild.set.php                                    13-Apr-2024 02:05                3169
evembed.construct.php                              13-Apr-2024 02:05                8418
evembed.createstopped.php                          13-Apr-2024 02:05                4886
evembed.set.php                                    13-Apr-2024 02:05                2577
evembed.sweep.php                                  13-Apr-2024 02:05                3116
event.add.php                                      13-Apr-2024 02:05               10279
event.addsignal.php                                13-Apr-2024 02:05                1673
event.addtimer.php                                 13-Apr-2024 02:05                1682
event.callbacks.php                                13-Apr-2024 02:05                5640
event.configuration.php                            13-Apr-2024 02:05                1176
event.construct.php                                13-Apr-2024 02:05                4534
event.constructing.signal.events.php               13-Apr-2024 02:05                5995
event.del.php                                      13-Apr-2024 02:05                2623
event.delsignal.php                                13-Apr-2024 02:05                1673
event.deltimer.php                                 13-Apr-2024 02:05                1670
event.examples.php                                 13-Apr-2024 02:05              164962
event.flags.php                                    13-Apr-2024 02:05                2561
event.free.php                                     13-Apr-2024 02:05                2990
event.getsupportedmethods.php                      13-Apr-2024 02:05                2638
event.installation.php                             13-Apr-2024 02:05                1825
event.pending.php                                  13-Apr-2024 02:05                3076
event.persistence.php                              13-Apr-2024 02:05                2894
event.requirements.php                             13-Apr-2024 02:05                1433
event.resources.php                                13-Apr-2024 02:05                1135
event.set.php                                      13-Apr-2024 02:05                4674
event.setpriority.php                              13-Apr-2024 02:05                2590
event.settimer.php                                 13-Apr-2024 02:05                4097
event.setup.php                                    13-Apr-2024 02:05                1505
event.signal.php                                   13-Apr-2024 02:05                4261
event.timer.php                                    13-Apr-2024 02:05                3557
eventbase.construct.php                            13-Apr-2024 02:05                3009
eventbase.dispatch.php                             13-Apr-2024 02:05                3316
eventbase.exit.php                                 13-Apr-2024 02:05                3083
eventbase.free.php                                 13-Apr-2024 02:05                3345
eventbase.getfeatures.php                          13-Apr-2024 02:05                5730
eventbase.getmethod.php                            13-Apr-2024 02:05                4536
eventbase.gettimeofdaycached.php                   13-Apr-2024 02:05                2715
eventbase.gotexit.php                              13-Apr-2024 02:05                3329
eventbase.gotstop.php                              13-Apr-2024 02:05                3301
eventbase.loop.php                                 13-Apr-2024 02:05                3625
eventbase.priorityinit.php                         13-Apr-2024 02:05                3060
eventbase.reinit.php                               13-Apr-2024 02:05                2413
eventbase.stop.php                                 13-Apr-2024 02:05                2876
eventbuffer.add.php                                13-Apr-2024 02:05                3061
eventbuffer.addbuffer.php                          13-Apr-2024 02:05                3413
eventbuffer.appendfrom.php                         13-Apr-2024 02:05                4890
eventbuffer.construct.php                          13-Apr-2024 02:05                1958
eventbuffer.copyout.php                            13-Apr-2024 02:05                3935
eventbuffer.drain.php                              13-Apr-2024 02:05                3536
eventbuffer.enablelocking.php                      13-Apr-2024 02:05                2873
eventbuffer.expand.php                             13-Apr-2024 02:05                2863
eventbuffer.freeze.php                             13-Apr-2024 02:05                3109
eventbuffer.lock.php                               13-Apr-2024 02:05                2998
eventbuffer.prepend.php                            13-Apr-2024 02:05                3536
eventbuffer.prependbuffer.php                      13-Apr-2024 02:05                3698
eventbuffer.pullup.php                             13-Apr-2024 02:05                4642
eventbuffer.read.php                               13-Apr-2024 02:05                4915
eventbuffer.readfrom.php                           13-Apr-2024 02:05                4348
eventbuffer.readline.php                           13-Apr-2024 02:05                4269
eventbuffer.search.php                             13-Apr-2024 02:05                8415
eventbuffer.searcheol.php                          13-Apr-2024 02:05                4949
eventbuffer.substr.php                             13-Apr-2024 02:05                3555
eventbuffer.unfreeze.php                           13-Apr-2024 02:05                3123
eventbuffer.unlock.php                             13-Apr-2024 02:05                2851
eventbuffer.write.php                              13-Apr-2024 02:05                3461
eventbufferevent.about.callbacks.php               13-Apr-2024 02:05                6105
eventbufferevent.close.php                         13-Apr-2024 02:05                2568
eventbufferevent.connect.php                       13-Apr-2024 02:05               23927
eventbufferevent.connecthost.php                   13-Apr-2024 02:05               17810
eventbufferevent.construct.php                     13-Apr-2024 02:05                6856
eventbufferevent.createpair.php                    13-Apr-2024 02:05                4312
eventbufferevent.disable.php                       13-Apr-2024 02:05                3564
eventbufferevent.enable.php                        13-Apr-2024 02:05                4034
eventbufferevent.free.php                          13-Apr-2024 02:05                2789
eventbufferevent.getdnserrorstring.php             13-Apr-2024 02:05                3108
eventbufferevent.getenabled.php                    13-Apr-2024 02:05                3057
eventbufferevent.getinput.php                      13-Apr-2024 02:05                4988
eventbufferevent.getoutput.php                     13-Apr-2024 02:05                7869
eventbufferevent.read.php                          13-Apr-2024 02:05                3057
eventbufferevent.readbuffer.php                    13-Apr-2024 02:05                3250
eventbufferevent.setcallbacks.php                  13-Apr-2024 02:05                4547
eventbufferevent.setpriority.php                   13-Apr-2024 02:05                2972
eventbufferevent.settimeouts.php                   13-Apr-2024 02:05                3197
eventbufferevent.setwatermark.php                  13-Apr-2024 02:05                4085
eventbufferevent.sslerror.php                      13-Apr-2024 02:05                5872
eventbufferevent.sslfilter.php                     13-Apr-2024 02:05               34466
eventbufferevent.sslgetcipherinfo.php              13-Apr-2024 02:05                2927
eventbufferevent.sslgetciphername.php              13-Apr-2024 02:05                2830
eventbufferevent.sslgetcipherversion.php           13-Apr-2024 02:05                2859
eventbufferevent.sslgetprotocol.php                13-Apr-2024 02:05                2736
eventbufferevent.sslrenegotiate.php                13-Apr-2024 02:05                2824
eventbufferevent.sslsocket.php                     13-Apr-2024 02:05                5880
eventbufferevent.write.php                         13-Apr-2024 02:05                3246
eventbufferevent.writebuffer.php                   13-Apr-2024 02:05                3368
eventconfig.avoidmethod.php                        13-Apr-2024 02:05                4397
eventconfig.construct.php                          13-Apr-2024 02:05                4035
eventconfig.requirefeatures.php                    13-Apr-2024 02:05                6014
eventconfig.setflags.php                           13-Apr-2024 02:05                3363
eventconfig.setmaxdispatchinterval.php             13-Apr-2024 02:05                4567
eventdnsbase.addnameserverip.php                   13-Apr-2024 02:05                2999
eventdnsbase.addsearch.php                         13-Apr-2024 02:05                2543
eventdnsbase.clearsearch.php                       13-Apr-2024 02:05                2804
eventdnsbase.construct.php                         13-Apr-2024 02:05                7510
eventdnsbase.countnameservers.php                  13-Apr-2024 02:05                2541
eventdnsbase.loadhosts.php                         13-Apr-2024 02:05                2872
eventdnsbase.parseresolvconf.php                   13-Apr-2024 02:05                4248
eventdnsbase.setoption.php                         13-Apr-2024 02:05                3446
eventdnsbase.setsearchndots.php                    13-Apr-2024 02:05                2935
eventhttp.accept.php                               13-Apr-2024 02:05               12416
eventhttp.addserveralias.php                       13-Apr-2024 02:05                6439
eventhttp.bind.php                                 13-Apr-2024 02:05                7877
eventhttp.construct.php                            13-Apr-2024 02:05               17391
eventhttp.removeserveralias.php                    13-Apr-2024 02:05                3256
eventhttp.setallowedmethods.php                    13-Apr-2024 02:05                3382
eventhttp.setcallback.php                          13-Apr-2024 02:05               18076
eventhttp.setdefaultcallback.php                   13-Apr-2024 02:05                7857
eventhttp.setmaxbodysize.php                       13-Apr-2024 02:05                2891
eventhttp.setmaxheaderssize.php                    13-Apr-2024 02:05                2803
eventhttp.settimeout.php                           13-Apr-2024 02:05                2496
eventhttpconnection.construct.php                  13-Apr-2024 02:05                5106
eventhttpconnection.getbase.php                    13-Apr-2024 02:05                2616
eventhttpconnection.getpeer.php                    13-Apr-2024 02:05                3012
eventhttpconnection.makerequest.php                13-Apr-2024 02:05               11684
eventhttpconnection.setclosecallback.php           13-Apr-2024 02:05                9406
eventhttpconnection.setlocaladdress.php            13-Apr-2024 02:05                3190
eventhttpconnection.setlocalport.php               13-Apr-2024 02:05                3078
eventhttpconnection.setmaxbodysize.php             13-Apr-2024 02:05                3115
eventhttpconnection.setmaxheaderssize.php          13-Apr-2024 02:05                3136
eventhttpconnection.setretries.php                 13-Apr-2024 02:05                2726
eventhttpconnection.settimeout.php                 13-Apr-2024 02:05                2623
eventhttprequest.addheader.php                     13-Apr-2024 02:05                3978
eventhttprequest.cancel.php                        13-Apr-2024 02:05                2843
eventhttprequest.clearheaders.php                  13-Apr-2024 02:05                2789
eventhttprequest.closeconnection.php               13-Apr-2024 02:05                2398
eventhttprequest.construct.php                     13-Apr-2024 02:05               11379
eventhttprequest.findheader.php                    13-Apr-2024 02:05                3520
eventhttprequest.free.php                          13-Apr-2024 02:05                2306
eventhttprequest.getbufferevent.php                13-Apr-2024 02:05                3669
eventhttprequest.getcommand.php                    13-Apr-2024 02:05                2680
eventhttprequest.getconnection.php                 13-Apr-2024 02:05                4423
eventhttprequest.gethost.php                       13-Apr-2024 02:05                2851
eventhttprequest.getinputbuffer.php                13-Apr-2024 02:05                2753
eventhttprequest.getinputheaders.php               13-Apr-2024 02:05                2844
eventhttprequest.getoutputbuffer.php               13-Apr-2024 02:05                2812
eventhttprequest.getoutputheaders.php              13-Apr-2024 02:05                2795
eventhttprequest.getresponsecode.php               13-Apr-2024 02:05                3131
eventhttprequest.geturi.php                        13-Apr-2024 02:05                3044
eventhttprequest.removeheader.php                  13-Apr-2024 02:05                3480
eventhttprequest.senderror.php                     13-Apr-2024 02:05                5807
eventhttprequest.sendreply.php                     13-Apr-2024 02:05                4026
eventhttprequest.sendreplychunk.php                13-Apr-2024 02:05                3398
eventhttprequest.sendreplyend.php                  13-Apr-2024 02:05                3022
eventhttprequest.sendreplystart.php                13-Apr-2024 02:05                4285
eventlistener.construct.php                        13-Apr-2024 02:05               22385
eventlistener.disable.php                          13-Apr-2024 02:05                2827
eventlistener.enable.php                           13-Apr-2024 02:05                2813
eventlistener.getbase.php                          13-Apr-2024 02:05                2319
eventlistener.getsocketname.php                    13-Apr-2024 02:05                3367
eventlistener.setcallback.php                      13-Apr-2024 02:05                6004
eventlistener.seterrorcallback.php                 13-Apr-2024 02:05                4369
eventsslcontext.construct.php                      13-Apr-2024 02:05                5262
eventutil.construct.php                            13-Apr-2024 02:05                2152
eventutil.getlastsocketerrno.php                   13-Apr-2024 02:05                3269
eventutil.getlastsocketerror.php                   13-Apr-2024 02:05                3085
eventutil.getsocketfd.php                          13-Apr-2024 02:05                3193
eventutil.getsocketname.php                        13-Apr-2024 02:05                3770
eventutil.setsocketoption.php                      13-Apr-2024 02:05                5716
eventutil.sslrandpoll.php                          13-Apr-2024 02:05                2371
evfork.construct.php                               13-Apr-2024 02:05                3740
evfork.createstopped.php                           13-Apr-2024 02:05                4072
evidle.construct.php                               13-Apr-2024 02:05                3636
evidle.createstopped.php                           13-Apr-2024 02:05                4108
evio.construct.php                                 13-Apr-2024 02:05                4784
evio.createstopped.php                             13-Apr-2024 02:05                5114
evio.set.php                                       13-Apr-2024 02:05                2808
evloop.backend.php                                 13-Apr-2024 02:05                2702
evloop.check.php                                   13-Apr-2024 02:05                3281
evloop.child.php                                   13-Apr-2024 02:05                3763
evloop.construct.php                               13-Apr-2024 02:05                4003
evloop.defaultloop.php                             13-Apr-2024 02:05                4594
evloop.embed.php                                   13-Apr-2024 02:05                3796
evloop.fork.php                                    13-Apr-2024 02:05                3363
evloop.idle.php                                    13-Apr-2024 02:05                3367
evloop.invokepending.php                           13-Apr-2024 02:05                2213
evloop.io.php                                      13-Apr-2024 02:05                3803
evloop.loopfork.php                                13-Apr-2024 02:05                2551
evloop.now.php                                     13-Apr-2024 02:05                2818
evloop.nowupdate.php                               13-Apr-2024 02:05                3127
evloop.periodic.php                                13-Apr-2024 02:05                3941
evloop.prepare.php                                 13-Apr-2024 02:05                3385
evloop.resume.php                                  13-Apr-2024 02:05                2821
evloop.run.php                                     13-Apr-2024 02:05                5040
evloop.signal.php                                  13-Apr-2024 02:05                3670
evloop.stat.php                                    13-Apr-2024 02:05                3851
evloop.stop.php                                    13-Apr-2024 02:05                2958
evloop.suspend.php                                 13-Apr-2024 02:05                2808
evloop.timer.php                                   13-Apr-2024 02:05                3868
evloop.verify.php                                  13-Apr-2024 02:05                2557
evperiodic.again.php                               13-Apr-2024 02:05                2541
evperiodic.at.php                                  13-Apr-2024 02:05                2620
evperiodic.construct.php                           13-Apr-2024 02:05                9966
evperiodic.createstopped.php                       13-Apr-2024 02:05                5816
evperiodic.set.php                                 13-Apr-2024 02:05                3165
evprepare.construct.php                            13-Apr-2024 02:05                3696
evprepare.createstopped.php                        13-Apr-2024 02:05                4487
evsignal.construct.php                             13-Apr-2024 02:05                5450
evsignal.createstopped.php                         13-Apr-2024 02:05                4796
evsignal.set.php                                   13-Apr-2024 02:05                2465
evstat.attr.php                                    13-Apr-2024 02:05                8186
evstat.construct.php                               13-Apr-2024 02:05                7175
evstat.createstopped.php                           13-Apr-2024 02:05                5172
evstat.prev.php                                    13-Apr-2024 02:05                2909
evstat.set.php                                     13-Apr-2024 02:05                2824
evstat.stat.php                                    13-Apr-2024 02:05                2966
evtimer.again.php                                  13-Apr-2024 02:05                3036
evtimer.construct.php                              13-Apr-2024 02:05               12632
evtimer.createstopped.php                          13-Apr-2024 02:05                8301
evtimer.set.php                                    13-Apr-2024 02:05                2981
evwatcher.clear.php                                13-Apr-2024 02:05                2807
evwatcher.construct.php                            13-Apr-2024 02:05                2093
evwatcher.feed.php                                 13-Apr-2024 02:05                2578
evwatcher.getloop.php                              13-Apr-2024 02:05                2293
evwatcher.invoke.php                               13-Apr-2024 02:05                2585
evwatcher.keepalive.php                            13-Apr-2024 02:05                5288
evwatcher.setcallback.php                          13-Apr-2024 02:05                2540
evwatcher.start.php                                13-Apr-2024 02:05                2483
evwatcher.stop.php                                 13-Apr-2024 02:05                2452
example.xml-external-entity.php                    13-Apr-2024 02:05               21856
example.xml-map-tags.php                           13-Apr-2024 02:05                8298
example.xml-structure.php                          13-Apr-2024 02:05                6291
example.xmlwriter-namespace.php                    13-Apr-2024 02:05                5394
example.xmlwriter-oop.php                          13-Apr-2024 02:05                3413
example.xmlwriter-simple.php                       13-Apr-2024 02:05                8639
exception.clone.php                                13-Apr-2024 02:05                3108
exception.construct.php                            13-Apr-2024 02:05                3829
exception.getcode.php                              13-Apr-2024 02:05                4399
exception.getfile.php                              13-Apr-2024 02:05                3881
exception.getline.php                              13-Apr-2024 02:05                4080
exception.getmessage.php                           13-Apr-2024 02:05                3952
exception.getprevious.php                          13-Apr-2024 02:05                6879
exception.gettrace.php                             13-Apr-2024 02:05                4376
exception.gettraceasstring.php                     13-Apr-2024 02:05                4252
exception.tostring.php                             13-Apr-2024 02:05                3973
exec.configuration.php                             13-Apr-2024 02:05                1169
exec.constants.php                                 13-Apr-2024 02:05                1127
exec.installation.php                              13-Apr-2024 02:05                1203
exec.requirements.php                              13-Apr-2024 02:05                1143
exec.resources.php                                 13-Apr-2024 02:05                1343
exec.setup.php                                     13-Apr-2024 02:05                1532
exif.configuration.php                             13-Apr-2024 02:05                8079
exif.constants.php                                 13-Apr-2024 02:05                2091
exif.installation.php                              13-Apr-2024 02:05                1794
exif.requirements.php                              13-Apr-2024 02:05                1998
exif.resources.php                                 13-Apr-2024 02:05                1144
exif.setup.php                                     13-Apr-2024 02:05                1526
expect.configuration.php                           13-Apr-2024 02:05                5674
expect.constants.php                               13-Apr-2024 02:05                3968
expect.examples-usage.php                          13-Apr-2024 02:05               12383
expect.examples.php                                13-Apr-2024 02:05                1326
expect.installation.php                            13-Apr-2024 02:05                2539
expect.requirements.php                            13-Apr-2024 02:05                1327
expect.resources.php                               13-Apr-2024 02:05                1424
expect.setup.php                                   13-Apr-2024 02:05                1551
extensions.alphabetical.php                        13-Apr-2024 02:05               20936
extensions.membership.php                          13-Apr-2024 02:05               20784
extensions.php                                     13-Apr-2024 02:05                1672
extensions.state.php                               13-Apr-2024 02:05                2812
fann.configuration.php                             13-Apr-2024 02:05                1169
fann.constants.php                                 13-Apr-2024 02:05               23593
fann.examples-1.php                                13-Apr-2024 02:05                8436
fann.examples.php                                  13-Apr-2024 02:05                1284
fann.installation.php                              13-Apr-2024 02:05                4871
fann.requirements.php                              13-Apr-2024 02:05                1141
fann.resources.php                                 13-Apr-2024 02:05                1100
fann.setup.php                                     13-Apr-2024 02:05                1496
fannconnection.construct.php                       13-Apr-2024 02:05                2971
fannconnection.getfromneuron.php                   13-Apr-2024 02:05                2346
fannconnection.gettoneuron.php                     13-Apr-2024 02:05                2334
fannconnection.getweight.php                       13-Apr-2024 02:05                2269
fannconnection.setweight.php                       13-Apr-2024 02:05                2897
faq.build.php                                      13-Apr-2024 02:05               26972
faq.com.php                                        13-Apr-2024 02:05               14001
faq.databases.php                                  13-Apr-2024 02:05                9300
faq.general.php                                    13-Apr-2024 02:05                5385
faq.html.php                                       13-Apr-2024 02:05               21993
faq.installation.php                               13-Apr-2024 02:05               29399
faq.mailinglist.php                                13-Apr-2024 02:05               12932
faq.misc.php                                       13-Apr-2024 02:05                5054
faq.obtaining.php                                  13-Apr-2024 02:05               11794
faq.passwords.php                                  13-Apr-2024 02:05               11477
faq.php                                            13-Apr-2024 02:05                2065
faq.using.php                                      13-Apr-2024 02:05               23093
fdf.configuration.php                              13-Apr-2024 02:05                1162
fdf.constants.php                                  13-Apr-2024 02:05                9206
fdf.examples.php                                   13-Apr-2024 02:05                6063
fdf.installation.php                               13-Apr-2024 02:05                3912
fdf.requirements.php                               13-Apr-2024 02:05                1568
fdf.resources.php                                  13-Apr-2024 02:05                1757
fdf.setup.php                                      13-Apr-2024 02:05                1505
features.commandline.differences.php               13-Apr-2024 02:05               13302
features.commandline.ini.php                       13-Apr-2024 02:05                2378
features.commandline.interactive.php               13-Apr-2024 02:05                9895
features.commandline.introduction.php              13-Apr-2024 02:05                7112
features.commandline.io-streams.php                13-Apr-2024 02:05                6231
features.commandline.options.php                   13-Apr-2024 02:05               28382
features.commandline.php                           13-Apr-2024 02:05                2047
features.commandline.usage.php                     13-Apr-2024 02:05               16384
features.commandline.webserver.php                 13-Apr-2024 02:05               14294
features.connection-handling.php                   13-Apr-2024 02:05                6584
features.cookies.php                               13-Apr-2024 02:05                3210
features.dtrace.dtrace.php                         13-Apr-2024 02:05               15499
features.dtrace.introduction.php                   13-Apr-2024 02:05                3867
features.dtrace.php                                13-Apr-2024 02:05                1646
features.dtrace.systemtap.php                      13-Apr-2024 02:05                8411
features.file-upload.common-pitfalls.php           13-Apr-2024 02:05                5761
features.file-upload.errors.php                    13-Apr-2024 02:05                4179
features.file-upload.errors.seealso.php            13-Apr-2024 02:05                1352
features.file-upload.multiple.php                  13-Apr-2024 02:05                7377
features.file-upload.php                           13-Apr-2024 02:05                1929
features.file-upload.post-method.php               13-Apr-2024 02:05               18008
features.file-upload.put-method.php                13-Apr-2024 02:05                6456
features.gc.collecting-cycles.php                  13-Apr-2024 02:05                9676
features.gc.performance-considerations.php         13-Apr-2024 02:05               15376
features.gc.php                                    13-Apr-2024 02:05                1772
features.gc.refcounting-basics.php                 13-Apr-2024 02:05               23099
features.http-auth.php                             13-Apr-2024 02:05               24353
features.persistent-connections.php                13-Apr-2024 02:05               10140
features.php                                       13-Apr-2024 02:05                4220
features.remote-files.php                          13-Apr-2024 02:05                8308
features.session.security.management.php           13-Apr-2024 02:05               31203
features.sessions.php                              13-Apr-2024 02:05                1559
features.xforms.php                                13-Apr-2024 02:05                5839
ffi-ctype.getalignment.php                         13-Apr-2024 02:05                2364
ffi-ctype.getarrayelementtype.php                  13-Apr-2024 02:05                2450
ffi-ctype.getarraylength.php                       13-Apr-2024 02:05                2407
ffi-ctype.getattributes.php                        13-Apr-2024 02:05                2383
ffi-ctype.getenumkind.php                          13-Apr-2024 02:05                2359
ffi-ctype.getfuncabi.php                           13-Apr-2024 02:05                2367
ffi-ctype.getfuncparametercount.php                13-Apr-2024 02:05                2473
ffi-ctype.getfuncparametertype.php                 13-Apr-2024 02:05                2696
ffi-ctype.getfuncreturntype.php                    13-Apr-2024 02:05                2432
ffi-ctype.getkind.php                              13-Apr-2024 02:05                2321
ffi-ctype.getname.php                              13-Apr-2024 02:05                2327
ffi-ctype.getpointertype.php                       13-Apr-2024 02:05                2376
ffi-ctype.getsize.php                              13-Apr-2024 02:05                2339
ffi-ctype.getstructfieldnames.php                  13-Apr-2024 02:05                2449
ffi-ctype.getstructfieldoffset.php                 13-Apr-2024 02:05                2692
ffi-ctype.getstructfieldtype.php                   13-Apr-2024 02:05                2654
ffi.addr.php                                       13-Apr-2024 02:05                2739
ffi.alignof.php                                    13-Apr-2024 02:05                2869
ffi.arraytype.php                                  13-Apr-2024 02:05                4569
ffi.cast.php                                       13-Apr-2024 02:05                4782
ffi.cdef.php                                       13-Apr-2024 02:05                4404
ffi.configuration.php                              13-Apr-2024 02:05                4290
ffi.constants.php                                  13-Apr-2024 02:05                1080
ffi.examples-basic.php                             13-Apr-2024 02:05               15785
ffi.examples-callback.php                          13-Apr-2024 02:05                4730
ffi.examples-complete.php                          13-Apr-2024 02:05                5398
ffi.examples.php                                   13-Apr-2024 02:05                1441
ffi.free.php                                       13-Apr-2024 02:05                2379
ffi.installation.php                               13-Apr-2024 02:05                1395
ffi.isnull.php                                     13-Apr-2024 02:05                2482
ffi.load.php                                       13-Apr-2024 02:05                4246
ffi.memcmp.php                                     13-Apr-2024 02:05                4047
ffi.memcpy.php                                     13-Apr-2024 02:05                3231
ffi.memset.php                                     13-Apr-2024 02:05                3071
ffi.new.php                                        13-Apr-2024 02:05                5114
ffi.requirements.php                               13-Apr-2024 02:05                1237
ffi.resources.php                                  13-Apr-2024 02:05                1137
ffi.scope.php                                      13-Apr-2024 02:05                3085
ffi.setup.php                                      13-Apr-2024 02:05                1494
ffi.sizeof.php                                     13-Apr-2024 02:05                2710
ffi.string.php                                     13-Apr-2024 02:05                4151
ffi.type.php                                       13-Apr-2024 02:05                3528
ffi.typeof.php                                     13-Apr-2024 02:05                2803
fiber.construct.php                                13-Apr-2024 02:05                2395
fiber.getcurrent.php                               13-Apr-2024 02:05                2567
fiber.getreturn.php                                13-Apr-2024 02:05                2668
fiber.isrunning.php                                13-Apr-2024 02:05                2891
fiber.isstarted.php                                13-Apr-2024 02:05                2385
fiber.issuspended.php                              13-Apr-2024 02:05                2389
fiber.isterminated.php                             13-Apr-2024 02:05                2482
fiber.resume.php                                   13-Apr-2024 02:05                3560
fiber.start.php                                    13-Apr-2024 02:05                3199
fiber.suspend.php                                  13-Apr-2024 02:05                4507
fiber.throw.php                                    13-Apr-2024 02:05                3451
fibererror.construct.php                           13-Apr-2024 02:05                2244
fileinfo.configuration.php                         13-Apr-2024 02:05                1197
fileinfo.constants.php                             13-Apr-2024 02:05                6441
fileinfo.installation.php                          13-Apr-2024 02:05                1836
fileinfo.requirements.php                          13-Apr-2024 02:05                1171
fileinfo.resources.php                             13-Apr-2024 02:05                1422
fileinfo.setup.php                                 13-Apr-2024 02:05                1570
filesystem.configuration.php                       13-Apr-2024 02:05                8051
filesystem.constants.php                           13-Apr-2024 02:05               14284
filesystem.installation.php                        13-Apr-2024 02:05                1245
filesystem.requirements.php                        13-Apr-2024 02:05                1185
filesystem.resources.php                           13-Apr-2024 02:05                1419
filesystem.setup.php                               13-Apr-2024 02:05                1611
filesystemiterator.construct.php                   13-Apr-2024 02:05                7917
filesystemiterator.current.php                     13-Apr-2024 02:05                5487
filesystemiterator.getflags.php                    13-Apr-2024 02:05                3248
filesystemiterator.key.php                         13-Apr-2024 02:05                5181
filesystemiterator.next.php                        13-Apr-2024 02:05                4537
filesystemiterator.rewind.php                      13-Apr-2024 02:05                5106
filesystemiterator.setflags.php                    13-Apr-2024 02:05                6696
filter.configuration.php                           13-Apr-2024 02:05                5412
filter.constants.php                               13-Apr-2024 02:05               26159
filter.examples.php                                13-Apr-2024 02:05                1377
filter.examples.sanitization.php                   13-Apr-2024 02:05                5618
filter.examples.validation.php                     13-Apr-2024 02:05               10299
filter.filters.flags.php                           13-Apr-2024 02:05               17795
filter.filters.misc.php                            13-Apr-2024 02:05                1994
filter.filters.php                                 13-Apr-2024 02:05                1586
filter.filters.sanitize.php                        13-Apr-2024 02:05               14777
filter.filters.validate.php                        13-Apr-2024 02:05               15715
filter.installation.php                            13-Apr-2024 02:05                1363
filter.requirements.php                            13-Apr-2024 02:05                1157
filter.resources.php                               13-Apr-2024 02:05                1156
filter.setup.php                                   13-Apr-2024 02:05                1537
filteriterator.accept.php                          13-Apr-2024 02:05                5376
filteriterator.construct.php                       13-Apr-2024 02:05                3112
filteriterator.current.php                         13-Apr-2024 02:05                3027
filteriterator.key.php                             13-Apr-2024 02:05                2975
filteriterator.next.php                            13-Apr-2024 02:05                2977
filteriterator.rewind.php                          13-Apr-2024 02:05                3166
filteriterator.valid.php                           13-Apr-2024 02:05                2726
filters.compression.php                            13-Apr-2024 02:05               16617
filters.convert.php                                13-Apr-2024 02:05               12183
filters.encryption.php                             13-Apr-2024 02:05               41158
filters.php                                        13-Apr-2024 02:05                3710
filters.string.php                                 13-Apr-2024 02:05               10240
finfo.buffer.php                                   13-Apr-2024 02:05                2874
finfo.construct.php                                13-Apr-2024 02:05                3070
finfo.file.php                                     13-Apr-2024 02:05                2865
finfo.set-flags.php                                13-Apr-2024 02:05                2092
fpm.observability.php                              13-Apr-2024 02:05                1422
fpm.setup.php                                      13-Apr-2024 02:05                1297
fpm.status.php                                     13-Apr-2024 02:05               11619
ftp.configuration.php                              13-Apr-2024 02:05                1162
ftp.constants.php                                  13-Apr-2024 02:05                5486
ftp.examples-basic.php                             13-Apr-2024 02:05                4822
ftp.examples.php                                   13-Apr-2024 02:05                1300
ftp.installation.php                               13-Apr-2024 02:05                1580
ftp.requirements.php                               13-Apr-2024 02:05                1136
ftp.resources.php                                  13-Apr-2024 02:05                1534
ftp.setup.php                                      13-Apr-2024 02:05                1506
funchand.configuration.php                         13-Apr-2024 02:05                1197
funchand.constants.php                             13-Apr-2024 02:05                1135
funchand.installation.php                          13-Apr-2024 02:05                1231
funchand.requirements.php                          13-Apr-2024 02:05                1171
funchand.resources.php                             13-Apr-2024 02:05                1172
funchand.setup.php                                 13-Apr-2024 02:05                1552
funcref.php                                        13-Apr-2024 02:05               14283
function.abs.php                                   13-Apr-2024 02:05                5655
function.acos.php                                  13-Apr-2024 02:05                3619
function.acosh.php                                 13-Apr-2024 02:05                3456
function.addcslashes.php                           13-Apr-2024 02:05                8471
function.addslashes.php                            13-Apr-2024 02:05                6671
function.apache-child-terminate.php                13-Apr-2024 02:05                3535
function.apache-get-modules.php                    13-Apr-2024 02:05                3485
function.apache-get-version.php                    13-Apr-2024 02:05                3938
function.apache-getenv.php                         13-Apr-2024 02:05                5270
function.apache-lookup-uri.php                     13-Apr-2024 02:05                5933
function.apache-note.php                           13-Apr-2024 02:05                7440
function.apache-request-headers.php                13-Apr-2024 02:05                5929
function.apache-response-headers.php               13-Apr-2024 02:05                4500
function.apache-setenv.php                         13-Apr-2024 02:05                5793
function.apcu-add.php                              13-Apr-2024 02:05                8909
function.apcu-cache-info.php                       13-Apr-2024 02:05                7044
function.apcu-cas.php                              13-Apr-2024 02:05                8800
function.apcu-clear-cache.php                      13-Apr-2024 02:05                2641
function.apcu-dec.php                              13-Apr-2024 02:05                8230
function.apcu-delete.php                           13-Apr-2024 02:05                5997
function.apcu-enabled.php                          13-Apr-2024 02:05                2402
function.apcu-entry.php                            13-Apr-2024 02:05                8987
function.apcu-exists.php                           13-Apr-2024 02:05                6845
function.apcu-fetch.php                            13-Apr-2024 02:05                5961
function.apcu-inc.php                              13-Apr-2024 02:05                8221
function.apcu-key-info.php                         13-Apr-2024 02:05                5066
function.apcu-sma-info.php                         13-Apr-2024 02:05                4711
function.apcu-store.php                            13-Apr-2024 02:05                7723
function.array-change-key-case.php                 13-Apr-2024 02:05                5416
function.array-chunk.php                           13-Apr-2024 02:05                7875
function.array-column.php                          13-Apr-2024 02:05               17505
function.array-combine.php                         13-Apr-2024 02:05                7434
function.array-count-values.php                    13-Apr-2024 02:05                5866
function.array-diff-assoc.php                      13-Apr-2024 02:05               11626
function.array-diff-key.php                        13-Apr-2024 02:05               13016
function.array-diff-uassoc.php                     13-Apr-2024 02:05               12920
function.array-diff-ukey.php                       13-Apr-2024 02:05               12502
function.array-diff.php                            13-Apr-2024 02:05               12398
function.array-fill-keys.php                       13-Apr-2024 02:05                5383
function.array-fill.php                            13-Apr-2024 02:05                9636
function.array-filter.php                          13-Apr-2024 02:05               17103
function.array-flip.php                            13-Apr-2024 02:05                7176
function.array-intersect-assoc.php                 13-Apr-2024 02:05                9148
function.array-intersect-key.php                   13-Apr-2024 02:05               10379
function.array-intersect-uassoc.php                13-Apr-2024 02:05                9239
function.array-intersect-ukey.php                  13-Apr-2024 02:05               12281
function.array-intersect.php                       13-Apr-2024 02:05                7107
function.array-is-list.php                         13-Apr-2024 02:05                7041
function.array-key-exists.php                      13-Apr-2024 02:05               10313
function.array-key-first.php                       13-Apr-2024 02:05                7335
function.array-key-last.php                        13-Apr-2024 02:05                3438
function.array-keys.php                            13-Apr-2024 02:05                8508
function.array-map.php                             13-Apr-2024 02:05               28202
function.array-merge-recursive.php                 13-Apr-2024 02:05                7057
function.array-merge.php                           13-Apr-2024 02:05               12737
function.array-multisort.php                       13-Apr-2024 02:05               24598
function.array-pad.php                             13-Apr-2024 02:05                7679
function.array-pop.php                             13-Apr-2024 02:05                5709
function.array-product.php                         13-Apr-2024 02:05                5526
function.array-push.php                            13-Apr-2024 02:05                7370
function.array-rand.php                            13-Apr-2024 02:05               10654
function.array-reduce.php                          13-Apr-2024 02:05               10137
function.array-replace-recursive.php               13-Apr-2024 02:05               11327
function.array-replace.php                         13-Apr-2024 02:05                6910
function.array-reverse.php                         13-Apr-2024 02:05                6089
function.array-search.php                          13-Apr-2024 02:05                8669
function.array-shift.php                           13-Apr-2024 02:05                5791
function.array-slice.php                           13-Apr-2024 02:05               14033
function.array-splice.php                          13-Apr-2024 02:05               18108
function.array-sum.php                             13-Apr-2024 02:05                6266
function.array-udiff-assoc.php                     13-Apr-2024 02:05               18442
function.array-udiff-uassoc.php                    13-Apr-2024 02:05               19897
function.array-udiff.php                           13-Apr-2024 02:05               30640
function.array-uintersect-assoc.php                13-Apr-2024 02:05               12207
function.array-uintersect-uassoc.php               13-Apr-2024 02:05               12539
function.array-uintersect.php                      13-Apr-2024 02:05               11747
function.array-unique.php                          13-Apr-2024 02:05               10074
function.array-unshift.php                         13-Apr-2024 02:05               11316
function.array-values.php                          13-Apr-2024 02:05                4596
function.array-walk-recursive.php                  13-Apr-2024 02:05                7856
function.array-walk.php                            13-Apr-2024 02:05               14553
function.array.php                                 13-Apr-2024 02:05               12257
function.arsort.php                                13-Apr-2024 02:05                9680
function.asin.php                                  13-Apr-2024 02:05                3611
function.asinh.php                                 13-Apr-2024 02:05                3446
function.asort.php                                 13-Apr-2024 02:05                9679
function.assert-options.php                        13-Apr-2024 02:05               14764
function.assert.php                                13-Apr-2024 02:05               23960
function.atan.php                                  13-Apr-2024 02:05                3647
function.atan2.php                                 13-Apr-2024 02:05                3508
function.atanh.php                                 13-Apr-2024 02:05                3505
function.autoload.php                              13-Apr-2024 02:05                3218
function.base-convert.php                          13-Apr-2024 02:05                6793
function.base64-decode.php                         13-Apr-2024 02:05                5403
function.base64-encode.php                         13-Apr-2024 02:05                4893
function.basename.php                              13-Apr-2024 02:05                7788
function.bcadd.php                                 13-Apr-2024 02:05                5867
function.bccomp.php                                13-Apr-2024 02:05                5779
function.bcdiv.php                                 13-Apr-2024 02:05                5449
function.bcmod.php                                 13-Apr-2024 02:05                7558
function.bcmul.php                                 13-Apr-2024 02:05                7424
function.bcpow.php                                 13-Apr-2024 02:05                7477
function.bcpowmod.php                              13-Apr-2024 02:05                7602
function.bcscale.php                               13-Apr-2024 02:05                5823
function.bcsqrt.php                                13-Apr-2024 02:05                6536
function.bcsub.php                                 13-Apr-2024 02:05                5231
function.bin2hex.php                               13-Apr-2024 02:05                4506
function.bind-textdomain-codeset.php               13-Apr-2024 02:05                4790
function.bindec.php                                13-Apr-2024 02:05               15182
function.bindtextdomain.php                        13-Apr-2024 02:05                5745
function.boolval.php                               13-Apr-2024 02:05               10208
function.bzclose.php                               13-Apr-2024 02:05                3169
function.bzcompress.php                            13-Apr-2024 02:05                5224
function.bzdecompress.php                          13-Apr-2024 02:05                6743
function.bzerrno.php                               13-Apr-2024 02:05                3208
function.bzerror.php                               13-Apr-2024 02:05                4419
function.bzerrstr.php                              13-Apr-2024 02:05                3227
function.bzflush.php                               13-Apr-2024 02:05                3556
function.bzopen.php                                13-Apr-2024 02:05                5387
function.bzread.php                                13-Apr-2024 02:05                6776
function.bzwrite.php                               13-Apr-2024 02:05                6548
function.cal-days-in-month.php                     13-Apr-2024 02:05                4641
function.cal-from-jd.php                           13-Apr-2024 02:05                7161
function.cal-info.php                              13-Apr-2024 02:05                6163
function.cal-to-jd.php                             13-Apr-2024 02:05                6215
function.call-user-func-array.php                  13-Apr-2024 02:05               17977
function.call-user-func.php                        13-Apr-2024 02:05               14589
function.ceil.php                                  13-Apr-2024 02:05                5209
function.chdir.php                                 13-Apr-2024 02:05                5861
function.checkdate.php                             13-Apr-2024 02:05                5675
function.checkdnsrr.php                            13-Apr-2024 02:05                5341
function.chgrp.php                                 13-Apr-2024 02:05                7062
function.chmod.php                                 13-Apr-2024 02:05                9378
function.chop.php                                  13-Apr-2024 02:05                2026
function.chown.php                                 13-Apr-2024 02:05                7129
function.chr.php                                   13-Apr-2024 02:05                9397
function.chroot.php                                13-Apr-2024 02:05                4923
function.chunk-split.php                           13-Apr-2024 02:05                5286
function.class-alias.php                           13-Apr-2024 02:05                8630
function.class-exists.php                          13-Apr-2024 02:05                7188
function.class-implements.php                      13-Apr-2024 02:05                7662
function.class-parents.php                         13-Apr-2024 02:05                7253
function.class-uses.php                            13-Apr-2024 02:05                6497
function.clearstatcache.php                        13-Apr-2024 02:05               11313
function.cli-get-process-title.php                 13-Apr-2024 02:05                4638
function.cli-set-process-title.php                 13-Apr-2024 02:05                5684
function.closedir.php                              13-Apr-2024 02:05                4978
function.closelog.php                              13-Apr-2024 02:05                2964
function.com-create-guid.php                       13-Apr-2024 02:05                2912
function.com-event-sink.php                        13-Apr-2024 02:05               10938
function.com-get-active-object.php                 13-Apr-2024 02:05                6224
function.com-load-typelib.php                      13-Apr-2024 02:05                5693
function.com-message-pump.php                      13-Apr-2024 02:05                4297
function.com-print-typeinfo.php                    13-Apr-2024 02:05                5486
function.commonmark-parse.php                      13-Apr-2024 02:05                4107
function.commonmark-render-html.php                13-Apr-2024 02:05                4694
function.commonmark-render-latex.php               13-Apr-2024 02:05                5024
function.commonmark-render-man.php                 13-Apr-2024 02:05                5006
function.commonmark-render-xml.php                 13-Apr-2024 02:05                4651
function.commonmark-render.php                     13-Apr-2024 02:05                4952
function.compact.php                               13-Apr-2024 02:05                8287
function.connection-aborted.php                    13-Apr-2024 02:05                3183
function.connection-status.php                     13-Apr-2024 02:05                3322
function.constant.php                              13-Apr-2024 02:05                9385
function.convert-cyr-string.php                    13-Apr-2024 02:05                5269
function.convert-uudecode.php                      13-Apr-2024 02:05                4551
function.convert-uuencode.php                      13-Apr-2024 02:05                5583
function.copy.php                                  13-Apr-2024 02:05                6186
function.cos.php                                   13-Apr-2024 02:05                3999
function.cosh.php                                  13-Apr-2024 02:05                3379
function.count-chars.php                           13-Apr-2024 02:05                7547
function.count.php                                 13-Apr-2024 02:05               16559
function.crc32.php                                 13-Apr-2024 02:05                7444
function.create-function.php                       13-Apr-2024 02:05               31665
function.crypt.php                                 13-Apr-2024 02:05               14143
function.ctype-alnum.php                           13-Apr-2024 02:05                6838
function.ctype-alpha.php                           13-Apr-2024 02:05                7295
function.ctype-cntrl.php                           13-Apr-2024 02:05                6870
function.ctype-digit.php                           13-Apr-2024 02:05                9025
function.ctype-graph.php                           13-Apr-2024 02:05                7527
function.ctype-lower.php                           13-Apr-2024 02:05                7165
function.ctype-print.php                           13-Apr-2024 02:05                7560
function.ctype-punct.php                           13-Apr-2024 02:05                6888
function.ctype-space.php                           13-Apr-2024 02:05                7650
function.ctype-upper.php                           13-Apr-2024 02:05                7040
function.ctype-xdigit.php                          13-Apr-2024 02:05                6739
function.cubrid-affected-rows.php                  13-Apr-2024 02:05                9343
function.cubrid-bind.php                           13-Apr-2024 02:05               20668
function.cubrid-client-encoding.php                13-Apr-2024 02:05                5234
function.cubrid-close-prepare.php                  13-Apr-2024 02:05                6204
function.cubrid-close-request.php                  13-Apr-2024 02:05                6215
function.cubrid-close.php                          13-Apr-2024 02:05                6339
function.cubrid-col-get.php                        13-Apr-2024 02:05                8525
function.cubrid-col-size.php                       13-Apr-2024 02:05                8645
function.cubrid-column-names.php                   13-Apr-2024 02:05                8481
function.cubrid-column-types.php                   13-Apr-2024 02:05                8461
function.cubrid-commit.php                         13-Apr-2024 02:05               15309
function.cubrid-connect-with-url.php               13-Apr-2024 02:05               15064
function.cubrid-connect.php                        13-Apr-2024 02:05               12295
function.cubrid-current-oid.php                    13-Apr-2024 02:05                5962
function.cubrid-data-seek.php                      13-Apr-2024 02:05                7424
function.cubrid-db-name.php                        13-Apr-2024 02:05                6537
function.cubrid-disconnect.php                     13-Apr-2024 02:05                7100
function.cubrid-drop.php                           13-Apr-2024 02:05               11404
function.cubrid-errno.php                          13-Apr-2024 02:05                6763
function.cubrid-error-code-facility.php            13-Apr-2024 02:05                5799
function.cubrid-error-code.php                     13-Apr-2024 02:05                5709
function.cubrid-error-msg.php                      13-Apr-2024 02:05                5159
function.cubrid-error.php                          13-Apr-2024 02:05                6323
function.cubrid-execute.php                        13-Apr-2024 02:05               14344
function.cubrid-fetch-array.php                    13-Apr-2024 02:05                9764
function.cubrid-fetch-assoc.php                    13-Apr-2024 02:05                8998
function.cubrid-fetch-field.php                    13-Apr-2024 02:05               14036
function.cubrid-fetch-lengths.php                  13-Apr-2024 02:05                6088
function.cubrid-fetch-object.php                   13-Apr-2024 02:05               11943
function.cubrid-fetch-row.php                      13-Apr-2024 02:05                8922
function.cubrid-fetch.php                          13-Apr-2024 02:05                9904
function.cubrid-field-flags.php                    13-Apr-2024 02:05                7744
function.cubrid-field-len.php                      13-Apr-2024 02:05                8253
function.cubrid-field-name.php                     13-Apr-2024 02:05                7159
function.cubrid-field-seek.php                     13-Apr-2024 02:05               10911
function.cubrid-field-table.php                    13-Apr-2024 02:05                7364
function.cubrid-field-type.php                     13-Apr-2024 02:05                7426
function.cubrid-free-result.php                    13-Apr-2024 02:05                5923
function.cubrid-get-autocommit.php                 13-Apr-2024 02:05                3761
function.cubrid-get-charset.php                    13-Apr-2024 02:05                4974
function.cubrid-get-class-name.php                 13-Apr-2024 02:05                6304
function.cubrid-get-client-info.php                13-Apr-2024 02:05                8114
function.cubrid-get-db-parameter.php               13-Apr-2024 02:05               14273
function.cubrid-get-query-timeout.php              13-Apr-2024 02:05                6690
function.cubrid-get-server-info.php                13-Apr-2024 02:05                8405
function.cubrid-get.php                            13-Apr-2024 02:05                9814
function.cubrid-insert-id.php                      13-Apr-2024 02:05                7105
function.cubrid-is-instance.php                    13-Apr-2024 02:05                7138
function.cubrid-list-dbs.php                       13-Apr-2024 02:05                4506
function.cubrid-load-from-glo.php                  13-Apr-2024 02:05                6859
function.cubrid-lob-close.php                      13-Apr-2024 02:05                7233
function.cubrid-lob-export.php                     13-Apr-2024 02:05                7798
function.cubrid-lob-get.php                        13-Apr-2024 02:05                7591
function.cubrid-lob-send.php                       13-Apr-2024 02:05                6973
function.cubrid-lob-size.php                       13-Apr-2024 02:05                5789
function.cubrid-lob2-bind.php                      13-Apr-2024 02:05                9683
function.cubrid-lob2-close.php                     13-Apr-2024 02:05                3385
function.cubrid-lob2-export.php                    13-Apr-2024 02:05                8676
function.cubrid-lob2-import.php                    13-Apr-2024 02:05                8545
function.cubrid-lob2-new.php                       13-Apr-2024 02:05                3899
function.cubrid-lob2-read.php                      13-Apr-2024 02:05               13628
function.cubrid-lob2-seek.php                      13-Apr-2024 02:05               11207
function.cubrid-lob2-seek64.php                    13-Apr-2024 02:05               12629
function.cubrid-lob2-size.php                      13-Apr-2024 02:05                4280
function.cubrid-lob2-size64.php                    13-Apr-2024 02:05                4460
function.cubrid-lob2-tell.php                      13-Apr-2024 02:05                4299
function.cubrid-lob2-tell64.php                    13-Apr-2024 02:05                4497
function.cubrid-lob2-write.php                     13-Apr-2024 02:05               13963
function.cubrid-lock-read.php                      13-Apr-2024 02:05                9125
function.cubrid-lock-write.php                     13-Apr-2024 02:05                9513
function.cubrid-move-cursor.php                    13-Apr-2024 02:05                9497
function.cubrid-new-glo.php                        13-Apr-2024 02:05                6901
function.cubrid-next-result.php                    13-Apr-2024 02:05               16284
function.cubrid-num-cols.php                       13-Apr-2024 02:05                5935
function.cubrid-num-fields.php                     13-Apr-2024 02:05                5653
function.cubrid-num-rows.php                       13-Apr-2024 02:05                7119
function.cubrid-pconnect-with-url.php              13-Apr-2024 02:05               14391
function.cubrid-pconnect.php                       13-Apr-2024 02:05               12076
function.cubrid-ping.php                           13-Apr-2024 02:05                6027
function.cubrid-prepare.php                        13-Apr-2024 02:05               10231
function.cubrid-put.php                            13-Apr-2024 02:05               11346
function.cubrid-query.php                          13-Apr-2024 02:05               14653
function.cubrid-real-escape-string.php             13-Apr-2024 02:05                8174
function.cubrid-result.php                         13-Apr-2024 02:05                7384
function.cubrid-rollback.php                       13-Apr-2024 02:05               14604
function.cubrid-save-to-glo.php                    13-Apr-2024 02:05                6763
function.cubrid-schema.php                         13-Apr-2024 02:05               20436
function.cubrid-send-glo.php                       13-Apr-2024 02:05                6230
function.cubrid-seq-drop.php                       13-Apr-2024 02:05                9774
function.cubrid-seq-insert.php                     13-Apr-2024 02:05               10280
function.cubrid-seq-put.php                        13-Apr-2024 02:05               10207
function.cubrid-set-add.php                        13-Apr-2024 02:05                9546
function.cubrid-set-autocommit.php                 13-Apr-2024 02:05                4148
function.cubrid-set-db-parameter.php               13-Apr-2024 02:05                8163
function.cubrid-set-drop.php                       13-Apr-2024 02:05                9523
function.cubrid-set-query-timeout.php              13-Apr-2024 02:05                3536
function.cubrid-unbuffered-query.php               13-Apr-2024 02:05                6967
function.cubrid-version.php                        13-Apr-2024 02:05                8650
function.curl-close.php                            13-Apr-2024 02:05                6240
function.curl-copy-handle.php                      13-Apr-2024 02:05                6631
function.curl-errno.php                            13-Apr-2024 02:05                6144
function.curl-error.php                            13-Apr-2024 02:05                6065
function.curl-escape.php                           13-Apr-2024 02:05                7730
function.curl-exec.php                             13-Apr-2024 02:05                7734
function.curl-getinfo.php                          13-Apr-2024 02:05               38372
function.curl-init.php                             13-Apr-2024 02:05                7526
function.curl-multi-add-handle.php                 13-Apr-2024 02:05               10511
function.curl-multi-close.php                      13-Apr-2024 02:05                9782
function.curl-multi-errno.php                      13-Apr-2024 02:05                4020
function.curl-multi-exec.php                       13-Apr-2024 02:05               10500
function.curl-multi-getcontent.php                 13-Apr-2024 02:05                4663
function.curl-multi-info-read.php                  13-Apr-2024 02:05               12322
function.curl-multi-init.php                       13-Apr-2024 02:05                8872
function.curl-multi-remove-handle.php              13-Apr-2024 02:05                5651
function.curl-multi-select.php                     13-Apr-2024 02:05                4509
function.curl-multi-setopt.php                     13-Apr-2024 02:05               13430
function.curl-multi-strerror.php                   13-Apr-2024 02:05                7211
function.curl-pause.php                            13-Apr-2024 02:05                4028
function.curl-reset.php                            13-Apr-2024 02:05                6593
function.curl-setopt-array.php                     13-Apr-2024 02:05                7900
function.curl-setopt.php                           13-Apr-2024 02:05              184025
function.curl-share-close.php                      13-Apr-2024 02:05                8185
function.curl-share-errno.php                      13-Apr-2024 02:05                4005
function.curl-share-init.php                       13-Apr-2024 02:05                7746
function.curl-share-setopt.php                     13-Apr-2024 02:05               10549
function.curl-share-strerror.php                   13-Apr-2024 02:05                3491
function.curl-strerror.php                         13-Apr-2024 02:05                6303
function.curl-unescape.php                         13-Apr-2024 02:05                8232
function.curl-version.php                          13-Apr-2024 02:05                6962
function.curl_upkeep.php                           13-Apr-2024 02:05                7123
function.current.php                               13-Apr-2024 02:05               11600
function.date-add.php                              13-Apr-2024 02:05                1719
function.date-create-from-format.php               13-Apr-2024 02:05                1894
function.date-create-immutable-from-format.php     13-Apr-2024 02:05                2006
function.date-create-immutable.php                 13-Apr-2024 02:05                4380
function.date-create.php                           13-Apr-2024 02:05                4577
function.date-date-set.php                         13-Apr-2024 02:05                1778
function.date-default-timezone-get.php             13-Apr-2024 02:05                7187
function.date-default-timezone-set.php             13-Apr-2024 02:05                5831
function.date-diff.php                             13-Apr-2024 02:05                1738
function.date-format.php                           13-Apr-2024 02:05                1746
function.date-get-last-errors.php                  13-Apr-2024 02:05                1911
function.date-interval-create-from-date-string.php 13-Apr-2024 02:05                2022
function.date-interval-format.php                  13-Apr-2024 02:05                1873
function.date-isodate-set.php                      13-Apr-2024 02:05                1801
function.date-modify.php                           13-Apr-2024 02:05                1750
function.date-offset-get.php                       13-Apr-2024 02:05                1794
function.date-parse-from-format.php                13-Apr-2024 02:05               14458
function.date-parse.php                            13-Apr-2024 02:05               20182
function.date-sub.php                              13-Apr-2024 02:05                2253
function.date-sun-info.php                         13-Apr-2024 02:05               15932
function.date-sunrise.php                          13-Apr-2024 02:05               14581
function.date-sunset.php                           13-Apr-2024 02:05               14566
function.date-time-set.php                         13-Apr-2024 02:05                1764
function.date-timestamp-get.php                    13-Apr-2024 02:05                1823
function.date-timestamp-set.php                    13-Apr-2024 02:05                1831
function.date-timezone-get.php                     13-Apr-2024 02:05                1820
function.date-timezone-set.php                     13-Apr-2024 02:05                1792
function.date.php                                  13-Apr-2024 02:05               22733
function.db2-autocommit.php                        13-Apr-2024 02:05               11015
function.db2-bind-param.php                        13-Apr-2024 02:05               23445
function.db2-client-info.php                       13-Apr-2024 02:05               12349
function.db2-close.php                             13-Apr-2024 02:05                5773
function.db2-column-privileges.php                 13-Apr-2024 02:05                9606
function.db2-columns.php                           13-Apr-2024 02:05               11885
function.db2-commit.php                            13-Apr-2024 02:05                3857
function.db2-conn-error.php                        13-Apr-2024 02:05                7078
function.db2-conn-errormsg.php                     13-Apr-2024 02:05                6824
function.db2-connect.php                           13-Apr-2024 02:05               41421
function.db2-cursor-type.php                       13-Apr-2024 02:05                3326
function.db2-escape-string.php                     13-Apr-2024 02:05                7619
function.db2-exec.php                              13-Apr-2024 02:05               26960
function.db2-execute.php                           13-Apr-2024 02:05               26356
function.db2-fetch-array.php                       13-Apr-2024 02:05               11715
function.db2-fetch-assoc.php                       13-Apr-2024 02:05               11650
function.db2-fetch-both.php                        13-Apr-2024 02:05               12283
function.db2-fetch-object.php                      13-Apr-2024 02:05                9509
function.db2-fetch-row.php                         13-Apr-2024 02:05               16807
function.db2-field-display-size.php                13-Apr-2024 02:05                5147
function.db2-field-name.php                        13-Apr-2024 02:05                5022
function.db2-field-num.php                         13-Apr-2024 02:05                5028
function.db2-field-precision.php                   13-Apr-2024 02:05                5052
function.db2-field-scale.php                       13-Apr-2024 02:05                5022
function.db2-field-type.php                        13-Apr-2024 02:05                5044
function.db2-field-width.php                       13-Apr-2024 02:05                5262
function.db2-foreign-keys.php                      13-Apr-2024 02:05                9329
function.db2-free-result.php                       13-Apr-2024 02:05                3553
function.db2-free-stmt.php                         13-Apr-2024 02:05                3560
function.db2-get-option.php                        13-Apr-2024 02:05               24960
function.db2-last-insert-id.php                    13-Apr-2024 02:05                8103
function.db2-lob-read.php                          13-Apr-2024 02:05               16517
function.db2-next-result.php                       13-Apr-2024 02:05                9063
function.db2-num-fields.php                        13-Apr-2024 02:05                7331
function.db2-num-rows.php                          13-Apr-2024 02:05                4962
function.db2-pclose.php                            13-Apr-2024 02:05                5935
function.db2-pconnect.php                          13-Apr-2024 02:05               34633
function.db2-prepare.php                           13-Apr-2024 02:05               11295
function.db2-primary-keys.php                      13-Apr-2024 02:05                7972
function.db2-procedure-columns.php                 13-Apr-2024 02:05               12691
function.db2-procedures.php                        13-Apr-2024 02:05                8593
function.db2-result.php                            13-Apr-2024 02:05                8247
function.db2-rollback.php                          13-Apr-2024 02:05                9482
function.db2-server-info.php                       13-Apr-2024 02:05               23415
function.db2-set-option.php                        13-Apr-2024 02:05               69240
function.db2-special-columns.php                   13-Apr-2024 02:05               10421
function.db2-statistics.php                        13-Apr-2024 02:05               13469
function.db2-stmt-error.php                        13-Apr-2024 02:05                4687
function.db2-stmt-errormsg.php                     13-Apr-2024 02:05                4278
function.db2-table-privileges.php                  13-Apr-2024 02:05                9062
function.db2-tables.php                            13-Apr-2024 02:05                9416
function.dba-close.php                             13-Apr-2024 02:05                3282
function.dba-delete.php                            13-Apr-2024 02:05                4247
function.dba-exists.php                            13-Apr-2024 02:05                4288
function.dba-fetch.php                             13-Apr-2024 02:05                7682
function.dba-firstkey.php                          13-Apr-2024 02:05                3735
function.dba-handlers.php                          13-Apr-2024 02:05                5690
function.dba-insert.php                            13-Apr-2024 02:05                4945
function.dba-key-split.php                         13-Apr-2024 02:05                3956
function.dba-list.php                              13-Apr-2024 02:05                2332
function.dba-nextkey.php                           13-Apr-2024 02:05                3604
function.dba-open.php                              13-Apr-2024 02:05               14803
function.dba-optimize.php                          13-Apr-2024 02:05                3274
function.dba-popen.php                             13-Apr-2024 02:05                9565
function.dba-replace.php                           13-Apr-2024 02:05                4719
function.dba-sync.php                              13-Apr-2024 02:05                3349
function.dbase-add-record.php                      13-Apr-2024 02:05                6872
function.dbase-close.php                           13-Apr-2024 02:05                5212
function.dbase-create.php                          13-Apr-2024 02:05                8201
function.dbase-delete-record.php                   13-Apr-2024 02:05                4964
function.dbase-get-header-info.php                 13-Apr-2024 02:05                6943
function.dbase-get-record-with-names.php           13-Apr-2024 02:05                8861
function.dbase-get-record.php                      13-Apr-2024 02:05                5821
function.dbase-numfields.php                       13-Apr-2024 02:05                5906
function.dbase-numrecords.php                      13-Apr-2024 02:05                6854
function.dbase-open.php                            13-Apr-2024 02:05                6553
function.dbase-pack.php                            13-Apr-2024 02:05                6304
function.dbase-replace-record.php                  13-Apr-2024 02:05                9436
function.dcgettext.php                             13-Apr-2024 02:05                3484
function.dcngettext.php                            13-Apr-2024 02:05                4113
function.debug-backtrace.php                       13-Apr-2024 02:05               12382
function.debug-print-backtrace.php                 13-Apr-2024 02:05                6660
function.debug-zval-dump.php                       13-Apr-2024 02:05               10405
function.decbin.php                                13-Apr-2024 02:05                8858
function.dechex.php                                13-Apr-2024 02:05                7363
function.decoct.php                                13-Apr-2024 02:05                4928
function.define.php                                13-Apr-2024 02:05               12370
function.defined.php                               13-Apr-2024 02:05                8005
function.deflate-add.php                           13-Apr-2024 02:05                6277
function.deflate-init.php                          13-Apr-2024 02:05                8550
function.deg2rad.php                               13-Apr-2024 02:05                3976
function.delete.php                                13-Apr-2024 02:05                2545
function.dgettext.php                              13-Apr-2024 02:05                3208
function.die.php                                   13-Apr-2024 02:05                1525
function.dio-close.php                             13-Apr-2024 02:05                4019
function.dio-fcntl.php                             13-Apr-2024 02:05               10161
function.dio-open.php                              13-Apr-2024 02:05                8964
function.dio-read.php                              13-Apr-2024 02:05                3639
function.dio-seek.php                              13-Apr-2024 02:05                7482
function.dio-stat.php                              13-Apr-2024 02:05                4382
function.dio-tcsetattr.php                         13-Apr-2024 02:05                7096
function.dio-truncate.php                          13-Apr-2024 02:05                3896
function.dio-write.php                             13-Apr-2024 02:05                3923
function.dir.php                                   13-Apr-2024 02:05                7391
function.dirname.php                               13-Apr-2024 02:05               10121
function.disk-free-space.php                       13-Apr-2024 02:05                5769
function.disk-total-space.php                      13-Apr-2024 02:05                5456
function.diskfreespace.php                         13-Apr-2024 02:05                1771
function.dl.php                                    13-Apr-2024 02:05               10565
function.dngettext.php                             13-Apr-2024 02:05                3835
function.dns-check-record.php                      13-Apr-2024 02:05                1740
function.dns-get-mx.php                            13-Apr-2024 02:05                1710
function.dns-get-record.php                        13-Apr-2024 02:05               24684
function.dom-import-simplexml.php                  13-Apr-2024 02:05                7147
function.doubleval.php                             13-Apr-2024 02:05                1678
function.each.php                                  13-Apr-2024 02:05               11847
function.easter-date.php                           13-Apr-2024 02:05               14816
function.easter-days.php                           13-Apr-2024 02:05                7419
function.echo.php                                  13-Apr-2024 02:05               18300
function.eio-busy.php                              13-Apr-2024 02:05                5047
function.eio-cancel.php                            13-Apr-2024 02:05                7805
function.eio-chmod.php                             13-Apr-2024 02:05                6577
function.eio-chown.php                             13-Apr-2024 02:05                6757
function.eio-close.php                             13-Apr-2024 02:05                5930
function.eio-custom.php                            13-Apr-2024 02:05               10618
function.eio-dup2.php                              13-Apr-2024 02:05                6027
function.eio-event-loop.php                        13-Apr-2024 02:05                5868
function.eio-fallocate.php                         13-Apr-2024 02:05                7992
function.eio-fchmod.php                            13-Apr-2024 02:05                6547
function.eio-fchown.php                            13-Apr-2024 02:05                6850
function.eio-fdatasync.php                         13-Apr-2024 02:05                5862
function.eio-fstat.php                             13-Apr-2024 02:05               11990
function.eio-fstatvfs.php                          13-Apr-2024 02:05                5968
function.eio-fsync.php                             13-Apr-2024 02:05                5993
function.eio-ftruncate.php                         13-Apr-2024 02:05                6510
function.eio-futime.php                            13-Apr-2024 02:05                6824
function.eio-get-event-stream.php                  13-Apr-2024 02:05                8139
function.eio-get-last-error.php                    13-Apr-2024 02:05                3231
function.eio-grp-add.php                           13-Apr-2024 02:05               11866
function.eio-grp-cancel.php                        13-Apr-2024 02:05                3165
function.eio-grp-limit.php                         13-Apr-2024 02:05                3079
function.eio-grp.php                               13-Apr-2024 02:05               12166
function.eio-init.php                              13-Apr-2024 02:05                2661
function.eio-link.php                              13-Apr-2024 02:05               12733
function.eio-lstat.php                             13-Apr-2024 02:05               10212
function.eio-mkdir.php                             13-Apr-2024 02:05                9561
function.eio-mknod.php                             13-Apr-2024 02:05               12084
function.eio-nop.php                               13-Apr-2024 02:05                5534
function.eio-npending.php                          13-Apr-2024 02:05                3069
function.eio-nready.php                            13-Apr-2024 02:05                2719
function.eio-nreqs.php                             13-Apr-2024 02:05                5527
function.eio-nthreads.php                          13-Apr-2024 02:05                3465
function.eio-open.php                              13-Apr-2024 02:05               12035
function.eio-poll.php                              13-Apr-2024 02:05                5788
function.eio-read.php                              13-Apr-2024 02:05               13089
function.eio-readahead.php                         13-Apr-2024 02:05                6572
function.eio-readdir.php                           13-Apr-2024 02:05               18758
function.eio-readlink.php                          13-Apr-2024 02:05               12467
function.eio-realpath.php                          13-Apr-2024 02:05                5314
function.eio-rename.php                            13-Apr-2024 02:05                9560
function.eio-rmdir.php                             13-Apr-2024 02:05                8513
function.eio-seek.php                              13-Apr-2024 02:05                7301
function.eio-sendfile.php                          13-Apr-2024 02:05                7070
function.eio-set-max-idle.php                      13-Apr-2024 02:05                3126
function.eio-set-max-parallel.php                  13-Apr-2024 02:05                3166
function.eio-set-max-poll-reqs.php                 13-Apr-2024 02:05                2472
function.eio-set-max-poll-time.php                 13-Apr-2024 02:05                2547
function.eio-set-min-parallel.php                  13-Apr-2024 02:05                3156
function.eio-stat.php                              13-Apr-2024 02:05               10216
function.eio-statvfs.php                           13-Apr-2024 02:05                8655
function.eio-symlink.php                           13-Apr-2024 02:05               11144
function.eio-sync-file-range.php                   13-Apr-2024 02:05                7685
function.eio-sync.php                              13-Apr-2024 02:05                2940
function.eio-syncfs.php                            13-Apr-2024 02:05                5472
function.eio-truncate.php                          13-Apr-2024 02:05                6421
function.eio-unlink.php                            13-Apr-2024 02:05                5611
function.eio-utime.php                             13-Apr-2024 02:05                6447
function.eio-write.php                             13-Apr-2024 02:05                7243
function.empty.php                                 13-Apr-2024 02:05                9867
function.enchant-broker-describe.php               13-Apr-2024 02:05                6301
function.enchant-broker-dict-exists.php            13-Apr-2024 02:05                5926
function.enchant-broker-free-dict.php              13-Apr-2024 02:05                5029
function.enchant-broker-free.php                   13-Apr-2024 02:05                4563
function.enchant-broker-get-dict-path.php          13-Apr-2024 02:05                5566
function.enchant-broker-get-error.php              13-Apr-2024 02:05                3858
function.enchant-broker-init.php                   13-Apr-2024 02:05                3624
function.enchant-broker-list-dicts.php             13-Apr-2024 02:05                7114
function.enchant-broker-request-dict.php           13-Apr-2024 02:05                7352
function.enchant-broker-request-pwl-dict.php       13-Apr-2024 02:05                5736
function.enchant-broker-set-dict-path.php          13-Apr-2024 02:05                5841
function.enchant-broker-set-ordering.php           13-Apr-2024 02:05                5110
function.enchant-dict-add-to-personal.php          13-Apr-2024 02:05                2195
function.enchant-dict-add-to-session.php           13-Apr-2024 02:05                4643
function.enchant-dict-add.php                      13-Apr-2024 02:05                6531
function.enchant-dict-check.php                    13-Apr-2024 02:05                4436
function.enchant-dict-describe.php                 13-Apr-2024 02:05                6732
function.enchant-dict-get-error.php                13-Apr-2024 02:05                4081
function.enchant-dict-is-added.php                 13-Apr-2024 02:05                4707
function.enchant-dict-is-in-session.php            13-Apr-2024 02:05                2181
function.enchant-dict-quick-check.php              13-Apr-2024 02:05                8526
function.enchant-dict-store-replacement.php        13-Apr-2024 02:05                4923
function.enchant-dict-suggest.php                  13-Apr-2024 02:05                7553
function.end.php                                   13-Apr-2024 02:05                6876
function.enum-exists.php                           13-Apr-2024 02:05                5525
function.error-clear-last.php                      13-Apr-2024 02:05                4613
function.error-get-last.php                        13-Apr-2024 02:05                5010
function.error-log.php                             13-Apr-2024 02:05               11515
function.error-reporting.php                       13-Apr-2024 02:05                9525
function.escapeshellarg.php                        13-Apr-2024 02:05                5641
function.escapeshellcmd.php                        13-Apr-2024 02:05                7995
function.eval.php                                  13-Apr-2024 02:05               10088
function.exec.php                                  13-Apr-2024 02:05               11374
function.exif-imagetype.php                        13-Apr-2024 02:05               10101
function.exif-read-data.php                        13-Apr-2024 02:05               23640
function.exif-tagname.php                          13-Apr-2024 02:05                4741
function.exif-thumbnail.php                        13-Apr-2024 02:05                9427
function.exit.php                                  13-Apr-2024 02:05                9460
function.exp.php                                   13-Apr-2024 02:05                4217
function.expect-expectl.php                        13-Apr-2024 02:05               11538
function.expect-popen.php                          13-Apr-2024 02:05                4677
function.explode.php                               13-Apr-2024 02:05               15226
function.expm1.php                                 13-Apr-2024 02:05                3375
function.extension-loaded.php                      13-Apr-2024 02:05                5821
function.extract.php                               13-Apr-2024 02:05               14827
function.ezmlm-hash.php                            13-Apr-2024 02:05                4581
function.fann-cascadetrain-on-data.php             13-Apr-2024 02:05                6631
function.fann-cascadetrain-on-file.php             13-Apr-2024 02:05                5577
function.fann-clear-scaling-params.php             13-Apr-2024 02:05                2714
function.fann-copy.php                             13-Apr-2024 02:05                3237
function.fann-create-from-file.php                 13-Apr-2024 02:05                3231
function.fann-create-shortcut-array.php            13-Apr-2024 02:05                4104
function.fann-create-shortcut.php                  13-Apr-2024 02:05                5124
function.fann-create-sparse-array.php              13-Apr-2024 02:05                4743
function.fann-create-sparse.php                    13-Apr-2024 02:05                5501
function.fann-create-standard-array.php            13-Apr-2024 02:05                4417
function.fann-create-standard.php                  13-Apr-2024 02:05                5192
function.fann-create-train-from-callback.php       13-Apr-2024 02:05                9062
function.fann-create-train.php                     13-Apr-2024 02:05                4600
function.fann-descale-input.php                    13-Apr-2024 02:05                3768
function.fann-descale-output.php                   13-Apr-2024 02:05                3784
function.fann-descale-train.php                    13-Apr-2024 02:05                3735
function.fann-destroy-train.php                    13-Apr-2024 02:05                2671
function.fann-destroy.php                          13-Apr-2024 02:05                2701
function.fann-duplicate-train-data.php             13-Apr-2024 02:05                2856
function.fann-get-activation-function.php          13-Apr-2024 02:05                5204
function.fann-get-activation-steepness.php         13-Apr-2024 02:05                5617
function.fann-get-bias-array.php                   13-Apr-2024 02:05                2550
function.fann-get-bit-fail-limit.php               13-Apr-2024 02:05                3764
function.fann-get-bit-fail.php                     13-Apr-2024 02:05                4852
function.fann-get-cascade-activation-functions-..> 13-Apr-2024 02:05                3801
function.fann-get-cascade-activation-functions.php 13-Apr-2024 02:05                4617
function.fann-get-cascade-activation-steepnesse..> 13-Apr-2024 02:05                3857
function.fann-get-cascade-activation-steepnesse..> 13-Apr-2024 02:05                4008
function.fann-get-cascade-candidate-change-frac..> 13-Apr-2024 02:05                5114
function.fann-get-cascade-candidate-limit.php      13-Apr-2024 02:05                3504
function.fann-get-cascade-candidate-stagnation-..> 13-Apr-2024 02:05                4240
function.fann-get-cascade-max-cand-epochs.php      13-Apr-2024 02:05                3386
function.fann-get-cascade-max-out-epochs.php       13-Apr-2024 02:05                3307
function.fann-get-cascade-min-cand-epochs.php      13-Apr-2024 02:05                3732
function.fann-get-cascade-min-out-epochs.php       13-Apr-2024 02:05                3689
function.fann-get-cascade-num-candidate-groups.php 13-Apr-2024 02:05                3784
function.fann-get-cascade-num-candidates.php       13-Apr-2024 02:05                5918
function.fann-get-cascade-output-change-fractio..> 13-Apr-2024 02:05                5042
function.fann-get-cascade-output-stagnation-epo..> 13-Apr-2024 02:05                4183
function.fann-get-cascade-weight-multiplier.php    13-Apr-2024 02:05                3462
function.fann-get-connection-array.php             13-Apr-2024 02:05                2577
function.fann-get-connection-rate.php              13-Apr-2024 02:05                2700
function.fann-get-errno.php                        13-Apr-2024 02:05                3107
function.fann-get-errstr.php                       13-Apr-2024 02:05                3112
function.fann-get-layer-array.php                  13-Apr-2024 02:05                2651
function.fann-get-learning-momentum.php            13-Apr-2024 02:05                3881
function.fann-get-learning-rate.php                13-Apr-2024 02:05                3781
function.fann-get-mse.php                          13-Apr-2024 02:05                3167
function.fann-get-network-type.php                 13-Apr-2024 02:05                2670
function.fann-get-num-input.php                    13-Apr-2024 02:05                2557
function.fann-get-num-layers.php                   13-Apr-2024 02:05                2612
function.fann-get-num-output.php                   13-Apr-2024 02:05                2576
function.fann-get-quickprop-decay.php              13-Apr-2024 02:05                3319
function.fann-get-quickprop-mu.php                 13-Apr-2024 02:05                3212
function.fann-get-rprop-decrease-factor.php        13-Apr-2024 02:05                3273
function.fann-get-rprop-delta-max.php              13-Apr-2024 02:05                3335
function.fann-get-rprop-delta-min.php              13-Apr-2024 02:05                3146
function.fann-get-rprop-delta-zero.php             13-Apr-2024 02:05                3519
function.fann-get-rprop-increase-factor.php        13-Apr-2024 02:05                3298
function.fann-get-sarprop-step-error-shift.php     13-Apr-2024 02:05                3649
function.fann-get-sarprop-step-error-threshold-..> 13-Apr-2024 02:05                3801
function.fann-get-sarprop-temperature.php          13-Apr-2024 02:05                3563
function.fann-get-sarprop-weight-decay-shift.php   13-Apr-2024 02:05                3630
function.fann-get-total-connections.php            13-Apr-2024 02:05                2749
function.fann-get-total-neurons.php                13-Apr-2024 02:05                2796
function.fann-get-train-error-function.php         13-Apr-2024 02:05                3551
function.fann-get-train-stop-function.php          13-Apr-2024 02:05                3537
function.fann-get-training-algorithm.php           13-Apr-2024 02:05                3771
function.fann-init-weights.php                     13-Apr-2024 02:05                4386
function.fann-length-train-data.php                13-Apr-2024 02:05                2876
function.fann-merge-train-data.php                 13-Apr-2024 02:05                3187
function.fann-num-input-train-data.php             13-Apr-2024 02:05                3507
function.fann-num-output-train-data.php            13-Apr-2024 02:05                3505
function.fann-print-error.php                      13-Apr-2024 02:05                2861
function.fann-randomize-weights.php                13-Apr-2024 02:05                3958
function.fann-read-train-from-file.php             13-Apr-2024 02:05                4953
function.fann-reset-errno.php                      13-Apr-2024 02:05                3037
function.fann-reset-errstr.php                     13-Apr-2024 02:05                3018
function.fann-reset-mse.php                        13-Apr-2024 02:05                3445
function.fann-run.php                              13-Apr-2024 02:05                2866
function.fann-save-train.php                       13-Apr-2024 02:05                3512
function.fann-save.php                             13-Apr-2024 02:05                4321
function.fann-scale-input-train-data.php           13-Apr-2024 02:05                4139
function.fann-scale-input.php                      13-Apr-2024 02:05                3782
function.fann-scale-output-train-data.php          13-Apr-2024 02:05                4167
function.fann-scale-output.php                     13-Apr-2024 02:05                3786
function.fann-scale-train-data.php                 13-Apr-2024 02:05                4137
function.fann-scale-train.php                      13-Apr-2024 02:05                3753
function.fann-set-activation-function-hidden.php   13-Apr-2024 02:05                4477
function.fann-set-activation-function-layer.php    13-Apr-2024 02:05                4991
function.fann-set-activation-function-output.php   13-Apr-2024 02:05                4493
function.fann-set-activation-function.php          13-Apr-2024 02:05                6468
function.fann-set-activation-steepness-hidden.php  13-Apr-2024 02:05                4763
function.fann-set-activation-steepness-layer.php   13-Apr-2024 02:05                5228
function.fann-set-activation-steepness-output.php  13-Apr-2024 02:05                4744
function.fann-set-activation-steepness.php         13-Apr-2024 02:05                6124
function.fann-set-bit-fail-limit.php               13-Apr-2024 02:05                3466
function.fann-set-callback.php                     13-Apr-2024 02:05                5639
function.fann-set-cascade-activation-functions.php 13-Apr-2024 02:05                4122
function.fann-set-cascade-activation-steepnesse..> 13-Apr-2024 02:05                4335
function.fann-set-cascade-candidate-change-frac..> 13-Apr-2024 02:05                3817
function.fann-set-cascade-candidate-limit.php      13-Apr-2024 02:05                3624
function.fann-set-cascade-candidate-stagnation-..> 13-Apr-2024 02:05                3879
function.fann-set-cascade-max-cand-epochs.php      13-Apr-2024 02:05                3625
function.fann-set-cascade-max-out-epochs.php       13-Apr-2024 02:05                3576
function.fann-set-cascade-min-cand-epochs.php      13-Apr-2024 02:05                3976
function.fann-set-cascade-min-out-epochs.php       13-Apr-2024 02:05                3958
function.fann-set-cascade-num-candidate-groups.php 13-Apr-2024 02:05                3710
function.fann-set-cascade-output-change-fractio..> 13-Apr-2024 02:05                3774
function.fann-set-cascade-output-stagnation-epo..> 13-Apr-2024 02:05                3840
function.fann-set-cascade-weight-multiplier.php    13-Apr-2024 02:05                3609
function.fann-set-error-log.php                    13-Apr-2024 02:05                2888
function.fann-set-input-scaling-params.php         13-Apr-2024 02:05                4513
function.fann-set-learning-momentum.php            13-Apr-2024 02:05                3850
function.fann-set-learning-rate.php                13-Apr-2024 02:05                3776
function.fann-set-output-scaling-params.php        13-Apr-2024 02:05                4533
function.fann-set-quickprop-decay.php              13-Apr-2024 02:05                3537
function.fann-set-quickprop-mu.php                 13-Apr-2024 02:05                3392
function.fann-set-rprop-decrease-factor.php        13-Apr-2024 02:05                3594
function.fann-set-rprop-delta-max.php              13-Apr-2024 02:05                3706
function.fann-set-rprop-delta-min.php              13-Apr-2024 02:05                3512
function.fann-set-rprop-delta-zero.php             13-Apr-2024 02:05                3894
function.fann-set-rprop-increase-factor.php        13-Apr-2024 02:05                3620
function.fann-set-sarprop-step-error-shift.php     13-Apr-2024 02:05                4026
function.fann-set-sarprop-step-error-threshold-..> 13-Apr-2024 02:05                4220
function.fann-set-sarprop-temperature.php          13-Apr-2024 02:05                3937
function.fann-set-sarprop-weight-decay-shift.php   13-Apr-2024 02:05                4020
function.fann-set-scaling-params.php               13-Apr-2024 02:05                5550
function.fann-set-train-error-function.php         13-Apr-2024 02:05                3806
function.fann-set-train-stop-function.php          13-Apr-2024 02:05                3794
function.fann-set-training-algorithm.php           13-Apr-2024 02:05                3742
function.fann-set-weight-array.php                 13-Apr-2024 02:05                3256
function.fann-set-weight.php                       13-Apr-2024 02:05                3704
function.fann-shuffle-train-data.php               13-Apr-2024 02:05                2871
function.fann-subset-train-data.php                13-Apr-2024 02:05                4217
function.fann-test-data.php                        13-Apr-2024 02:05                4110
function.fann-test.php                             13-Apr-2024 02:05                4465
function.fann-train-epoch.php                      13-Apr-2024 02:05                4484
function.fann-train-on-data.php                    13-Apr-2024 02:05                6460
function.fann-train-on-file.php                    13-Apr-2024 02:05                6450
function.fann-train.php                            13-Apr-2024 02:05                4577
function.fastcgi-finish-request.php                13-Apr-2024 02:05                2744
function.fbird-add-user.php                        13-Apr-2024 02:05                2319
function.fbird-affected-rows.php                   13-Apr-2024 02:05                2337
function.fbird-backup.php                          13-Apr-2024 02:05                1750
function.fbird-blob-add.php                        13-Apr-2024 02:05                2660
function.fbird-blob-cancel.php                     13-Apr-2024 02:05                3689
function.fbird-blob-close.php                      13-Apr-2024 02:05                2691
function.fbird-blob-create.php                     13-Apr-2024 02:05                2691
function.fbird-blob-echo.php                       13-Apr-2024 02:05                2494
function.fbird-blob-get.php                        13-Apr-2024 02:05                2487
function.fbird-blob-import.php                     13-Apr-2024 02:05                2687
function.fbird-blob-info.php                       13-Apr-2024 02:05                1782
function.fbird-blob-open.php                       13-Apr-2024 02:05                2484
function.fbird-close.php                           13-Apr-2024 02:05                2260
function.fbird-commit-ret.php                      13-Apr-2024 02:05                1775
function.fbird-commit.php                          13-Apr-2024 02:05                1743
function.fbird-connect.php                         13-Apr-2024 02:05                2266
function.fbird-db-info.php                         13-Apr-2024 02:05                1756
function.fbird-delete-user.php                     13-Apr-2024 02:05                2334
function.fbird-drop-db.php                         13-Apr-2024 02:05                2282
function.fbird-errcode.php                         13-Apr-2024 02:05                2095
function.fbird-errmsg.php                          13-Apr-2024 02:05                2088
function.fbird-execute.php                         13-Apr-2024 02:05                2100
function.fbird-fetch-assoc.php                     13-Apr-2024 02:05                2350
function.fbird-fetch-object.php                    13-Apr-2024 02:05                2361
function.fbird-fetch-row.php                       13-Apr-2024 02:05                2338
function.fbird-field-info.php                      13-Apr-2024 02:05                2170
function.fbird-free-event-handler.php              13-Apr-2024 02:05                2274
function.fbird-free-query.php                      13-Apr-2024 02:05                1811
function.fbird-free-result.php                     13-Apr-2024 02:05                1796
function.fbird-gen-id.php                          13-Apr-2024 02:05                1753
function.fbird-maintain-db.php                     13-Apr-2024 02:05                1798
function.fbird-modify-user.php                     13-Apr-2024 02:05                2350
function.fbird-name-result.php                     13-Apr-2024 02:05                2333
function.fbird-num-fields.php                      13-Apr-2024 02:05                2159
function.fbird-num-params.php                      13-Apr-2024 02:05                2328
function.fbird-param-info.php                      13-Apr-2024 02:05                2333
function.fbird-pconnect.php                        13-Apr-2024 02:05                2283
function.fbird-prepare.php                         13-Apr-2024 02:05                1746
function.fbird-query.php                           13-Apr-2024 02:05                2619
function.fbird-restore.php                         13-Apr-2024 02:05                1753
function.fbird-rollback-ret.php                    13-Apr-2024 02:05                1805
function.fbird-rollback.php                        13-Apr-2024 02:05                1777
function.fbird-server-info.php                     13-Apr-2024 02:05                1808
function.fbird-service-attach.php                  13-Apr-2024 02:05                1847
function.fbird-service-detach.php                  13-Apr-2024 02:05                1859
function.fbird-set-event-handler.php               13-Apr-2024 02:05                2443
function.fbird-trans.php                           13-Apr-2024 02:05                1752
function.fbird-wait-event.php                      13-Apr-2024 02:05                2368
function.fclose.php                                13-Apr-2024 02:05                4592
function.fdatasync.php                             13-Apr-2024 02:05                6212
function.fdf-add-doc-javascript.php                13-Apr-2024 02:05                5647
function.fdf-add-template.php                      13-Apr-2024 02:05                2924
function.fdf-close.php                             13-Apr-2024 02:05                3105
function.fdf-create.php                            13-Apr-2024 02:05                5704
function.fdf-enum-values.php                       13-Apr-2024 02:05                2503
function.fdf-errno.php                             13-Apr-2024 02:05                2860
function.fdf-error.php                             13-Apr-2024 02:05                3259
function.fdf-get-ap.php                            13-Apr-2024 02:05                4423
function.fdf-get-attachment.php                    13-Apr-2024 02:05                6351
function.fdf-get-encoding.php                      13-Apr-2024 02:05                3449
function.fdf-get-file.php                          13-Apr-2024 02:05                3215
function.fdf-get-flags.php                         13-Apr-2024 02:05                2412
function.fdf-get-opt.php                           13-Apr-2024 02:05                2455
function.fdf-get-status.php                        13-Apr-2024 02:05                3210
function.fdf-get-value.php                         13-Apr-2024 02:05                4692
function.fdf-get-version.php                       13-Apr-2024 02:05                3740
function.fdf-header.php                            13-Apr-2024 02:05                2358
function.fdf-next-field-name.php                   13-Apr-2024 02:05                5456
function.fdf-open-string.php                       13-Apr-2024 02:05                5054
function.fdf-open.php                              13-Apr-2024 02:05                6131
function.fdf-remove-item.php                       13-Apr-2024 02:05                2439
function.fdf-save-string.php                       13-Apr-2024 02:05                5727
function.fdf-save.php                              13-Apr-2024 02:05                4221
function.fdf-set-ap.php                            13-Apr-2024 02:05                4692
function.fdf-set-encoding.php                      13-Apr-2024 02:05                3901
function.fdf-set-file.php                          13-Apr-2024 02:05                6982
function.fdf-set-flags.php                         13-Apr-2024 02:05                4465
function.fdf-set-javascript-action.php             13-Apr-2024 02:05                4684
function.fdf-set-on-import-javascript.php          13-Apr-2024 02:05                3259
function.fdf-set-opt.php                           13-Apr-2024 02:05                4760
function.fdf-set-status.php                        13-Apr-2024 02:05                3864
function.fdf-set-submit-form-action.php            13-Apr-2024 02:05                4988
function.fdf-set-target-frame.php                  13-Apr-2024 02:05                3867
function.fdf-set-value.php                         13-Apr-2024 02:05                5554
function.fdf-set-version.php                       13-Apr-2024 02:05                4229
function.fdiv.php                                  13-Apr-2024 02:05                6278
function.feof.php                                  13-Apr-2024 02:05                8110
function.fflush.php                                13-Apr-2024 02:05                5848
function.fgetc.php                                 13-Apr-2024 02:05                6851
function.fgetcsv.php                               13-Apr-2024 02:05               13757
function.fgets.php                                 13-Apr-2024 02:05                8939
function.fgetss.php                                13-Apr-2024 02:05                9990
function.file-exists.php                           13-Apr-2024 02:05                7648
function.file-get-contents.php                     13-Apr-2024 02:05               19618
function.file-put-contents.php                     13-Apr-2024 02:05               13877
function.file.php                                  13-Apr-2024 02:05               12542
function.fileatime.php                             13-Apr-2024 02:05                7284
function.filectime.php                             13-Apr-2024 02:05                7225
function.filegroup.php                             13-Apr-2024 02:05                6062
function.fileinode.php                             13-Apr-2024 02:05                5475
function.filemtime.php                             13-Apr-2024 02:05                6871
function.fileowner.php                             13-Apr-2024 02:05                5823
function.fileperms.php                             13-Apr-2024 02:05               16745
function.filesize.php                              13-Apr-2024 02:05                6059
function.filetype.php                              13-Apr-2024 02:05                7047
function.filter-has-var.php                        13-Apr-2024 02:05                3416
function.filter-id.php                             13-Apr-2024 02:05                2986
function.filter-input-array.php                    13-Apr-2024 02:05               14097
function.filter-input.php                          13-Apr-2024 02:05                8916
function.filter-list.php                           13-Apr-2024 02:05                3762
function.filter-var-array.php                      13-Apr-2024 02:05               12497
function.filter-var.php                            13-Apr-2024 02:05               14813
function.finfo-buffer.php                          13-Apr-2024 02:05                8636
function.finfo-close.php                           13-Apr-2024 02:05                3698
function.finfo-file.php                            13-Apr-2024 02:05                9277
function.finfo-open.php                            13-Apr-2024 02:05               10580
function.finfo-set-flags.php                       13-Apr-2024 02:05                4941
function.floatval.php                              13-Apr-2024 02:05                6898
function.flock.php                                 13-Apr-2024 02:05               13991
function.floor.php                                 13-Apr-2024 02:05                5028
function.flush.php                                 13-Apr-2024 02:05                4982
function.fmod.php                                  13-Apr-2024 02:05                4953
function.fnmatch.php                               13-Apr-2024 02:05                8479
function.fopen.php                                 13-Apr-2024 02:05               25423
function.forward-static-call-array.php             13-Apr-2024 02:05                9688
function.forward-static-call.php                   13-Apr-2024 02:05                9023
function.fpassthru.php                             13-Apr-2024 02:05                7759
function.fpm-get-status.php                        13-Apr-2024 02:05                2911
function.fprintf.php                               13-Apr-2024 02:05               24606
function.fputcsv.php                               13-Apr-2024 02:05               11027
function.fputs.php                                 13-Apr-2024 02:05                1659
function.fread.php                                 13-Apr-2024 02:05               15299
function.frenchtojd.php                            13-Apr-2024 02:05                4162
function.fscanf.php                                13-Apr-2024 02:05                9742
function.fseek.php                                 13-Apr-2024 02:05                8442
function.fsockopen.php                             13-Apr-2024 02:05               18111
function.fstat.php                                 13-Apr-2024 02:05                6268
function.fsync.php                                 13-Apr-2024 02:05                5980
function.ftell.php                                 13-Apr-2024 02:05                6445
function.ftok.php                                  13-Apr-2024 02:05                3794
function.ftp-alloc.php                             13-Apr-2024 02:05                8819
function.ftp-append.php                            13-Apr-2024 02:05                4728
function.ftp-cdup.php                              13-Apr-2024 02:05                6722
function.ftp-chdir.php                             13-Apr-2024 02:05                7630
function.ftp-chmod.php                             13-Apr-2024 02:05                7292
function.ftp-close.php                             13-Apr-2024 02:05                6245
function.ftp-connect.php                           13-Apr-2024 02:05                6922
function.ftp-delete.php                            13-Apr-2024 02:05                6395
function.ftp-exec.php                              13-Apr-2024 02:05                6961
function.ftp-fget.php                              13-Apr-2024 02:05               10621
function.ftp-fput.php                              13-Apr-2024 02:05                9965
function.ftp-get-option.php                        13-Apr-2024 02:05                6468
function.ftp-get.php                               13-Apr-2024 02:05                9847
function.ftp-login.php                             13-Apr-2024 02:05                6922
function.ftp-mdtm.php                              13-Apr-2024 02:05                7286
function.ftp-mkdir.php                             13-Apr-2024 02:05                7171
function.ftp-mlsd.php                              13-Apr-2024 02:05                9383
function.ftp-nb-continue.php                       13-Apr-2024 02:05                5672
function.ftp-nb-fget.php                           13-Apr-2024 02:05               11076
function.ftp-nb-fput.php                           13-Apr-2024 02:05               10877
function.ftp-nb-get.php                            13-Apr-2024 02:05               15028
function.ftp-nb-put.php                            13-Apr-2024 02:05               12184
function.ftp-nlist.php                             13-Apr-2024 02:05                7148
function.ftp-pasv.php                              13-Apr-2024 02:05                7675
function.ftp-put.php                               13-Apr-2024 02:05                9487
function.ftp-pwd.php                               13-Apr-2024 02:05                6186
function.ftp-quit.php                              13-Apr-2024 02:05                1653
function.ftp-raw.php                               13-Apr-2024 02:05                5843
function.ftp-rawlist.php                           13-Apr-2024 02:05                8495
function.ftp-rename.php                            13-Apr-2024 02:05                7399
function.ftp-rmdir.php                             13-Apr-2024 02:05                6721
function.ftp-set-option.php                        13-Apr-2024 02:05                8031
function.ftp-site.php                              13-Apr-2024 02:05                7062
function.ftp-size.php                              13-Apr-2024 02:05                6997
function.ftp-ssl-connect.php                       13-Apr-2024 02:05                9559
function.ftp-systype.php                           13-Apr-2024 02:05                5692
function.ftruncate.php                             13-Apr-2024 02:05                6659
function.func-get-arg.php                          13-Apr-2024 02:05               11384
function.func-get-args.php                         13-Apr-2024 02:05               12090
function.func-num-args.php                         13-Apr-2024 02:05                6034
function.function-exists.php                       13-Apr-2024 02:05                6292
function.fwrite.php                                13-Apr-2024 02:05               15297
function.gc-collect-cycles.php                     13-Apr-2024 02:05                2583
function.gc-disable.php                            13-Apr-2024 02:05                2567
function.gc-enable.php                             13-Apr-2024 02:05                2544
function.gc-enabled.php                            13-Apr-2024 02:05                3395
function.gc-mem-caches.php                         13-Apr-2024 02:05                2569
function.gc-status.php                             13-Apr-2024 02:05                8809
function.gd-info.php                               13-Apr-2024 02:05               10111
function.geoip-asnum-by-name.php                   13-Apr-2024 02:05                4228
function.geoip-continent-code-by-name.php          13-Apr-2024 02:05                5820
function.geoip-country-code-by-name.php            13-Apr-2024 02:05                5545
function.geoip-country-code3-by-name.php           13-Apr-2024 02:05                5072
function.geoip-country-name-by-name.php            13-Apr-2024 02:05                5030
function.geoip-database-info.php                   13-Apr-2024 02:05                4488
function.geoip-db-avail.php                        13-Apr-2024 02:05                4821
function.geoip-db-filename.php                     13-Apr-2024 02:05                4356
function.geoip-db-get-all-info.php                 13-Apr-2024 02:05                6923
function.geoip-domain-by-name.php                  13-Apr-2024 02:05                4588
function.geoip-id-by-name.php                      13-Apr-2024 02:05                5528
function.geoip-isp-by-name.php                     13-Apr-2024 02:05                4566
function.geoip-netspeedcell-by-name.php            13-Apr-2024 02:05                5324
function.geoip-org-by-name.php                     13-Apr-2024 02:05                4578
function.geoip-record-by-name.php                  13-Apr-2024 02:05                8129
function.geoip-region-by-name.php                  13-Apr-2024 02:05                5254
function.geoip-region-name-by-code.php             13-Apr-2024 02:05                7409
function.geoip-setup-custom-directory.php          13-Apr-2024 02:05                4282
function.geoip-time-zone-by-country-and-region.php 13-Apr-2024 02:05                7678
function.get-browser.php                           13-Apr-2024 02:05                9079
function.get-called-class.php                      13-Apr-2024 02:05                6408
function.get-cfg-var.php                           13-Apr-2024 02:05                3972
function.get-class-methods.php                     13-Apr-2024 02:05                7137
function.get-class-vars.php                        13-Apr-2024 02:05                9860
function.get-class.php                             13-Apr-2024 02:05               13398
function.get-current-user.php                      13-Apr-2024 02:05                4361
function.get-debug-type.php                        13-Apr-2024 02:05                9689
function.get-declared-classes.php                  13-Apr-2024 02:05                5567
function.get-declared-interfaces.php               13-Apr-2024 02:05                4424
function.get-declared-traits.php                   13-Apr-2024 02:05                2906
function.get-defined-constants.php                 13-Apr-2024 02:05                7713
function.get-defined-functions.php                 13-Apr-2024 02:05                7181
function.get-defined-vars.php                      13-Apr-2024 02:05                6248
function.get-extension-funcs.php                   13-Apr-2024 02:05                5704
function.get-headers.php                           13-Apr-2024 02:05                9625
function.get-html-translation-table.php            13-Apr-2024 02:05               14874
function.get-include-path.php                      13-Apr-2024 02:05                4440
function.get-included-files.php                    13-Apr-2024 02:05                6192
function.get-loaded-extensions.php                 13-Apr-2024 02:05                5734
function.get-magic-quotes-gpc.php                  13-Apr-2024 02:05                4240
function.get-magic-quotes-runtime.php              13-Apr-2024 02:05                3714
function.get-mangled-object-vars.php               13-Apr-2024 02:05                8244
function.get-meta-tags.php                         13-Apr-2024 02:05                8188
function.get-object-vars.php                       13-Apr-2024 02:05                6279
function.get-parent-class.php                      13-Apr-2024 02:05                8111
function.get-required-files.php                    13-Apr-2024 02:05                1829
function.get-resource-id.php                       13-Apr-2024 02:05                4798
function.get-resource-type.php                     13-Apr-2024 02:05                5469
function.get-resources.php                         13-Apr-2024 02:05                8210
function.getallheaders.php                         13-Apr-2024 02:05                4908
function.getcwd.php                                13-Apr-2024 02:05                5674
function.getdate.php                               13-Apr-2024 02:05                9437
function.getenv.php                                13-Apr-2024 02:05                8749
function.gethostbyaddr.php                         13-Apr-2024 02:05                4544
function.gethostbyname.php                         13-Apr-2024 02:05                4654
function.gethostbynamel.php                        13-Apr-2024 02:05                5296
function.gethostname.php                           13-Apr-2024 02:05                4084
function.getimagesize.php                          13-Apr-2024 02:05               18404
function.getimagesizefromstring.php                13-Apr-2024 02:05                5723
function.getlastmod.php                            13-Apr-2024 02:05                5302
function.getmxrr.php                               13-Apr-2024 02:05                6426
function.getmygid.php                              13-Apr-2024 02:05                3520
function.getmyinode.php                            13-Apr-2024 02:05                3522
function.getmypid.php                              13-Apr-2024 02:05                3905
function.getmyuid.php                              13-Apr-2024 02:05                3484
function.getopt.php                                13-Apr-2024 02:05               16050
function.getprotobyname.php                        13-Apr-2024 02:05                4718
function.getprotobynumber.php                      13-Apr-2024 02:05                3357
function.getrandmax.php                            13-Apr-2024 02:05                2966
function.getrusage.php                             13-Apr-2024 02:05               11650
function.getservbyname.php                         13-Apr-2024 02:05                6626
function.getservbyport.php                         13-Apr-2024 02:05                3994
function.gettext.php                               13-Apr-2024 02:05                5957
function.gettimeofday.php                          13-Apr-2024 02:05                4869
function.gettype.php                               13-Apr-2024 02:05                9084
function.glob.php                                  13-Apr-2024 02:05               11816
function.gmdate.php                                13-Apr-2024 02:05                7879
function.gmmktime.php                              13-Apr-2024 02:05               11684
function.gmp-abs.php                               13-Apr-2024 02:05                4380
function.gmp-add.php                               13-Apr-2024 02:05                4683
function.gmp-and.php                               13-Apr-2024 02:05                5176
function.gmp-binomial.php                          13-Apr-2024 02:05                3965
function.gmp-clrbit.php                            13-Apr-2024 02:05                5721
function.gmp-cmp.php                               13-Apr-2024 02:05                5601
function.gmp-com.php                               13-Apr-2024 02:05                3886
function.gmp-div-q.php                             13-Apr-2024 02:05                9881
function.gmp-div-qr.php                            13-Apr-2024 02:05                6572
function.gmp-div-r.php                             13-Apr-2024 02:05                6124
function.gmp-div.php                               13-Apr-2024 02:05                1672
function.gmp-divexact.php                          13-Apr-2024 02:05                5856
function.gmp-export.php                            13-Apr-2024 02:05                5840
function.gmp-fact.php                              13-Apr-2024 02:05                4789
function.gmp-gcd.php                               13-Apr-2024 02:05                5145
function.gmp-gcdext.php                            13-Apr-2024 02:05                9346
function.gmp-hamdist.php                           13-Apr-2024 02:05                6576
function.gmp-import.php                            13-Apr-2024 02:05                6161
function.gmp-init.php                              13-Apr-2024 02:05                5930
function.gmp-intval.php                            13-Apr-2024 02:05                5279
function.gmp-invert.php                            13-Apr-2024 02:05                5344
function.gmp-jacobi.php                            13-Apr-2024 02:05                5682
function.gmp-kronecker.php                         13-Apr-2024 02:05                3987
function.gmp-lcm.php                               13-Apr-2024 02:05                3743
function.gmp-legendre.php                          13-Apr-2024 02:05                5698
function.gmp-mod.php                               13-Apr-2024 02:05                4864
function.gmp-mul.php                               13-Apr-2024 02:05                4900
function.gmp-neg.php                               13-Apr-2024 02:05                4369
function.gmp-nextprime.php                         13-Apr-2024 02:05                5052
function.gmp-or.php                                13-Apr-2024 02:05                5400
function.gmp-perfect-power.php                     13-Apr-2024 02:05                3387
function.gmp-perfect-square.php                    13-Apr-2024 02:05                5626
function.gmp-popcount.php                          13-Apr-2024 02:05                4842
function.gmp-pow.php                               13-Apr-2024 02:05                5781
function.gmp-powm.php                              13-Apr-2024 02:05                5814
function.gmp-prob-prime.php                        13-Apr-2024 02:05                5903
function.gmp-random-bits.php                       13-Apr-2024 02:05                6144
function.gmp-random-range.php                      13-Apr-2024 02:05                7518
function.gmp-random-seed.php                       13-Apr-2024 02:05                7641
function.gmp-random.php                            13-Apr-2024 02:05                6519
function.gmp-root.php                              13-Apr-2024 02:05                3115
function.gmp-rootrem.php                           13-Apr-2024 02:05                3315
function.gmp-scan0.php                             13-Apr-2024 02:05                5596
function.gmp-scan1.php                             13-Apr-2024 02:05                5648
function.gmp-setbit.php                            13-Apr-2024 02:05               12179
function.gmp-sign.php                              13-Apr-2024 02:05                5085
function.gmp-sqrt.php                              13-Apr-2024 02:05                4918
function.gmp-sqrtrem.php                           13-Apr-2024 02:05                6414
function.gmp-strval.php                            13-Apr-2024 02:05                4658
function.gmp-sub.php                               13-Apr-2024 02:05                4973
function.gmp-testbit.php                           13-Apr-2024 02:05                6114
function.gmp-xor.php                               13-Apr-2024 02:05                5421
function.gmstrftime.php                            13-Apr-2024 02:05                9480
function.gnupg-adddecryptkey.php                   13-Apr-2024 02:05                5384
function.gnupg-addencryptkey.php                   13-Apr-2024 02:05                4931
function.gnupg-addsignkey.php                      13-Apr-2024 02:05                5409
function.gnupg-cleardecryptkeys.php                13-Apr-2024 02:05                4463
function.gnupg-clearencryptkeys.php                13-Apr-2024 02:05                4471
function.gnupg-clearsignkeys.php                   13-Apr-2024 02:05                4413
function.gnupg-decrypt.php                         13-Apr-2024 02:05                6195
function.gnupg-decryptverify.php                   13-Apr-2024 02:05                7281
function.gnupg-deletekey.php                       13-Apr-2024 02:05                5194
function.gnupg-encrypt.php                         13-Apr-2024 02:05                6083
function.gnupg-encryptsign.php                     13-Apr-2024 02:05                7021
function.gnupg-export.php                          13-Apr-2024 02:05                5269
function.gnupg-getengineinfo.php                   13-Apr-2024 02:05                5644
function.gnupg-geterror.php                        13-Apr-2024 02:05                4394
function.gnupg-geterrorinfo.php                    13-Apr-2024 02:05                5703
function.gnupg-getprotocol.php                     13-Apr-2024 02:05                4492
function.gnupg-gettrustlist.php                    13-Apr-2024 02:05                5302
function.gnupg-import.php                          13-Apr-2024 02:05                5537
function.gnupg-init.php                            13-Apr-2024 02:05                7383
function.gnupg-keyinfo.php                         13-Apr-2024 02:05                5464
function.gnupg-listsignatures.php                  13-Apr-2024 02:05                5499
function.gnupg-setarmor.php                        13-Apr-2024 02:05                5749
function.gnupg-seterrormode.php                    13-Apr-2024 02:05                5778
function.gnupg-setsignmode.php                     13-Apr-2024 02:05                5852
function.gnupg-sign.php                            13-Apr-2024 02:05                6319
function.gnupg-verify.php                          13-Apr-2024 02:05                8636
function.grapheme-extract.php                      13-Apr-2024 02:05                9224
function.grapheme-stripos.php                      13-Apr-2024 02:05                8615
function.grapheme-stristr.php                      13-Apr-2024 02:05                8160
function.grapheme-strlen.php                       13-Apr-2024 02:05                5638
function.grapheme-strpos.php                       13-Apr-2024 02:05                8264
function.grapheme-strripos.php                     13-Apr-2024 02:05                8024
function.grapheme-strrpos.php                      13-Apr-2024 02:05                7670
function.grapheme-strstr.php                       13-Apr-2024 02:05                7799
function.grapheme-substr.php                       13-Apr-2024 02:05                8413
function.gregoriantojd.php                         13-Apr-2024 02:05                8141
function.gzclose.php                               13-Apr-2024 02:05                4414
function.gzcompress.php                            13-Apr-2024 02:05                6211
function.gzdecode.php                              13-Apr-2024 02:05                3919
function.gzdeflate.php                             13-Apr-2024 02:05                5834
function.gzencode.php                              13-Apr-2024 02:05                7398
function.gzeof.php                                 13-Apr-2024 02:05                4350
function.gzfile.php                                13-Apr-2024 02:05                4903
function.gzgetc.php                                13-Apr-2024 02:05                4916
function.gzgets.php                                13-Apr-2024 02:05                6555
function.gzgetss.php                               13-Apr-2024 02:05                6418
function.gzinflate.php                             13-Apr-2024 02:05                5647
function.gzopen.php                                13-Apr-2024 02:05                6093
function.gzpassthru.php                            13-Apr-2024 02:05                5034
function.gzputs.php                                13-Apr-2024 02:05                1639
function.gzread.php                                13-Apr-2024 02:05                7118
function.gzrewind.php                              13-Apr-2024 02:05                3538
function.gzseek.php                                13-Apr-2024 02:05                6965
function.gztell.php                                13-Apr-2024 02:05                3727
function.gzuncompress.php                          13-Apr-2024 02:05                5505
function.gzwrite.php                               13-Apr-2024 02:05                7075
function.halt-compiler.php                         13-Apr-2024 02:05                5217
function.hash-algos.php                            13-Apr-2024 02:05                5881
function.hash-copy.php                             13-Apr-2024 02:05                5615
function.hash-equals.php                           13-Apr-2024 02:05                7235
function.hash-file.php                             13-Apr-2024 02:05                8024
function.hash-final.php                            13-Apr-2024 02:05                5252
function.hash-hkdf.php                             13-Apr-2024 02:05               10424
function.hash-hmac-algos.php                       13-Apr-2024 02:05                5449
function.hash-hmac-file.php                        13-Apr-2024 02:05                8817
function.hash-hmac.php                             13-Apr-2024 02:05                8386
function.hash-init.php                             13-Apr-2024 02:05               10956
function.hash-pbkdf2.php                           13-Apr-2024 02:05               12378
function.hash-update-file.php                      13-Apr-2024 02:05                6188
function.hash-update-stream.php                    13-Apr-2024 02:05                7692
function.hash-update.php                           13-Apr-2024 02:05                4651
function.hash.php                                  13-Apr-2024 02:05                7757
function.header-register-callback.php              13-Apr-2024 02:05                7053
function.header-remove.php                         13-Apr-2024 02:05                7108
function.header.php                                13-Apr-2024 02:05               21474
function.headers-list.php                          13-Apr-2024 02:05                6324
function.headers-sent.php                          13-Apr-2024 02:05                8691
function.hebrev.php                                13-Apr-2024 02:05                3421
function.hebrevc.php                               13-Apr-2024 02:05                3863
function.hex2bin.php                               13-Apr-2024 02:05                5141
function.hexdec.php                                13-Apr-2024 02:05                6549
function.highlight-file.php                        13-Apr-2024 02:05                6423
function.highlight-string.php                      13-Apr-2024 02:05                7224
function.hrtime.php                                13-Apr-2024 02:05                5533
function.html-entity-decode.php                    13-Apr-2024 02:05               15688
function.htmlentities.php                          13-Apr-2024 02:05               18727
function.htmlspecialchars-decode.php               13-Apr-2024 02:05                9874
function.htmlspecialchars.php                      13-Apr-2024 02:05               24654
function.http-build-query.php                      13-Apr-2024 02:05               20154
function.http-response-code.php                    13-Apr-2024 02:05                7526
function.hypot.php                                 13-Apr-2024 02:05                3031
function.ibase-add-user.php                        13-Apr-2024 02:05                5144
function.ibase-affected-rows.php                   13-Apr-2024 02:05                3554
function.ibase-backup.php                          13-Apr-2024 02:05               10439
function.ibase-blob-add.php                        13-Apr-2024 02:05                4050
function.ibase-blob-cancel.php                     13-Apr-2024 02:05                3755
function.ibase-blob-close.php                      13-Apr-2024 02:05                4098
function.ibase-blob-create.php                     13-Apr-2024 02:05                4163
function.ibase-blob-echo.php                       13-Apr-2024 02:05                4358
function.ibase-blob-get.php                        13-Apr-2024 02:05                6700
function.ibase-blob-import.php                     13-Apr-2024 02:05                8179
function.ibase-blob-info.php                       13-Apr-2024 02:05                3548
function.ibase-blob-open.php                       13-Apr-2024 02:05                4586
function.ibase-close.php                           13-Apr-2024 02:05                4025
function.ibase-commit-ret.php                      13-Apr-2024 02:05                3457
function.ibase-commit.php                          13-Apr-2024 02:05                3255
function.ibase-connect.php                         13-Apr-2024 02:05               11034
function.ibase-db-info.php                         13-Apr-2024 02:05                2751
function.ibase-delete-user.php                     13-Apr-2024 02:05                3560
function.ibase-drop-db.php                         13-Apr-2024 02:05                3848
function.ibase-errcode.php                         13-Apr-2024 02:05                2729
function.ibase-errmsg.php                          13-Apr-2024 02:05                2734
function.ibase-execute.php                         13-Apr-2024 02:05                7148
function.ibase-fetch-assoc.php                     13-Apr-2024 02:05                4863
function.ibase-fetch-object.php                    13-Apr-2024 02:05                6708
function.ibase-fetch-row.php                       13-Apr-2024 02:05                4717
function.ibase-field-info.php                      13-Apr-2024 02:05                6999
function.ibase-free-event-handler.php              13-Apr-2024 02:05                3621
function.ibase-free-query.php                      13-Apr-2024 02:05                2868
function.ibase-free-result.php                     13-Apr-2024 02:05                2958
function.ibase-gen-id.php                          13-Apr-2024 02:05                2920
function.ibase-maintain-db.php                     13-Apr-2024 02:05                3203
function.ibase-modify-user.php                     13-Apr-2024 02:05                5149
function.ibase-name-result.php                     13-Apr-2024 02:05                5807
function.ibase-num-fields.php                      13-Apr-2024 02:05                6404
function.ibase-num-params.php                      13-Apr-2024 02:05                3494
function.ibase-param-info.php                      13-Apr-2024 02:05                3758
function.ibase-pconnect.php                        13-Apr-2024 02:05                8519
function.ibase-prepare.php                         13-Apr-2024 02:05                4613
function.ibase-query.php                           13-Apr-2024 02:05                7391
function.ibase-restore.php                         13-Apr-2024 02:05               10706
function.ibase-rollback-ret.php                    13-Apr-2024 02:05                3515
function.ibase-rollback.php                        13-Apr-2024 02:05                3327
function.ibase-server-info.php                     13-Apr-2024 02:05                9865
function.ibase-service-attach.php                  13-Apr-2024 02:05               11248
function.ibase-service-detach.php                  13-Apr-2024 02:05                6183
function.ibase-set-event-handler.php               13-Apr-2024 02:05                8156
function.ibase-trans.php                           13-Apr-2024 02:05                6473
function.ibase-wait-event.php                      13-Apr-2024 02:05                4432
function.iconv-get-encoding.php                    13-Apr-2024 02:05                5761
function.iconv-mime-decode-headers.php             13-Apr-2024 02:05               10972
function.iconv-mime-decode.php                     13-Apr-2024 02:05                8807
function.iconv-mime-encode.php                     13-Apr-2024 02:05               12240
function.iconv-set-encoding.php                    13-Apr-2024 02:05                5015
function.iconv-strlen.php                          13-Apr-2024 02:05                5185
function.iconv-strpos.php                          13-Apr-2024 02:05                7782
function.iconv-strrpos.php                         13-Apr-2024 02:05                6985
function.iconv-substr.php                          13-Apr-2024 02:05                8739
function.iconv.php                                 13-Apr-2024 02:05                9324
function.idate.php                                 13-Apr-2024 02:05               11772
function.idn-to-ascii.php                          13-Apr-2024 02:05                8271
function.idn-to-utf8.php                           13-Apr-2024 02:05                8293
function.igbinary-serialize.php                    13-Apr-2024 02:05               10520
function.igbinary-unserialize.php                  13-Apr-2024 02:05               10998
function.ignore-user-abort.php                     13-Apr-2024 02:05                7863
function.image-type-to-extension.php               13-Apr-2024 02:05                5516
function.image-type-to-mime-type.php               13-Apr-2024 02:05                9080
function.image2wbmp.php                            13-Apr-2024 02:05                6785
function.imageaffine.php                           13-Apr-2024 02:05                5111
function.imageaffinematrixconcat.php               13-Apr-2024 02:05                6683
function.imageaffinematrixget.php                  13-Apr-2024 02:05                6795
function.imagealphablending.php                    13-Apr-2024 02:05                8067
function.imageantialias.php                        13-Apr-2024 02:05               11550
function.imagearc.php                              13-Apr-2024 02:05               13961
function.imageavif.php                             13-Apr-2024 02:05                6494
function.imagebmp.php                              13-Apr-2024 02:05                8639
function.imagechar.php                             13-Apr-2024 02:05               10300
function.imagecharup.php                           13-Apr-2024 02:05               10199
function.imagecolorallocate.php                    13-Apr-2024 02:05               10368
function.imagecolorallocatealpha.php               13-Apr-2024 02:05               18692
function.imagecolorat.php                          13-Apr-2024 02:05               10648
function.imagecolorclosest.php                     13-Apr-2024 02:05               12370
function.imagecolorclosestalpha.php                13-Apr-2024 02:05               12761
function.imagecolorclosesthwb.php                  13-Apr-2024 02:05                6787
function.imagecolordeallocate.php                  13-Apr-2024 02:05                6097
function.imagecolorexact.php                       13-Apr-2024 02:05                8797
function.imagecolorexactalpha.php                  13-Apr-2024 02:05                9803
function.imagecolormatch.php                       13-Apr-2024 02:05                8690
function.imagecolorresolve.php                     13-Apr-2024 02:05                7978
function.imagecolorresolvealpha.php                13-Apr-2024 02:05                8725
function.imagecolorset.php                         13-Apr-2024 02:05                9269
function.imagecolorsforindex.php                   13-Apr-2024 02:05                7753
function.imagecolorstotal.php                      13-Apr-2024 02:05                5999
function.imagecolortransparent.php                 13-Apr-2024 02:05                9425
function.imageconvolution.php                      13-Apr-2024 02:05               12123
function.imagecopy.php                             13-Apr-2024 02:05                9692
function.imagecopymerge.php                        13-Apr-2024 02:05               10078
function.imagecopymergegray.php                    13-Apr-2024 02:05               10803
function.imagecopyresampled.php                    13-Apr-2024 02:05               19839
function.imagecopyresized.php                      13-Apr-2024 02:05               14702
function.imagecreate.php                           13-Apr-2024 02:05                8567
function.imagecreatefromavif.php                   13-Apr-2024 02:05                2964
function.imagecreatefrombmp.php                    13-Apr-2024 02:05                5841
function.imagecreatefromgd.php                     13-Apr-2024 02:05                6490
function.imagecreatefromgd2.php                    13-Apr-2024 02:05                6769
function.imagecreatefromgd2part.php                13-Apr-2024 02:05                9387
function.imagecreatefromgif.php                    13-Apr-2024 02:05               10045
function.imagecreatefromjpeg.php                   13-Apr-2024 02:05                9656
function.imagecreatefrompng.php                    13-Apr-2024 02:05                9606
function.imagecreatefromstring.php                 13-Apr-2024 02:05                8595
function.imagecreatefromtga.php                    13-Apr-2024 02:05                3704
function.imagecreatefromwbmp.php                   13-Apr-2024 02:05                9742
function.imagecreatefromwebp.php                   13-Apr-2024 02:05                6012
function.imagecreatefromxbm.php                    13-Apr-2024 02:05                5839
function.imagecreatefromxpm.php                    13-Apr-2024 02:05                6545
function.imagecreatetruecolor.php                  13-Apr-2024 02:05                7446
function.imagecrop.php                             13-Apr-2024 02:05                8211
function.imagecropauto.php                         13-Apr-2024 02:05               12130
function.imagedashedline.php                       13-Apr-2024 02:05               13005
function.imagedestroy.php                          13-Apr-2024 02:05                5499
function.imageellipse.php                          13-Apr-2024 02:05               10374
function.imagefill.php                             13-Apr-2024 02:05                7840
function.imagefilledarc.php                        13-Apr-2024 02:05               19241
function.imagefilledellipse.php                    13-Apr-2024 02:05               10093
function.imagefilledpolygon.php                    13-Apr-2024 02:05               12524
function.imagefilledrectangle.php                  13-Apr-2024 02:05                8714
function.imagefilltoborder.php                     13-Apr-2024 02:05               11737
function.imagefilter.php                           13-Apr-2024 02:05               34782
function.imageflip.php                             13-Apr-2024 02:05               10135
function.imagefontheight.php                       13-Apr-2024 02:05                6742
function.imagefontwidth.php                        13-Apr-2024 02:05                6697
function.imageftbbox.php                           13-Apr-2024 02:05               14642
function.imagefttext.php                           13-Apr-2024 02:05               16718
function.imagegammacorrect.php                     13-Apr-2024 02:05                6267
function.imagegd.php                               13-Apr-2024 02:05               11374
function.imagegd2.php                              13-Apr-2024 02:05               12308
function.imagegetclip.php                          13-Apr-2024 02:05                6247
function.imagegetinterpolation.php                 13-Apr-2024 02:05                3860
function.imagegif.php                              13-Apr-2024 02:05               17286
function.imagegrabscreen.php                       13-Apr-2024 02:05                5053
function.imagegrabwindow.php                       13-Apr-2024 02:05               10368
function.imageinterlace.php                        13-Apr-2024 02:05                7814
function.imageistruecolor.php                      13-Apr-2024 02:05                7688
function.imagejpeg.php                             13-Apr-2024 02:05               15697
function.imagelayereffect.php                      13-Apr-2024 02:05               12635
function.imageline.php                             13-Apr-2024 02:05               15807
function.imageloadfont.php                         13-Apr-2024 02:05                9751
function.imageopenpolygon.php                      13-Apr-2024 02:05               10899
function.imagepalettecopy.php                      13-Apr-2024 02:05                7703
function.imagepalettetotruecolor.php               13-Apr-2024 02:05               10081
function.imagepng.php                              13-Apr-2024 02:05                9710
function.imagepolygon.php                          13-Apr-2024 02:05               11190
function.imagerectangle.php                        13-Apr-2024 02:05               10845
function.imageresolution.php                       13-Apr-2024 02:05                8080
function.imagerotate.php                           13-Apr-2024 02:05                9552
function.imagesavealpha.php                        13-Apr-2024 02:05                8289
function.imagescale.php                            13-Apr-2024 02:05                7356
function.imagesetbrush.php                         13-Apr-2024 02:05                9797
function.imagesetclip.php                          13-Apr-2024 02:05                5413
function.imagesetinterpolation.php                 13-Apr-2024 02:05               11846
function.imagesetpixel.php                         13-Apr-2024 02:05               11710
function.imagesetstyle.php                         13-Apr-2024 02:05               12384
function.imagesetthickness.php                     13-Apr-2024 02:05                8666
function.imagesettile.php                          13-Apr-2024 02:05                8932
function.imagestring.php                           13-Apr-2024 02:05               10599
function.imagestringup.php                         13-Apr-2024 02:05                9762
function.imagesx.php                               13-Apr-2024 02:05                5247
function.imagesy.php                               13-Apr-2024 02:05                5273
function.imagetruecolortopalette.php               13-Apr-2024 02:05                7265
function.imagettfbbox.php                          13-Apr-2024 02:05               20202
function.imagettftext.php                          13-Apr-2024 02:05               19395
function.imagetypes.php                            13-Apr-2024 02:05                5272
function.imagewbmp.php                             13-Apr-2024 02:05               15766
function.imagewebp.php                             13-Apr-2024 02:05                8001
function.imagexbm.php                              13-Apr-2024 02:05               12581
function.imap-8bit.php                             13-Apr-2024 02:05                3196
function.imap-alerts.php                           13-Apr-2024 02:05                3395
function.imap-append.php                           13-Apr-2024 02:05               10057
function.imap-base64.php                           13-Apr-2024 02:05                3696
function.imap-binary.php                           13-Apr-2024 02:05                3212
function.imap-body.php                             13-Apr-2024 02:05                5953
function.imap-bodystruct.php                       13-Apr-2024 02:05                4932
function.imap-check.php                            13-Apr-2024 02:05                6372
function.imap-clearflag-full.php                   13-Apr-2024 02:05                6879
function.imap-close.php                            13-Apr-2024 02:05                5329
function.imap-create.php                           13-Apr-2024 02:05                1743
function.imap-createmailbox.php                    13-Apr-2024 02:05               14272
function.imap-delete.php                           13-Apr-2024 02:05               10983
function.imap-deletemailbox.php                    13-Apr-2024 02:05                5265
function.imap-errors.php                           13-Apr-2024 02:05                3599
function.imap-expunge.php                          13-Apr-2024 02:05                3808
function.imap-fetch-overview.php                   13-Apr-2024 02:05               11778
function.imap-fetchbody.php                        13-Apr-2024 02:05                6558
function.imap-fetchheader.php                      13-Apr-2024 02:05                6185
function.imap-fetchmime.php                        13-Apr-2024 02:05                6730
function.imap-fetchstructure.php                   13-Apr-2024 02:05               10285
function.imap-fetchtext.php                        13-Apr-2024 02:05                1724
function.imap-gc.php                               13-Apr-2024 02:05                6144
function.imap-get-quota.php                        13-Apr-2024 02:05               12843
function.imap-get-quotaroot.php                    13-Apr-2024 02:05                9584
function.imap-getacl.php                           13-Apr-2024 02:05                6200
function.imap-getmailboxes.php                     13-Apr-2024 02:05               13324
function.imap-getsubscribed.php                    13-Apr-2024 02:05                8800
function.imap-header.php                           13-Apr-2024 02:05                1956
function.imap-headerinfo.php                       13-Apr-2024 02:05               12526
function.imap-headers.php                          13-Apr-2024 02:05                3761
function.imap-is-open.php                          13-Apr-2024 02:05                4260
function.imap-last-error.php                       13-Apr-2024 02:05                3270
function.imap-list.php                             13-Apr-2024 02:05                9210
function.imap-listmailbox.php                      13-Apr-2024 02:05                1729
function.imap-listscan.php                         13-Apr-2024 02:05                7392
function.imap-listsubscribed.php                   13-Apr-2024 02:05                1750
function.imap-lsub.php                             13-Apr-2024 02:05                6534
function.imap-mail-compose.php                     13-Apr-2024 02:05               16719
function.imap-mail-copy.php                        13-Apr-2024 02:05                6730
function.imap-mail-move.php                        13-Apr-2024 02:05                7176
function.imap-mail.php                             13-Apr-2024 02:05                7720
function.imap-mailboxmsginfo.php                   13-Apr-2024 02:05                9545
function.imap-mime-header-decode.php               13-Apr-2024 02:05                6685
function.imap-msgno.php                            13-Apr-2024 02:05                4309
function.imap-mutf7-to-utf8.php                    13-Apr-2024 02:05                3416
function.imap-num-msg.php                          13-Apr-2024 02:05                4306
function.imap-num-recent.php                       13-Apr-2024 02:05                4076
function.imap-open.php                             13-Apr-2024 02:05               23607
function.imap-ping.php                             13-Apr-2024 02:05                5164
function.imap-qprint.php                           13-Apr-2024 02:05                3212
function.imap-rename.php                           13-Apr-2024 02:05                1746
function.imap-renamemailbox.php                    13-Apr-2024 02:05                5999
function.imap-reopen.php                           13-Apr-2024 02:05                9330
function.imap-rfc822-parse-adrlist.php             13-Apr-2024 02:05                7968
function.imap-rfc822-parse-headers.php             13-Apr-2024 02:05                3818
function.imap-rfc822-write-address.php             13-Apr-2024 02:05                5608
function.imap-savebody.php                         13-Apr-2024 02:05                6938
function.imap-scan.php                             13-Apr-2024 02:05                1711
function.imap-scanmailbox.php                      13-Apr-2024 02:05                1741
function.imap-search.php                           13-Apr-2024 02:05               14578
function.imap-set-quota.php                        13-Apr-2024 02:05                7169
function.imap-setacl.php                           13-Apr-2024 02:05                5786
function.imap-setflag-full.php                     13-Apr-2024 02:05                9048
function.imap-sort.php                             13-Apr-2024 02:05                9037
function.imap-status.php                           13-Apr-2024 02:05               11231
function.imap-subscribe.php                        13-Apr-2024 02:05                4696
function.imap-thread.php                           13-Apr-2024 02:05                8160
function.imap-timeout.php                          13-Apr-2024 02:05                4910
function.imap-uid.php                              13-Apr-2024 02:05                4826
function.imap-undelete.php                         13-Apr-2024 02:05                5201
function.imap-unsubscribe.php                      13-Apr-2024 02:05                4791
function.imap-utf7-decode.php                      13-Apr-2024 02:05                3940
function.imap-utf7-encode.php                      13-Apr-2024 02:05                3388
function.imap-utf8-to-mutf7.php                    13-Apr-2024 02:05                3422
function.imap-utf8.php                             13-Apr-2024 02:05                4460
function.implode.php                               13-Apr-2024 02:05                8024
function.in-array.php                              13-Apr-2024 02:05               12048
function.include-once.php                          13-Apr-2024 02:05                2397
function.include.php                               13-Apr-2024 02:05               21856
function.inet-ntop.php                             13-Apr-2024 02:05                6455
function.inet-pton.php                             13-Apr-2024 02:05                5037
function.inflate-add.php                           13-Apr-2024 02:05                6709
function.inflate-get-read-len.php                  13-Apr-2024 02:05                3629
function.inflate-get-status.php                    13-Apr-2024 02:05                3331
function.inflate-init.php                          13-Apr-2024 02:05                7517
function.ini-alter.php                             13-Apr-2024 02:05                1688
function.ini-get-all.php                           13-Apr-2024 02:05               10750
function.ini-get.php                               13-Apr-2024 02:05               10646
function.ini-parse-quantity.php                    13-Apr-2024 02:05                7829
function.ini-restore.php                           13-Apr-2024 02:05                6355
function.ini-set.php                               13-Apr-2024 02:05                6857
function.inotify-add-watch.php                     13-Apr-2024 02:05                4639
function.inotify-init.php                          13-Apr-2024 02:05                9355
function.inotify-queue-len.php                     13-Apr-2024 02:05                3984
function.inotify-read.php                          13-Apr-2024 02:05                4717
function.inotify-rm-watch.php                      13-Apr-2024 02:05                3740
function.intdiv.php                                13-Apr-2024 02:05                7497
function.interface-exists.php                      13-Apr-2024 02:05                5685
function.intl-error-name.php                       13-Apr-2024 02:05                5102
function.intl-get-error-code.php                   13-Apr-2024 02:05                4705
function.intl-get-error-message.php                13-Apr-2024 02:05                4685
function.intl-is-failure.php                       13-Apr-2024 02:05                5693
function.intval.php                                13-Apr-2024 02:05               14128
function.ip2long.php                               13-Apr-2024 02:05                9386
function.iptcembed.php                             13-Apr-2024 02:05               12057
function.iptcparse.php                             13-Apr-2024 02:05                4712
function.is-a.php                                  13-Apr-2024 02:05                7365
function.is-array.php                              13-Apr-2024 02:05                5691
function.is-bool.php                               13-Apr-2024 02:05                5594
function.is-callable.php                           13-Apr-2024 02:05               11457
function.is-countable.php                          13-Apr-2024 02:05                6378
function.is-dir.php                                13-Apr-2024 02:05                7018
function.is-double.php                             13-Apr-2024 02:05                1677
function.is-executable.php                         13-Apr-2024 02:05                6896
function.is-file.php                               13-Apr-2024 02:05                6391
function.is-finite.php                             13-Apr-2024 02:05                6239
function.is-float.php                              13-Apr-2024 02:05                6603
function.is-infinite.php                           13-Apr-2024 02:05                5379
function.is-int.php                                13-Apr-2024 02:05                6707
function.is-integer.php                            13-Apr-2024 02:05                1670
function.is-iterable.php                           13-Apr-2024 02:05                5849
function.is-link.php                               13-Apr-2024 02:05                5975
function.is-long.php                               13-Apr-2024 02:05                1651
function.is-nan.php                                13-Apr-2024 02:05                6347
function.is-null.php                               13-Apr-2024 02:05                6100
function.is-numeric.php                            13-Apr-2024 02:05               12242
function.is-object.php                             13-Apr-2024 02:05                7391
function.is-readable.php                           13-Apr-2024 02:05                6817
function.is-real.php                               13-Apr-2024 02:05                1873
function.is-resource.php                           13-Apr-2024 02:05                5229
function.is-scalar.php                             13-Apr-2024 02:05                8337
function.is-soap-fault.php                         13-Apr-2024 02:05                8461
function.is-string.php                             13-Apr-2024 02:05                6706
function.is-subclass-of.php                        13-Apr-2024 02:05               12944
function.is-tainted.php                            13-Apr-2024 02:05                2423
function.is-uploaded-file.php                      13-Apr-2024 02:05                7163
function.is-writable.php                           13-Apr-2024 02:05                6330
function.is-writeable.php                          13-Apr-2024 02:05                1738
function.isset.php                                 13-Apr-2024 02:05               16715
function.iterator-apply.php                        13-Apr-2024 02:05                7035
function.iterator-count.php                        13-Apr-2024 02:05                8812
function.iterator-to-array.php                     13-Apr-2024 02:05                8139
function.jddayofweek.php                           13-Apr-2024 02:05                3852
function.jdmonthname.php                           13-Apr-2024 02:05                5108
function.jdtofrench.php                            13-Apr-2024 02:05                3150
function.jdtogregorian.php                         13-Apr-2024 02:05                3225
function.jdtojewish.php                            13-Apr-2024 02:05                7612
function.jdtojulian.php                            13-Apr-2024 02:05                3160
function.jdtounix.php                              13-Apr-2024 02:05                4668
function.jewishtojd.php                            13-Apr-2024 02:05                4809
function.join.php                                  13-Apr-2024 02:05                1633
function.jpeg2wbmp.php                             13-Apr-2024 02:05                6748
function.json-decode.php                           13-Apr-2024 02:05               20862
function.json-encode.php                           13-Apr-2024 02:05               31710
function.json-last-error-msg.php                   13-Apr-2024 02:05                3149
function.json-last-error.php                       13-Apr-2024 02:05               14389
function.json-validate.php                         13-Apr-2024 02:05                9007
function.juliantojd.php                            13-Apr-2024 02:05                4858
function.key-exists.php                            13-Apr-2024 02:05                1709
function.key.php                                   13-Apr-2024 02:05                8205
function.krsort.php                                13-Apr-2024 02:05                9198
function.ksort.php                                 13-Apr-2024 02:05               11104
function.lcfirst.php                               13-Apr-2024 02:05                5865
function.lcg-value.php                             13-Apr-2024 02:05                5506
function.lchgrp.php                                13-Apr-2024 02:05                6319
function.lchown.php                                13-Apr-2024 02:05                6136
function.ldap-8859-to-t61.php                      13-Apr-2024 02:05                3399
function.ldap-add-ext.php                          13-Apr-2024 02:05                6214
function.ldap-add.php                              13-Apr-2024 02:05               10882
function.ldap-bind-ext.php                         13-Apr-2024 02:05                6373
function.ldap-bind.php                             13-Apr-2024 02:05                9690
function.ldap-close.php                            13-Apr-2024 02:05                1694
function.ldap-compare.php                          13-Apr-2024 02:05               10723
function.ldap-connect-wallet.php                   13-Apr-2024 02:05                4323
function.ldap-connect.php                          13-Apr-2024 02:05               10444
function.ldap-control-paged-result-response.php    13-Apr-2024 02:05                6055
function.ldap-control-paged-result.php             13-Apr-2024 02:05               14836
function.ldap-count-entries.php                    13-Apr-2024 02:05                5993
function.ldap-count-references.php                 13-Apr-2024 02:05                4990
function.ldap-delete-ext.php                       13-Apr-2024 02:05                5709
function.ldap-delete.php                           13-Apr-2024 02:05                5662
function.ldap-dn2ufn.php                           13-Apr-2024 02:05                2846
function.ldap-err2str.php                          13-Apr-2024 02:05                4845
function.ldap-errno.php                            13-Apr-2024 02:05                7842
function.ldap-error.php                            13-Apr-2024 02:05                4855
function.ldap-escape.php                           13-Apr-2024 02:05                6535
function.ldap-exop-passwd.php                      13-Apr-2024 02:05               10915
function.ldap-exop-refresh.php                     13-Apr-2024 02:05                5490
function.ldap-exop-sync.php                        13-Apr-2024 02:05                5476
function.ldap-exop-whoami.php                      13-Apr-2024 02:05                4135
function.ldap-exop.php                             13-Apr-2024 02:05               13177
function.ldap-explode-dn.php                       13-Apr-2024 02:05                3804
function.ldap-first-attribute.php                  13-Apr-2024 02:05                5827
function.ldap-first-entry.php                      13-Apr-2024 02:05                6325
function.ldap-first-reference.php                  13-Apr-2024 02:05                2386
function.ldap-free-result.php                      13-Apr-2024 02:05                4410
function.ldap-get-attributes.php                   13-Apr-2024 02:05                8753
function.ldap-get-dn.php                           13-Apr-2024 02:05                4615
function.ldap-get-entries.php                      13-Apr-2024 02:05                6533
function.ldap-get-option.php                       13-Apr-2024 02:05               17126
function.ldap-get-values-len.php                   13-Apr-2024 02:05                5878
function.ldap-get-values.php                       13-Apr-2024 02:05                9419
function.ldap-list.php                             13-Apr-2024 02:05               16664
function.ldap-mod-add.php                          13-Apr-2024 02:05                7184
function.ldap-mod-del.php                          13-Apr-2024 02:05                6661
function.ldap-mod-replace.php                      13-Apr-2024 02:05                7112
function.ldap-mod_add-ext.php                      13-Apr-2024 02:05                6165
function.ldap-mod_del-ext.php                      13-Apr-2024 02:05                6180
function.ldap-mod_replace-ext.php                  13-Apr-2024 02:05                6245
function.ldap-modify-batch.php                     13-Apr-2024 02:05               19449
function.ldap-modify.php                           13-Apr-2024 02:05                2093
function.ldap-next-attribute.php                   13-Apr-2024 02:05                5605
function.ldap-next-entry.php                       13-Apr-2024 02:05                6225
function.ldap-next-reference.php                   13-Apr-2024 02:05                2314
function.ldap-parse-exop.php                       13-Apr-2024 02:05                6353
function.ldap-parse-reference.php                  13-Apr-2024 02:05                2446
function.ldap-parse-result.php                     13-Apr-2024 02:05               10319
function.ldap-read.php                             13-Apr-2024 02:05               14152
function.ldap-rename-ext.php                       13-Apr-2024 02:05                6531
function.ldap-rename.php                           13-Apr-2024 02:05                7669
function.ldap-sasl-bind.php                        13-Apr-2024 02:05                7372
function.ldap-search.php                           13-Apr-2024 02:05               17017
function.ldap-set-option.php                       13-Apr-2024 02:05               20118
function.ldap-set-rebind-proc.php                  13-Apr-2024 02:05                3412
function.ldap-sort.php                             13-Apr-2024 02:05                7333
function.ldap-start-tls.php                        13-Apr-2024 02:05                2065
function.ldap-t61-to-8859.php                      13-Apr-2024 02:05                2204
function.ldap-unbind.php                           13-Apr-2024 02:05                4062
function.levenshtein.php                           13-Apr-2024 02:05               12772
function.libxml-clear-errors.php                   13-Apr-2024 02:05                2895
function.libxml-disable-entity-loader.php          13-Apr-2024 02:05                5330
function.libxml-get-errors.php                     13-Apr-2024 02:05               10788
function.libxml-get-external-entity-loader.php     13-Apr-2024 02:05                3764
function.libxml-get-last-error.php                 13-Apr-2024 02:05                3301
function.libxml-set-external-entity-loader.php     13-Apr-2024 02:05               10903
function.libxml-set-streams-context.php            13-Apr-2024 02:05                5166
function.libxml-use-internal-errors.php            13-Apr-2024 02:05                6995
function.link.php                                  13-Apr-2024 02:05                6224
function.linkinfo.php                              13-Apr-2024 02:05                4721
function.list.php                                  13-Apr-2024 02:05               17229
function.localeconv.php                            13-Apr-2024 02:05                9736
function.localtime.php                             13-Apr-2024 02:05                9681
function.log.php                                   13-Apr-2024 02:05                4105
function.log10.php                                 13-Apr-2024 02:05                2683
function.log1p.php                                 13-Apr-2024 02:05                3468
function.long2ip.php                               13-Apr-2024 02:05                4691
function.lstat.php                                 13-Apr-2024 02:05                6861
function.ltrim.php                                 13-Apr-2024 02:05                9659
function.lzf-compress.php                          13-Apr-2024 02:05                2986
function.lzf-decompress.php                        13-Apr-2024 02:05                3034
function.lzf-optimized-for.php                     13-Apr-2024 02:05                2326
function.mail.php                                  13-Apr-2024 02:05               27709
function.mailparse-determine-best-xfer-encoding..> 13-Apr-2024 02:05                4397
function.mailparse-msg-create.php                  13-Apr-2024 02:05                3498
function.mailparse-msg-extract-part-file.php       13-Apr-2024 02:05                5557
function.mailparse-msg-extract-part.php            13-Apr-2024 02:05                4209
function.mailparse-msg-extract-whole-part-file.php 13-Apr-2024 02:05                4233
function.mailparse-msg-free.php                    13-Apr-2024 02:05                3715
function.mailparse-msg-get-part-data.php           13-Apr-2024 02:05                2613
function.mailparse-msg-get-part.php                13-Apr-2024 02:05                2924
function.mailparse-msg-get-structure.php           13-Apr-2024 02:05                2643
function.mailparse-msg-parse-file.php              13-Apr-2024 02:05                4509
function.mailparse-msg-parse.php                   13-Apr-2024 02:05                3736
function.mailparse-rfc822-parse-addresses.php      13-Apr-2024 02:05                5782
function.mailparse-stream-encode.php               13-Apr-2024 02:05                6189
function.mailparse-uudecode-all.php                13-Apr-2024 02:05                7080
function.max.php                                   13-Apr-2024 02:05               12872
function.mb-check-encoding.php                     13-Apr-2024 02:05                5732
function.mb-chr.php                                13-Apr-2024 02:05                7425
function.mb-convert-case.php                       13-Apr-2024 02:05               12099
function.mb-convert-encoding.php                   13-Apr-2024 02:05               12199
function.mb-convert-kana.php                       13-Apr-2024 02:05               10145
function.mb-convert-variables.php                  13-Apr-2024 02:05                6803
function.mb-decode-mimeheader.php                  13-Apr-2024 02:05                3143
function.mb-decode-numericentity.php               13-Apr-2024 02:05               34014
function.mb-detect-encoding.php                    13-Apr-2024 02:05               17613
function.mb-detect-order.php                       13-Apr-2024 02:05                9387
function.mb-encode-mimeheader.php                  13-Apr-2024 02:05                9961
function.mb-encode-numericentity.php               13-Apr-2024 02:05               12795
function.mb-encoding-aliases.php                   13-Apr-2024 02:05                6673
function.mb-ereg-match.php                         13-Apr-2024 02:05                5813
function.mb-ereg-replace-callback.php              13-Apr-2024 02:05               13012
function.mb-ereg-replace.php                       13-Apr-2024 02:05                7591
function.mb-ereg-search-getpos.php                 13-Apr-2024 02:05                4031
function.mb-ereg-search-getregs.php                13-Apr-2024 02:05                4524
function.mb-ereg-search-init.php                   13-Apr-2024 02:05                6456
function.mb-ereg-search-pos.php                    13-Apr-2024 02:05                6218
function.mb-ereg-search-regs.php                   13-Apr-2024 02:05                6034
function.mb-ereg-search-setpos.php                 13-Apr-2024 02:05                4745
function.mb-ereg-search.php                        13-Apr-2024 02:05                5944
function.mb-ereg.php                               13-Apr-2024 02:05                6905
function.mb-eregi-replace.php                      13-Apr-2024 02:05                7258
function.mb-eregi.php                              13-Apr-2024 02:05                7101
function.mb-get-info.php                           13-Apr-2024 02:05                6399
function.mb-http-input.php                         13-Apr-2024 02:05                5350
function.mb-http-output.php                        13-Apr-2024 02:05                5307
function.mb-internal-encoding.php                  13-Apr-2024 02:05                7592
function.mb-language.php                           13-Apr-2024 02:05                6834
function.mb-list-encodings.php                     13-Apr-2024 02:05                5198
function.mb-ord.php                                13-Apr-2024 02:05                7026
function.mb-output-handler.php                     13-Apr-2024 02:05                5388
function.mb-parse-str.php                          13-Apr-2024 02:05                4854
function.mb-preferred-mime-name.php                13-Apr-2024 02:05                4521
function.mb-regex-encoding.php                     13-Apr-2024 02:05                4698
function.mb-regex-set-options.php                  13-Apr-2024 02:05                9366
function.mb-scrub.php                              13-Apr-2024 02:05                4269
function.mb-send-mail.php                          13-Apr-2024 02:05               11053
function.mb-split.php                              13-Apr-2024 02:05                4742
function.mb-str-pad.php                            13-Apr-2024 02:05                8873
function.mb-str-split.php                          13-Apr-2024 02:05                5756
function.mb-strcut.php                             13-Apr-2024 02:05                8046
function.mb-strimwidth.php                         13-Apr-2024 02:05                8125
function.mb-stripos.php                            13-Apr-2024 02:05                6775
function.mb-stristr.php                            13-Apr-2024 02:05                7170
function.mb-strlen.php                             13-Apr-2024 02:05                5178
function.mb-strpos.php                             13-Apr-2024 02:05                6643
function.mb-strrchr.php                            13-Apr-2024 02:05                6934
function.mb-strrichr.php                           13-Apr-2024 02:05                7033
function.mb-strripos.php                           13-Apr-2024 02:05                6644
function.mb-strrpos.php                            13-Apr-2024 02:05                6935
function.mb-strstr.php                             13-Apr-2024 02:05                6933
function.mb-strtolower.php                         13-Apr-2024 02:05                7294
function.mb-strtoupper.php                         13-Apr-2024 02:05                7303
function.mb-strwidth.php                           13-Apr-2024 02:05                9193
function.mb-substitute-character.php               13-Apr-2024 02:05                7261
function.mb-substr-count.php                       13-Apr-2024 02:05                5957
function.mb-substr.php                             13-Apr-2024 02:05                6815
function.mcrypt-create-iv.php                      13-Apr-2024 02:05                6960
function.mcrypt-decrypt.php                        13-Apr-2024 02:05                6074
function.mcrypt-enc-get-algorithms-name.php        13-Apr-2024 02:05                5340
function.mcrypt-enc-get-block-size.php             13-Apr-2024 02:05                3014
function.mcrypt-enc-get-iv-size.php                13-Apr-2024 02:05                3387
function.mcrypt-enc-get-key-size.php               13-Apr-2024 02:05                3106
function.mcrypt-enc-get-modes-name.php             13-Apr-2024 02:05                5264
function.mcrypt-enc-get-supported-key-sizes.php    13-Apr-2024 02:05                5131
function.mcrypt-enc-is-block-algorithm-mode.php    13-Apr-2024 02:05                3725
function.mcrypt-enc-is-block-algorithm.php         13-Apr-2024 02:05                3456
function.mcrypt-enc-is-block-mode.php              13-Apr-2024 02:05                3562
function.mcrypt-enc-self-test.php                  13-Apr-2024 02:05                3192
function.mcrypt-encrypt.php                        13-Apr-2024 02:05               14225
function.mcrypt-generic-deinit.php                 13-Apr-2024 02:05                4158
function.mcrypt-generic-init.php                   13-Apr-2024 02:05                5592
function.mcrypt-generic.php                        13-Apr-2024 02:05                6424
function.mcrypt-get-block-size.php                 13-Apr-2024 02:05                6913
function.mcrypt-get-cipher-name.php                13-Apr-2024 02:05                5112
function.mcrypt-get-iv-size.php                    13-Apr-2024 02:05                6613
function.mcrypt-get-key-size.php                   13-Apr-2024 02:05                7108
function.mcrypt-list-algorithms.php                13-Apr-2024 02:05                4944
function.mcrypt-list-modes.php                     13-Apr-2024 02:05                4852
function.mcrypt-module-close.php                   13-Apr-2024 02:05                3543
function.mcrypt-module-get-algo-block-size.php     13-Apr-2024 02:05                3658
function.mcrypt-module-get-algo-key-size.php       13-Apr-2024 02:05                3736
function.mcrypt-module-get-supported-key-sizes.php 13-Apr-2024 02:05                4969
function.mcrypt-module-is-block-algorithm-mode.php 13-Apr-2024 02:05                4707
function.mcrypt-module-is-block-algorithm.php      13-Apr-2024 02:05                4266
function.mcrypt-module-is-block-mode.php           13-Apr-2024 02:05                4733
function.mcrypt-module-open.php                    13-Apr-2024 02:05               14903
function.mcrypt-module-self-test.php               13-Apr-2024 02:05                5138
function.md5-file.php                              13-Apr-2024 02:05                5329
function.md5.php                                   13-Apr-2024 02:05                6212
function.mdecrypt-generic.php                      13-Apr-2024 02:05               11145
function.memcache-debug.php                        13-Apr-2024 02:05                3970
function.memory-get-peak-usage.php                 13-Apr-2024 02:05                3858
function.memory-get-usage.php                      13-Apr-2024 02:05                5758
function.memory-reset-peak-usage.php               13-Apr-2024 02:05                5032
function.metaphone.php                             13-Apr-2024 02:05                8452
function.method-exists.php                         13-Apr-2024 02:05                6837
function.mhash-count.php                           13-Apr-2024 02:05                4786
function.mhash-get-block-size.php                  13-Apr-2024 02:05                4700
function.mhash-get-hash-name.php                   13-Apr-2024 02:05                4654
function.mhash-keygen-s2k.php                      13-Apr-2024 02:05                6201
function.mhash.php                                 13-Apr-2024 02:05                4896
function.microtime.php                             13-Apr-2024 02:05                8170
function.mime-content-type.php                     13-Apr-2024 02:05                5176
function.min.php                                   13-Apr-2024 02:05               13413
function.mkdir.php                                 13-Apr-2024 02:05               10003
function.mktime.php                                13-Apr-2024 02:05               19521
function.money-format.php                          13-Apr-2024 02:05               19473
function.mongodb.bson-fromjson.php                 13-Apr-2024 02:05                5840
function.mongodb.bson-fromphp.php                  13-Apr-2024 02:05                6182
function.mongodb.bson-tocanonicalextendedjson.php  13-Apr-2024 02:05               13881
function.mongodb.bson-tojson.php                   13-Apr-2024 02:05               14956
function.mongodb.bson-tophp.php                    13-Apr-2024 02:05                9068
function.mongodb.bson-torelaxedextendedjson.php    13-Apr-2024 02:05               13578
function.mongodb.driver.monitoring.addsubscribe..> 13-Apr-2024 02:05                5034
function.mongodb.driver.monitoring.removesubscr..> 13-Apr-2024 02:05                4894
function.move-uploaded-file.php                    13-Apr-2024 02:05                9129
function.mqseries-back.php                         13-Apr-2024 02:05                6629
function.mqseries-begin.php                        13-Apr-2024 02:05                7606
function.mqseries-close.php                        13-Apr-2024 02:05                6719
function.mqseries-cmit.php                         13-Apr-2024 02:05                6550
function.mqseries-conn.php                         13-Apr-2024 02:05                6079
function.mqseries-connx.php                        13-Apr-2024 02:05               12624
function.mqseries-disc.php                         13-Apr-2024 02:05                5688
function.mqseries-get.php                          13-Apr-2024 02:05               12248
function.mqseries-inq.php                          13-Apr-2024 02:05                9357
function.mqseries-open.php                         13-Apr-2024 02:05                7342
function.mqseries-put.php                          13-Apr-2024 02:05               12913
function.mqseries-put1.php                         13-Apr-2024 02:05                6283
function.mqseries-set.php                          13-Apr-2024 02:05                6209
function.mqseries-strerror.php                     13-Apr-2024 02:05                4274
function.msg-get-queue.php                         13-Apr-2024 02:05                5981
function.msg-queue-exists.php                      13-Apr-2024 02:05                3535
function.msg-receive.php                           13-Apr-2024 02:05               12538
function.msg-remove-queue.php                      13-Apr-2024 02:05                4817
function.msg-send.php                              13-Apr-2024 02:05               10554
function.msg-set-queue.php                         13-Apr-2024 02:05                5447
function.msg-stat-queue.php                        13-Apr-2024 02:05                6911
function.mt-getrandmax.php                         13-Apr-2024 02:05                3449
function.mt-rand.php                               13-Apr-2024 02:05               11248
function.mt-srand.php                              13-Apr-2024 02:05                9217
function.mysql-affected-rows.php                   13-Apr-2024 02:05               12528
function.mysql-client-encoding.php                 13-Apr-2024 02:05                6345
function.mysql-close.php                           13-Apr-2024 02:05                7785
function.mysql-connect.php                         13-Apr-2024 02:05               18088
function.mysql-create-db.php                       13-Apr-2024 02:05                8762
function.mysql-data-seek.php                       13-Apr-2024 02:05               12273
function.mysql-db-name.php                         13-Apr-2024 02:05                7977
function.mysql-db-query.php                        13-Apr-2024 02:05               10534
function.mysql-drop-db.php                         13-Apr-2024 02:05                7938
function.mysql-errno.php                           13-Apr-2024 02:05                8489
function.mysql-error.php                           13-Apr-2024 02:05                8465
function.mysql-escape-string.php                   13-Apr-2024 02:05                6703
function.mysql-fetch-array.php                     13-Apr-2024 02:05               16018
function.mysql-fetch-assoc.php                     13-Apr-2024 02:05               11719
function.mysql-fetch-field.php                     13-Apr-2024 02:05               13383
function.mysql-fetch-lengths.php                   13-Apr-2024 02:05                7756
function.mysql-fetch-object.php                    13-Apr-2024 02:05               12099
function.mysql-fetch-row.php                       13-Apr-2024 02:05                7768
function.mysql-field-flags.php                     13-Apr-2024 02:05                8754
function.mysql-field-len.php                       13-Apr-2024 02:05                7102
function.mysql-field-name.php                      13-Apr-2024 02:05                9252
function.mysql-field-seek.php                      13-Apr-2024 02:05                5278
function.mysql-field-table.php                     13-Apr-2024 02:05                7785
function.mysql-field-type.php                      13-Apr-2024 02:05               11829
function.mysql-free-result.php                     13-Apr-2024 02:05                7925
function.mysql-get-client-info.php                 13-Apr-2024 02:05                5302
function.mysql-get-host-info.php                   13-Apr-2024 02:05                7197
function.mysql-get-proto-info.php                  13-Apr-2024 02:05                6758
function.mysql-get-server-info.php                 13-Apr-2024 02:05                7296
function.mysql-info.php                            13-Apr-2024 02:05                6517
function.mysql-insert-id.php                       13-Apr-2024 02:05                8564
function.mysql-list-dbs.php                        13-Apr-2024 02:05                9003
function.mysql-list-fields.php                     13-Apr-2024 02:05                9127
function.mysql-list-processes.php                  13-Apr-2024 02:05                7793
function.mysql-list-tables.php                     13-Apr-2024 02:05                9886
function.mysql-num-fields.php                      13-Apr-2024 02:05                6663
function.mysql-num-rows.php                        13-Apr-2024 02:05                8147
function.mysql-pconnect.php                        13-Apr-2024 02:05                9012
function.mysql-ping.php                            13-Apr-2024 02:05                8125
function.mysql-query.php                           13-Apr-2024 02:05               14443
function.mysql-real-escape-string.php              13-Apr-2024 02:05               16257
function.mysql-result.php                          13-Apr-2024 02:05                9933
function.mysql-select-db.php                       13-Apr-2024 02:05                7940
function.mysql-set-charset.php                     13-Apr-2024 02:05                6144
function.mysql-stat.php                            13-Apr-2024 02:05                9613
function.mysql-tablename.php                       13-Apr-2024 02:05                8353
function.mysql-thread-id.php                       13-Apr-2024 02:05                6913
function.mysql-unbuffered-query.php                13-Apr-2024 02:05                7426
function.mysql-xdevapi-expression.php              13-Apr-2024 02:05                4881
function.mysql-xdevapi-getsession.php              13-Apr-2024 02:05               14165
function.mysqli-connect.php                        13-Apr-2024 02:05                2428
function.mysqli-escape-string.php                  13-Apr-2024 02:05                1951
function.mysqli-execute.php                        13-Apr-2024 02:05                2528
function.mysqli-get-client-stats.php               13-Apr-2024 02:05                8403
function.mysqli-get-links-stats.php                13-Apr-2024 02:05                3479
function.mysqli-report.php                         13-Apr-2024 02:05                1753
function.mysqli-set-opt.php                        13-Apr-2024 02:05                1842
function.natcasesort.php                           13-Apr-2024 02:05                8083
function.natsort.php                               13-Apr-2024 02:05               11281
function.net-get-interfaces.php                    13-Apr-2024 02:05                5090
function.next.php                                  13-Apr-2024 02:05               10084
function.ngettext.php                              13-Apr-2024 02:05                5757
function.nl-langinfo.php                           13-Apr-2024 02:05               15619
function.nl2br.php                                 13-Apr-2024 02:05                6970
function.number-format.php                         13-Apr-2024 02:05                9173
function.oauth-get-sbs.php                         13-Apr-2024 02:05                3095
function.oauth-urlencode.php                       13-Apr-2024 02:05                2658
function.ob-clean.php                              13-Apr-2024 02:05                4890
function.ob-end-clean.php                          13-Apr-2024 02:05                6135
function.ob-end-flush.php                          13-Apr-2024 02:05                5931
function.ob-flush.php                              13-Apr-2024 02:05                4968
function.ob-get-clean.php                          13-Apr-2024 02:05                7297
function.ob-get-contents.php                       13-Apr-2024 02:05                4880
function.ob-get-flush.php                          13-Apr-2024 02:05                6990
function.ob-get-length.php                         13-Apr-2024 02:05                4822
function.ob-get-level.php                          13-Apr-2024 02:05                3769
function.ob-get-status.php                         13-Apr-2024 02:05               10785
function.ob-gzhandler.php                          13-Apr-2024 02:05                6393
function.ob-iconv-handler.php                      13-Apr-2024 02:05                5288
function.ob-implicit-flush.php                     13-Apr-2024 02:05                5539
function.ob-list-handlers.php                      13-Apr-2024 02:05               14225
function.ob-start.php                              13-Apr-2024 02:05               18869
function.ob-tidyhandler.php                        13-Apr-2024 02:05                4459
function.oci-bind-array-by-name.php                13-Apr-2024 02:05               14100
function.oci-bind-by-name.php                      13-Apr-2024 02:05               82275
function.oci-cancel.php                            13-Apr-2024 02:05                2770
function.oci-client-version.php                    13-Apr-2024 02:05                4058
function.oci-close.php                             13-Apr-2024 02:05               19536
function.oci-commit.php                            13-Apr-2024 02:05               11802
function.oci-connect.php                           13-Apr-2024 02:05               37016
function.oci-define-by-name.php                    13-Apr-2024 02:05               24321
function.oci-error.php                             13-Apr-2024 02:05               12219
function.oci-execute.php                           13-Apr-2024 02:05               22483
function.oci-fetch-all.php                         13-Apr-2024 02:05               25450
function.oci-fetch-array.php                       13-Apr-2024 02:05               66377
function.oci-fetch-assoc.php                       13-Apr-2024 02:05                8994
function.oci-fetch-object.php                      13-Apr-2024 02:05               18926
function.oci-fetch-row.php                         13-Apr-2024 02:05                9033
function.oci-fetch.php                             13-Apr-2024 02:05               13764
function.oci-field-is-null.php                     13-Apr-2024 02:05                8017
function.oci-field-name.php                        13-Apr-2024 02:05                9754
function.oci-field-precision.php                   13-Apr-2024 02:05                8816
function.oci-field-scale.php                       13-Apr-2024 02:05                8832
function.oci-field-size.php                        13-Apr-2024 02:05               10395
function.oci-field-type-raw.php                    13-Apr-2024 02:05                8085
function.oci-field-type.php                        13-Apr-2024 02:05               10627
function.oci-free-descriptor.php                   13-Apr-2024 02:05                3603
function.oci-free-statement.php                    13-Apr-2024 02:05                3018
function.oci-get-implicit-resultset.php            13-Apr-2024 02:05               28792
function.oci-internal-debug.php                    13-Apr-2024 02:05                3192
function.oci-new-collection.php                    13-Apr-2024 02:05                5285
function.oci-new-connect.php                       13-Apr-2024 02:05               17797
function.oci-new-cursor.php                        13-Apr-2024 02:05                7884
function.oci-new-descriptor.php                    13-Apr-2024 02:05               18824
function.oci-num-fields.php                        13-Apr-2024 02:05                7013
function.oci-num-rows.php                          13-Apr-2024 02:05                7942
function.oci-parse.php                             13-Apr-2024 02:05               12965
function.oci-password-change.php                   13-Apr-2024 02:05               14013
function.oci-pconnect.php                          13-Apr-2024 02:05               16257
function.oci-register-taf-callback.php             13-Apr-2024 02:05                5782
function.oci-result.php                            13-Apr-2024 02:05                8889
function.oci-rollback.php                          13-Apr-2024 02:05               15134
function.oci-server-version.php                    13-Apr-2024 02:05                4861
function.oci-set-action.php                        13-Apr-2024 02:05                9146
function.oci-set-call-timout.php                   13-Apr-2024 02:05                5954
function.oci-set-client-identifier.php             13-Apr-2024 02:05                8930
function.oci-set-client-info.php                   13-Apr-2024 02:05                9001
function.oci-set-db-operation.php                  13-Apr-2024 02:05                8027
function.oci-set-edition.php                       13-Apr-2024 02:05               10308
function.oci-set-module-name.php                   13-Apr-2024 02:05                9248
function.oci-set-prefetch-lob.php                  13-Apr-2024 02:05                9246
function.oci-set-prefetch.php                      13-Apr-2024 02:05               21892
function.oci-statement-type.php                    13-Apr-2024 02:05                7157
function.oci-unregister-taf-callback.php           13-Apr-2024 02:05                3633
function.ocibindbyname.php                         13-Apr-2024 02:05                2013
function.ocicancel.php                             13-Apr-2024 02:05                1955
function.ocicloselob.php                           13-Apr-2024 02:05                1954
function.ocicollappend.php                         13-Apr-2024 02:05                2019
function.ocicollassign.php                         13-Apr-2024 02:05                2024
function.ocicollassignelem.php                     13-Apr-2024 02:05                2069
function.ocicollgetelem.php                        13-Apr-2024 02:05                2036
function.ocicollmax.php                            13-Apr-2024 02:05                1988
function.ocicollsize.php                           13-Apr-2024 02:05                1991
function.ocicolltrim.php                           13-Apr-2024 02:05                2001
function.ocicolumnisnull.php                       13-Apr-2024 02:05                2025
function.ocicolumnname.php                         13-Apr-2024 02:05                2017
function.ocicolumnprecision.php                    13-Apr-2024 02:05                2060
function.ocicolumnscale.php                        13-Apr-2024 02:05                2024
function.ocicolumnsize.php                         13-Apr-2024 02:05                2005
function.ocicolumntype.php                         13-Apr-2024 02:05                2009
function.ocicolumntyperaw.php                      13-Apr-2024 02:05                2032
function.ocicommit.php                             13-Apr-2024 02:05                1969
function.ocidefinebyname.php                       13-Apr-2024 02:05                2015
function.ocierror.php                              13-Apr-2024 02:05                1946
function.ociexecute.php                            13-Apr-2024 02:05                1950
function.ocifetch.php                              13-Apr-2024 02:05                1940
function.ocifetchinto.php                          13-Apr-2024 02:05                2688
function.ocifetchstatement.php                     13-Apr-2024 02:05                2033
function.ocifreecollection.php                     13-Apr-2024 02:05                2051
function.ocifreecursor.php                         13-Apr-2024 02:05                2023
function.ocifreedesc.php                           13-Apr-2024 02:05                1967
function.ocifreestatement.php                      13-Apr-2024 02:05                2042
function.ociinternaldebug.php                      13-Apr-2024 02:05                2056
function.ociloadlob.php                            13-Apr-2024 02:05                1952
function.ocilob-copy.php                           13-Apr-2024 02:05                4850
function.ocilob-is-equal.php                       13-Apr-2024 02:05                3391
function.ocilogoff.php                             13-Apr-2024 02:05                1939
function.ocilogon.php                              13-Apr-2024 02:05                1954
function.ocinewcollection.php                      13-Apr-2024 02:05                2040
function.ocinewcursor.php                          13-Apr-2024 02:05                2008
function.ocinewdescriptor.php                      13-Apr-2024 02:05                2030
function.ocinlogon.php                             13-Apr-2024 02:05                1979
function.ocinumcols.php                            13-Apr-2024 02:05                1964
function.ociparse.php                              13-Apr-2024 02:05                1934
function.ociplogon.php                             13-Apr-2024 02:05                1949
function.ociresult.php                             13-Apr-2024 02:05                1947
function.ocirollback.php                           13-Apr-2024 02:05                1969
function.ocirowcount.php                           13-Apr-2024 02:05                1971
function.ocisavelob.php                            13-Apr-2024 02:05                1952
function.ocisavelobfile.php                        13-Apr-2024 02:05                1990
function.ociserverversion.php                      13-Apr-2024 02:05                2044
function.ocisetprefetch.php                        13-Apr-2024 02:05                2030
function.ocistatementtype.php                      13-Apr-2024 02:05                2050
function.ociwritelobtofile.php                     13-Apr-2024 02:05                2031
function.ociwritetemporarylob.php                  13-Apr-2024 02:05                2054
function.octdec.php                                13-Apr-2024 02:05                6000
function.odbc-autocommit.php                       13-Apr-2024 02:05                5688
function.odbc-binmode.php                          13-Apr-2024 02:05                7812
function.odbc-close-all.php                        13-Apr-2024 02:05                2684
function.odbc-close.php                            13-Apr-2024 02:05                3003
function.odbc-columnprivileges.php                 13-Apr-2024 02:05                9103
function.odbc-columns.php                          13-Apr-2024 02:05               12164
function.odbc-commit.php                           13-Apr-2024 02:05                2805
function.odbc-connect.php                          13-Apr-2024 02:05                9239
function.odbc-connection-string-is-quoted.php      13-Apr-2024 02:05                3907
function.odbc-connection-string-quote.php          13-Apr-2024 02:05                6079
function.odbc-connection-string-should-quote.php   13-Apr-2024 02:05                4338
function.odbc-cursor.php                           13-Apr-2024 02:05                2790
function.odbc-data-source.php                      13-Apr-2024 02:05                5970
function.odbc-do.php                               13-Apr-2024 02:05                1673
function.odbc-error.php                            13-Apr-2024 02:05                4331
function.odbc-errormsg.php                         13-Apr-2024 02:05                4396
function.odbc-exec.php                             13-Apr-2024 02:05                4124
function.odbc-execute.php                          13-Apr-2024 02:05                7333
function.odbc-fetch-array.php                      13-Apr-2024 02:05                4384
function.odbc-fetch-into.php                       13-Apr-2024 02:05                5158
function.odbc-fetch-object.php                     13-Apr-2024 02:05                4416
function.odbc-fetch-row.php                        13-Apr-2024 02:05                5169
function.odbc-field-len.php                        13-Apr-2024 02:05                3517
function.odbc-field-name.php                       13-Apr-2024 02:05                3150
function.odbc-field-num.php                        13-Apr-2024 02:05                3136
function.odbc-field-precision.php                  13-Apr-2024 02:05                2197
function.odbc-field-scale.php                      13-Apr-2024 02:05                3144
function.odbc-field-type.php                       13-Apr-2024 02:05                3170
function.odbc-foreignkeys.php                      13-Apr-2024 02:05                9516
function.odbc-free-result.php                      13-Apr-2024 02:05                3549
function.odbc-gettypeinfo.php                      13-Apr-2024 02:05                4684
function.odbc-longreadlen.php                      13-Apr-2024 02:05                4055
function.odbc-next-result.php                      13-Apr-2024 02:05                9293
function.odbc-num-fields.php                       13-Apr-2024 02:05                2629
function.odbc-num-rows.php                         13-Apr-2024 02:05                3338
function.odbc-pconnect.php                         13-Apr-2024 02:05                4970
function.odbc-prepare.php                          13-Apr-2024 02:05                6625
function.odbc-primarykeys.php                      13-Apr-2024 02:05                8093
function.odbc-procedurecolumns.php                 13-Apr-2024 02:05               12387
function.odbc-procedures.php                       13-Apr-2024 02:05               10139
function.odbc-result-all.php                       13-Apr-2024 02:05                4353
function.odbc-result.php                           13-Apr-2024 02:05                6111
function.odbc-rollback.php                         13-Apr-2024 02:05                2813
function.odbc-setoption.php                        13-Apr-2024 02:05                7641
function.odbc-specialcolumns.php                   13-Apr-2024 02:05                8249
function.odbc-statistics.php                       13-Apr-2024 02:05               10352
function.odbc-tableprivileges.php                  13-Apr-2024 02:05                8642
function.odbc-tables.php                           13-Apr-2024 02:05               13620
function.opcache-compile-file.php                  13-Apr-2024 02:05                4159
function.opcache-get-configuration.php             13-Apr-2024 02:05                3401
function.opcache-get-status.php                    13-Apr-2024 02:05                3976
function.opcache-invalidate.php                    13-Apr-2024 02:05                4716
function.opcache-is-script-cached.php              13-Apr-2024 02:05                3768
function.opcache-reset.php                         13-Apr-2024 02:05                3847
function.openal-buffer-create.php                  13-Apr-2024 02:05                2941
function.openal-buffer-data.php                    13-Apr-2024 02:05                5138
function.openal-buffer-destroy.php                 13-Apr-2024 02:05                3227
function.openal-buffer-get.php                     13-Apr-2024 02:05                4055
function.openal-buffer-loadwav.php                 13-Apr-2024 02:05                3831
function.openal-context-create.php                 13-Apr-2024 02:05                3458
function.openal-context-current.php                13-Apr-2024 02:05                3312
function.openal-context-destroy.php                13-Apr-2024 02:05                3278
function.openal-context-process.php                13-Apr-2024 02:05                3727
function.openal-context-suspend.php                13-Apr-2024 02:05                3721
function.openal-device-close.php                   13-Apr-2024 02:05                3244
function.openal-device-open.php                    13-Apr-2024 02:05                3470
function.openal-listener-get.php                   13-Apr-2024 02:05                3519
function.openal-listener-set.php                   13-Apr-2024 02:05                3911
function.openal-source-create.php                  13-Apr-2024 02:05                3143
function.openal-source-destroy.php                 13-Apr-2024 02:05                3232
function.openal-source-get.php                     13-Apr-2024 02:05                5742
function.openal-source-pause.php                   13-Apr-2024 02:05                3552
function.openal-source-play.php                    13-Apr-2024 02:05                3551
function.openal-source-rewind.php                  13-Apr-2024 02:05                3561
function.openal-source-set.php                     13-Apr-2024 02:05                6490
function.openal-source-stop.php                    13-Apr-2024 02:05                3533
function.openal-stream.php                         13-Apr-2024 02:05                4591
function.opendir.php                               13-Apr-2024 02:05                8317
function.openlog.php                               13-Apr-2024 02:05               10489
function.openssl-cipher-iv-length.php              13-Apr-2024 02:05                4603
function.openssl-cipher-key-length.php             13-Apr-2024 02:05                4513
function.openssl-cms-decrypt.php                   13-Apr-2024 02:05                5607
function.openssl-cms-encrypt.php                   13-Apr-2024 02:05                7025
function.openssl-cms-read.php                      13-Apr-2024 02:05                3346
function.openssl-cms-sign.php                      13-Apr-2024 02:05                8456
function.openssl-cms-verify.php                    13-Apr-2024 02:05                7674
function.openssl-csr-export-to-file.php            13-Apr-2024 02:05                8848
function.openssl-csr-export.php                    13-Apr-2024 02:05                8813
function.openssl-csr-get-public-key.php            13-Apr-2024 02:05                9101
function.openssl-csr-get-subject.php               13-Apr-2024 02:05                9909
function.openssl-csr-new.php                       13-Apr-2024 02:05               22825
function.openssl-csr-sign.php                      13-Apr-2024 02:05               14182
function.openssl-decrypt.php                       13-Apr-2024 02:05                8341
function.openssl-dh-compute-key.php                13-Apr-2024 02:05               16977
function.openssl-digest.php                        13-Apr-2024 02:05                4966
function.openssl-encrypt.php                       13-Apr-2024 02:05               18504
function.openssl-error-string.php                  13-Apr-2024 02:05                3988
function.openssl-free-key.php                      13-Apr-2024 02:05                3919
function.openssl-get-cert-locations.php            13-Apr-2024 02:05                4063
function.openssl-get-cipher-methods.php            13-Apr-2024 02:05               14318
function.openssl-get-curve-names.php               13-Apr-2024 02:05                7355
function.openssl-get-md-methods.php                13-Apr-2024 02:05                7238
function.openssl-get-privatekey.php                13-Apr-2024 02:05                1898
function.openssl-get-publickey.php                 13-Apr-2024 02:05                1869
function.openssl-open.php                          13-Apr-2024 02:05               10656
function.openssl-pbkdf2.php                        13-Apr-2024 02:05                7826
function.openssl-pkcs12-export-to-file.php         13-Apr-2024 02:05                7865
function.openssl-pkcs12-export.php                 13-Apr-2024 02:05                7903
function.openssl-pkcs12-read.php                   13-Apr-2024 02:05                5756
function.openssl-pkcs7-decrypt.php                 13-Apr-2024 02:05                7941
function.openssl-pkcs7-encrypt.php                 13-Apr-2024 02:05               11291
function.openssl-pkcs7-read.php                    13-Apr-2024 02:05                7088
function.openssl-pkcs7-sign.php                    13-Apr-2024 02:05               12579
function.openssl-pkcs7-verify.php                  13-Apr-2024 02:05                8797
function.openssl-pkey-derive.php                   13-Apr-2024 02:05                8379
function.openssl-pkey-export-to-file.php           13-Apr-2024 02:05                6949
function.openssl-pkey-export.php                   13-Apr-2024 02:05                6823
function.openssl-pkey-free.php                     13-Apr-2024 02:05                4243
function.openssl-pkey-get-details.php              13-Apr-2024 02:05                9908
function.openssl-pkey-get-private.php              13-Apr-2024 02:05                6526
function.openssl-pkey-get-public.php               13-Apr-2024 02:05                5859
function.openssl-pkey-new.php                      13-Apr-2024 02:05                7325
function.openssl-private-decrypt.php               13-Apr-2024 02:05                7075
function.openssl-private-encrypt.php               13-Apr-2024 02:05                6843
function.openssl-public-decrypt.php                13-Apr-2024 02:05                6838
function.openssl-public-encrypt.php                13-Apr-2024 02:05                7235
function.openssl-random-pseudo-bytes.php           13-Apr-2024 02:05                9775
function.openssl-seal.php                          13-Apr-2024 02:05               11837
function.openssl-sign.php                          13-Apr-2024 02:05               12957
function.openssl-spki-export-challenge.php         13-Apr-2024 02:05                7941
function.openssl-spki-export.php                   13-Apr-2024 02:05                8740
function.openssl-spki-new.php                      13-Apr-2024 02:05                9727
function.openssl-spki-verify.php                   13-Apr-2024 02:05                7993
function.openssl-verify.php                        13-Apr-2024 02:05               13750
function.openssl-x509-check-private-key.php        13-Apr-2024 02:05                6109
function.openssl-x509-checkpurpose.php             13-Apr-2024 02:05                7992
function.openssl-x509-export-to-file.php           13-Apr-2024 02:05                5387
function.openssl-x509-export.php                   13-Apr-2024 02:05                5360
function.openssl-x509-fingerprint.php              13-Apr-2024 02:05                5943
function.openssl-x509-free.php                     13-Apr-2024 02:05                4252
function.openssl-x509-parse.php                    13-Apr-2024 02:05                5046
function.openssl-x509-read.php                     13-Apr-2024 02:05                4783
function.openssl-x509-verify.php                   13-Apr-2024 02:05               12751
function.ord.php                                   13-Apr-2024 02:05                7322
function.output-add-rewrite-var.php                13-Apr-2024 02:05               10061
function.output-reset-rewrite-vars.php             13-Apr-2024 02:05                6969
function.pack.php                                  13-Apr-2024 02:05               14085
function.parse-ini-file.php                        13-Apr-2024 02:05               22388
function.parse-ini-string.php                      13-Apr-2024 02:05                7745
function.parse-str.php                             13-Apr-2024 02:05               10580
function.parse-url.php                             13-Apr-2024 02:05               17416
function.passthru.php                              13-Apr-2024 02:05                8150
function.password-algos.php                        13-Apr-2024 02:05                3325
function.password-get-info.php                     13-Apr-2024 02:05                3622
function.password-hash.php                         13-Apr-2024 02:05               25480
function.password-needs-rehash.php                 13-Apr-2024 02:05                8551
function.password-verify.php                       13-Apr-2024 02:05                7218
function.pathinfo.php                              13-Apr-2024 02:05               14815
function.pclose.php                                13-Apr-2024 02:05                5091
function.pcntl-alarm.php                           13-Apr-2024 02:05                3038
function.pcntl-async-signals.php                   13-Apr-2024 02:05                4400
function.pcntl-errno.php                           13-Apr-2024 02:05                1761
function.pcntl-exec.php                            13-Apr-2024 02:05                3875
function.pcntl-fork.php                            13-Apr-2024 02:05                5198
function.pcntl-get-last-error.php                  13-Apr-2024 02:05                2842
function.pcntl-getpriority.php                     13-Apr-2024 02:05                6051
function.pcntl-rfork.php                           13-Apr-2024 02:05                8329
function.pcntl-setpriority.php                     13-Apr-2024 02:05                5877
function.pcntl-signal-dispatch.php                 13-Apr-2024 02:05                5827
function.pcntl-signal-get-handler.php              13-Apr-2024 02:05                6874
function.pcntl-signal.php                          13-Apr-2024 02:05               11954
function.pcntl-sigprocmask.php                     13-Apr-2024 02:05                6324
function.pcntl-sigtimedwait.php                    13-Apr-2024 02:05                5321
function.pcntl-sigwaitinfo.php                     13-Apr-2024 02:05                7869
function.pcntl-strerror.php                        13-Apr-2024 02:05                3021
function.pcntl-unshare.php                         13-Apr-2024 02:05                4821
function.pcntl-wait.php                            13-Apr-2024 02:05                8695
function.pcntl-waitpid.php                         13-Apr-2024 02:05                9974
function.pcntl-wexitstatus.php                     13-Apr-2024 02:05                3886
function.pcntl-wifexited.php                       13-Apr-2024 02:05                3616
function.pcntl-wifsignaled.php                     13-Apr-2024 02:05                3682
function.pcntl-wifstopped.php                      13-Apr-2024 02:05                3659
function.pcntl-wstopsig.php                        13-Apr-2024 02:05                3833
function.pcntl-wtermsig.php                        13-Apr-2024 02:05                4017
function.pfsockopen.php                            13-Apr-2024 02:05                5919
function.pg-affected-rows.php                      13-Apr-2024 02:05                7075
function.pg-cancel-query.php                       13-Apr-2024 02:05                7747
function.pg-client-encoding.php                    13-Apr-2024 02:05                7590
function.pg-close.php                              13-Apr-2024 02:05                7364
function.pg-connect-poll.php                       13-Apr-2024 02:05                4311
function.pg-connect.php                            13-Apr-2024 02:05               11874
function.pg-connection-busy.php                    13-Apr-2024 02:05                5985
function.pg-connection-reset.php                   13-Apr-2024 02:05                5937
function.pg-connection-status.php                  13-Apr-2024 02:05                5715
function.pg-consume-input.php                      13-Apr-2024 02:05                3906
function.pg-convert.php                            13-Apr-2024 02:05               10629
function.pg-copy-from.php                          13-Apr-2024 02:05                8364
function.pg-copy-to.php                            13-Apr-2024 02:05                7685
function.pg-dbname.php                             13-Apr-2024 02:05                5558
function.pg-delete.php                             13-Apr-2024 02:05               10422
function.pg-end-copy.php                           13-Apr-2024 02:05                7708
function.pg-escape-bytea.php                       13-Apr-2024 02:05                8382
function.pg-escape-identifier.php                  13-Apr-2024 02:05                8305
function.pg-escape-literal.php                     13-Apr-2024 02:05                8790
function.pg-escape-string.php                      13-Apr-2024 02:05                8163
function.pg-execute.php                            13-Apr-2024 02:05               11292
function.pg-fetch-all-columns.php                  13-Apr-2024 02:05                7284
function.pg-fetch-all.php                          13-Apr-2024 02:05                9539
function.pg-fetch-array.php                        13-Apr-2024 02:05               13154
function.pg-fetch-assoc.php                        13-Apr-2024 02:05                9682
function.pg-fetch-object.php                       13-Apr-2024 02:05               12425
function.pg-fetch-result.php                       13-Apr-2024 02:05                9698
function.pg-fetch-row.php                          13-Apr-2024 02:05               10201
function.pg-field-is-null.php                      13-Apr-2024 02:05                8810
function.pg-field-name.php                         13-Apr-2024 02:05                9248
function.pg-field-num.php                          13-Apr-2024 02:05                6941
function.pg-field-prtlen.php                       13-Apr-2024 02:05               11328
function.pg-field-size.php                         13-Apr-2024 02:05                9469
function.pg-field-table.php                        13-Apr-2024 02:05                9155
function.pg-field-type-oid.php                     13-Apr-2024 02:05                7750
function.pg-field-type.php                         13-Apr-2024 02:05                7440
function.pg-flush.php                              13-Apr-2024 02:05                3920
function.pg-free-result.php                        13-Apr-2024 02:05                7726
function.pg-get-notify.php                         13-Apr-2024 02:05                7900
function.pg-get-pid.php                            13-Apr-2024 02:05                5307
function.pg-get-result.php                         13-Apr-2024 02:05                9061
function.pg-host.php                               13-Apr-2024 02:05                6573
function.pg-insert.php                             13-Apr-2024 02:05               12686
function.pg-last-error.php                         13-Apr-2024 02:05                7881
function.pg-last-notice.php                        13-Apr-2024 02:05                8972
function.pg-last-oid.php                           13-Apr-2024 02:05                7949
function.pg-lo-close.php                           13-Apr-2024 02:05                7487
function.pg-lo-create.php                          13-Apr-2024 02:05                9280
function.pg-lo-export.php                          13-Apr-2024 02:05                8695
function.pg-lo-import.php                          13-Apr-2024 02:05                8084
function.pg-lo-open.php                            13-Apr-2024 02:05                9668
function.pg-lo-read-all.php                        13-Apr-2024 02:05                6722
function.pg-lo-read.php                            13-Apr-2024 02:05                7297
function.pg-lo-seek.php                            13-Apr-2024 02:05                8323
function.pg-lo-tell.php                            13-Apr-2024 02:05                7227
function.pg-lo-truncate.php                        13-Apr-2024 02:05                6883
function.pg-lo-unlink.php                          13-Apr-2024 02:05                7669
function.pg-lo-write.php                           13-Apr-2024 02:05                8614
function.pg-meta-data.php                          13-Apr-2024 02:05                7710
function.pg-num-fields.php                         13-Apr-2024 02:05                6190
function.pg-num-rows.php                           13-Apr-2024 02:05                6135
function.pg-options.php                            13-Apr-2024 02:05                5864
function.pg-parameter-status.php                   13-Apr-2024 02:05                9159
function.pg-pconnect.php                           13-Apr-2024 02:05               10695
function.pg-ping.php                               13-Apr-2024 02:05                6448
function.pg-port.php                               13-Apr-2024 02:05                6052
function.pg-prepare.php                            13-Apr-2024 02:05               11401
function.pg-put-line.php                           13-Apr-2024 02:05                9399
function.pg-query-params.php                       13-Apr-2024 02:05               11774
function.pg-query.php                              13-Apr-2024 02:05               13057
function.pg-result-error-field.php                 13-Apr-2024 02:05               10051
function.pg-result-error.php                       13-Apr-2024 02:05                8508
function.pg-result-seek.php                        13-Apr-2024 02:05                7626
function.pg-result-status.php                      13-Apr-2024 02:05                8960
function.pg-select.php                             13-Apr-2024 02:05               12757
function.pg-send-execute.php                       13-Apr-2024 02:05               10922
function.pg-send-prepare.php                       13-Apr-2024 02:05               11415
function.pg-send-query-params.php                  13-Apr-2024 02:05                8410
function.pg-send-query.php                         13-Apr-2024 02:05               10279
function.pg-set-client-encoding.php                13-Apr-2024 02:05                9502
function.pg-set-error-context-visibility.php       13-Apr-2024 02:05                6998
function.pg-set-error-verbosity.php                13-Apr-2024 02:05                9516
function.pg-socket.php                             13-Apr-2024 02:05                4078
function.pg-trace.php                              13-Apr-2024 02:05                9791
function.pg-transaction-status.php                 13-Apr-2024 02:05                6986
function.pg-tty.php                                13-Apr-2024 02:05                6402
function.pg-unescape-bytea.php                     13-Apr-2024 02:05                6634
function.pg-untrace.php                            13-Apr-2024 02:05                7120
function.pg-update.php                             13-Apr-2024 02:05               11433
function.pg-version.php                            13-Apr-2024 02:05                6966
function.php-ini-loaded-file.php                   13-Apr-2024 02:05                4765
function.php-ini-scanned-files.php                 13-Apr-2024 02:05                6487
function.php-sapi-name.php                         13-Apr-2024 02:05                6317
function.php-strip-whitespace.php                  13-Apr-2024 02:05                4901
function.php-uname.php                             13-Apr-2024 02:05                9334
function.phpcredits.php                            13-Apr-2024 02:05                8492
function.phpdbg-break-file.php                     13-Apr-2024 02:05                3846
function.phpdbg-break-function.php                 13-Apr-2024 02:05                3583
function.phpdbg-break-method.php                   13-Apr-2024 02:05                3913
function.phpdbg-break-next.php                     13-Apr-2024 02:05                3249
function.phpdbg-clear.php                          13-Apr-2024 02:05                3617
function.phpdbg-color.php                          13-Apr-2024 02:05                3840
function.phpdbg-end-oplog.php                      13-Apr-2024 02:05                2634
function.phpdbg-exec.php                           13-Apr-2024 02:05                3216
function.phpdbg-get-executable.php                 13-Apr-2024 02:05                2577
function.phpdbg-prompt.php                         13-Apr-2024 02:05                2861
function.phpdbg-start-oplog.php                    13-Apr-2024 02:05                2300
function.phpinfo.php                               13-Apr-2024 02:05                9875
function.phpversion.php                            13-Apr-2024 02:05               11309
function.pi.php                                    13-Apr-2024 02:05                3094
function.png2wbmp.php                              13-Apr-2024 02:05                6716
function.popen.php                                 13-Apr-2024 02:05                9387
function.pos.php                                   13-Apr-2024 02:05                1606
function.posix-access.php                          13-Apr-2024 02:05                6974
function.posix-ctermid.php                         13-Apr-2024 02:05                4419
function.posix-eaccess.php                         13-Apr-2024 02:05                7886
function.posix-errno.php                           13-Apr-2024 02:05                1767
function.posix-fpathconf.php                       13-Apr-2024 02:05                7164
function.posix-get-last-error.php                  13-Apr-2024 02:05                4343
function.posix-getcwd.php                          13-Apr-2024 02:05                4388
function.posix-getegid.php                         13-Apr-2024 02:05                5260
function.posix-geteuid.php                         13-Apr-2024 02:05                5284
function.posix-getgid.php                          13-Apr-2024 02:05                4751
function.posix-getgrgid.php                        13-Apr-2024 02:05                6465
function.posix-getgrnam.php                        13-Apr-2024 02:05                6450
function.posix-getgroups.php                       13-Apr-2024 02:05                4280
function.posix-getlogin.php                        13-Apr-2024 02:05                3599
function.posix-getpgid.php                         13-Apr-2024 02:05                4725
function.posix-getpgrp.php                         13-Apr-2024 02:05                2561
function.posix-getpid.php                          13-Apr-2024 02:05                3250
function.posix-getppid.php                         13-Apr-2024 02:05                2868
function.posix-getpwnam.php                        13-Apr-2024 02:05                7194
function.posix-getpwuid.php                        13-Apr-2024 02:05                7143
function.posix-getrlimit.php                       13-Apr-2024 02:05                8887
function.posix-getsid.php                          13-Apr-2024 02:05                4801
function.posix-getuid.php                          13-Apr-2024 02:05                3312
function.posix-initgroups.php                      13-Apr-2024 02:05                3362
function.posix-isatty.php                          13-Apr-2024 02:05                4631
function.posix-kill.php                            13-Apr-2024 02:05                3554
function.posix-mkfifo.php                          13-Apr-2024 02:05                3726
function.posix-mknod.php                           13-Apr-2024 02:05                7688
function.posix-pathconf.php                        13-Apr-2024 02:05                6595
function.posix-setegid.php                         13-Apr-2024 02:05                5233
function.posix-seteuid.php                         13-Apr-2024 02:05                3584
function.posix-setgid.php                          13-Apr-2024 02:05                5494
function.posix-setpgid.php                         13-Apr-2024 02:05                3505
function.posix-setrlimit.php                       13-Apr-2024 02:05                4987
function.posix-setsid.php                          13-Apr-2024 02:05                2621
function.posix-setuid.php                          13-Apr-2024 02:05                5562
function.posix-strerror.php                        13-Apr-2024 02:05                4990
function.posix-sysconf.php                         13-Apr-2024 02:05                4044
function.posix-times.php                           13-Apr-2024 02:05                4954
function.posix-ttyname.php                         13-Apr-2024 02:05                5304
function.posix-uname.php                           13-Apr-2024 02:05                5191
function.pow.php                                   13-Apr-2024 02:05                6815
function.preg-filter.php                           13-Apr-2024 02:05               10001
function.preg-grep.php                             13-Apr-2024 02:05                6009
function.preg-last-error-msg.php                   13-Apr-2024 02:05                4159
function.preg-last-error.php                       13-Apr-2024 02:05                5194
function.preg-match-all.php                        13-Apr-2024 02:05               26485
function.preg-match.php                            13-Apr-2024 02:05               24486
function.preg-quote.php                            13-Apr-2024 02:05                8923
function.preg-replace-callback-array.php           13-Apr-2024 02:05               10824
function.preg-replace-callback.php                 13-Apr-2024 02:05               18240
function.preg-replace.php                          13-Apr-2024 02:05               25568
function.preg-split.php                            13-Apr-2024 02:05               13201
function.prev.php                                  13-Apr-2024 02:05                9530
function.print-r.php                               13-Apr-2024 02:05                9537
function.print.php                                 13-Apr-2024 02:05               13168
function.printf.php                                13-Apr-2024 02:05               29989
function.proc-close.php                            13-Apr-2024 02:05                3844
function.proc-get-status.php                       13-Apr-2024 02:05                6955
function.proc-nice.php                             13-Apr-2024 02:05                8159
function.proc-open.php                             13-Apr-2024 02:05               24283
function.proc-terminate.php                        13-Apr-2024 02:05                4937
function.property-exists.php                       13-Apr-2024 02:05                8813
function.ps-add-bookmark.php                       13-Apr-2024 02:05                5512
function.ps-add-launchlink.php                     13-Apr-2024 02:05                5966
function.ps-add-locallink.php                      13-Apr-2024 02:05                6895
function.ps-add-note.php                           13-Apr-2024 02:05                7622
function.ps-add-pdflink.php                        13-Apr-2024 02:05                7291
function.ps-add-weblink.php                        13-Apr-2024 02:05                6077
function.ps-arc.php                                13-Apr-2024 02:05                5423
function.ps-arcn.php                               13-Apr-2024 02:05                5430
function.ps-begin-page.php                         13-Apr-2024 02:05                7895
function.ps-begin-pattern.php                      13-Apr-2024 02:05               13604
function.ps-begin-template.php                     13-Apr-2024 02:05               11655
function.ps-circle.php                             13-Apr-2024 02:05                4859
function.ps-clip.php                               13-Apr-2024 02:05                3145
function.ps-close-image.php                        13-Apr-2024 02:05                4095
function.ps-close.php                              13-Apr-2024 02:05                3922
function.ps-closepath-stroke.php                   13-Apr-2024 02:05                3190
function.ps-closepath.php                          13-Apr-2024 02:05                3401
function.ps-continue-text.php                      13-Apr-2024 02:05                4346
function.ps-curveto.php                            13-Apr-2024 02:05                5173
function.ps-delete.php                             13-Apr-2024 02:05                3830
function.ps-end-page.php                           13-Apr-2024 02:05                3554
function.ps-end-pattern.php                        13-Apr-2024 02:05                3364
function.ps-end-template.php                       13-Apr-2024 02:05                3395
function.ps-fill-stroke.php                        13-Apr-2024 02:05                3441
function.ps-fill.php                               13-Apr-2024 02:05                3372
function.ps-findfont.php                           13-Apr-2024 02:05                8180
function.ps-get-buffer.php                         13-Apr-2024 02:05                3373
function.ps-get-parameter.php                      13-Apr-2024 02:05                7677
function.ps-get-value.php                          13-Apr-2024 02:05               10051
function.ps-hyphenate.php                          13-Apr-2024 02:05                7640
function.ps-include-file.php                       13-Apr-2024 02:05                3257
function.ps-lineto.php                             13-Apr-2024 02:05                8347
function.ps-makespotcolor.php                      13-Apr-2024 02:05               10457
function.ps-moveto.php                             13-Apr-2024 02:05                3984
function.ps-new.php                                13-Apr-2024 02:05                3348
function.ps-open-file.php                          13-Apr-2024 02:05                3888
function.ps-open-image-file.php                    13-Apr-2024 02:05                5073
function.ps-open-image.php                         13-Apr-2024 02:05                7233
function.ps-open-memory-image.php                  13-Apr-2024 02:05                2906
function.ps-place-image.php                        13-Apr-2024 02:05                5380
function.ps-rect.php                               13-Apr-2024 02:05                5101
function.ps-restore.php                            13-Apr-2024 02:05                3558
function.ps-rotate.php                             13-Apr-2024 02:05               12296
function.ps-save.php                               13-Apr-2024 02:05                3312
function.ps-scale.php                              13-Apr-2024 02:05                3843
function.ps-set-border-color.php                   13-Apr-2024 02:05                4922
function.ps-set-border-dash.php                    13-Apr-2024 02:05                4538
function.ps-set-border-style.php                   13-Apr-2024 02:05                4660
function.ps-set-info.php                           13-Apr-2024 02:05                6420
function.ps-set-parameter.php                      13-Apr-2024 02:05                4167
function.ps-set-text-pos.php                       13-Apr-2024 02:05                9552
function.ps-set-value.php                          13-Apr-2024 02:05                4884
function.ps-setcolor.php                           13-Apr-2024 02:05                6335
function.ps-setdash.php                            13-Apr-2024 02:05                3718
function.ps-setflat.php                            13-Apr-2024 02:05                3267
function.ps-setfont.php                            13-Apr-2024 02:05                4274
function.ps-setgray.php                            13-Apr-2024 02:05                3440
function.ps-setlinecap.php                         13-Apr-2024 02:05                3959
function.ps-setlinejoin.php                        13-Apr-2024 02:05                3979
function.ps-setlinewidth.php                       13-Apr-2024 02:05                3802
function.ps-setmiterlimit.php                      13-Apr-2024 02:05                4352
function.ps-setoverprintmode.php                   13-Apr-2024 02:05                3274
function.ps-setpolydash.php                        13-Apr-2024 02:05                7945
function.ps-shading-pattern.php                    13-Apr-2024 02:05                4523
function.ps-shading.php                            13-Apr-2024 02:05                7635
function.ps-shfill.php                             13-Apr-2024 02:05                4233
function.ps-show-boxed.php                         13-Apr-2024 02:05               13989
function.ps-show-xy.php                            13-Apr-2024 02:05                4362
function.ps-show-xy2.php                           13-Apr-2024 02:05                3255
function.ps-show.php                               13-Apr-2024 02:05                6327
function.ps-show2.php                              13-Apr-2024 02:05                3414
function.ps-string-geometry.php                    13-Apr-2024 02:05                5069
function.ps-stringwidth.php                        13-Apr-2024 02:05                4583
function.ps-stroke.php                             13-Apr-2024 02:05                3556
function.ps-symbol-name.php                        13-Apr-2024 02:05                4058
function.ps-symbol-width.php                       13-Apr-2024 02:05                4715
function.ps-symbol.php                             13-Apr-2024 02:05                3936
function.ps-translate.php                          13-Apr-2024 02:05               14265
function.pspell-add-to-personal.php                13-Apr-2024 02:05                6703
function.pspell-add-to-session.php                 13-Apr-2024 02:05                4281
function.pspell-check.php                          13-Apr-2024 02:05                5176
function.pspell-clear-session.php                  13-Apr-2024 02:05                6041
function.pspell-config-create.php                  13-Apr-2024 02:05                8491
function.pspell-config-data-dir.php                13-Apr-2024 02:05                3550
function.pspell-config-dict-dir.php                13-Apr-2024 02:05                3544
function.pspell-config-ignore.php                  13-Apr-2024 02:05                5927
function.pspell-config-mode.php                    13-Apr-2024 02:05                6762
function.pspell-config-personal.php                13-Apr-2024 02:05                6901
function.pspell-config-repl.php                    13-Apr-2024 02:05                7213
function.pspell-config-runtogether.php             13-Apr-2024 02:05                6665
function.pspell-config-save-repl.php               13-Apr-2024 02:05                5631
function.pspell-new-config.php                     13-Apr-2024 02:05                6642
function.pspell-new-personal.php                   13-Apr-2024 02:05               11831
function.pspell-new.php                            13-Apr-2024 02:05               10151
function.pspell-save-wordlist.php                  13-Apr-2024 02:05                6287
function.pspell-store-replacement.php              13-Apr-2024 02:05                8052
function.pspell-suggest.php                        13-Apr-2024 02:05                5697
function.putenv.php                                13-Apr-2024 02:05                4112
function.quoted-printable-decode.php               13-Apr-2024 02:05                5203
function.quoted-printable-encode.php               13-Apr-2024 02:05                4961
function.quotemeta.php                             13-Apr-2024 02:05                5917
function.rad2deg.php                               13-Apr-2024 02:05                3574
function.radius-acct-open.php                      13-Apr-2024 02:05                3307
function.radius-add-server.php                     13-Apr-2024 02:05                8125
function.radius-auth-open.php                      13-Apr-2024 02:05                3316
function.radius-close.php                          13-Apr-2024 02:05                2733
function.radius-config.php                         13-Apr-2024 02:05                4226
function.radius-create-request.php                 13-Apr-2024 02:05                5428
function.radius-cvt-addr.php                       13-Apr-2024 02:05                6226
function.radius-cvt-int.php                        13-Apr-2024 02:05                5617
function.radius-cvt-string.php                     13-Apr-2024 02:05                5685
function.radius-demangle-mppe-key.php              13-Apr-2024 02:05                3355
function.radius-demangle.php                       13-Apr-2024 02:05                3069
function.radius-get-attr.php                       13-Apr-2024 02:05                6505
function.radius-get-tagged-attr-data.php           13-Apr-2024 02:05                6520
function.radius-get-tagged-attr-tag.php            13-Apr-2024 02:05                6573
function.radius-get-vendor-attr.php                13-Apr-2024 02:05                8224
function.radius-put-addr.php                       13-Apr-2024 02:05                5662
function.radius-put-attr.php                       13-Apr-2024 02:05                8882
function.radius-put-int.php                        13-Apr-2024 02:05                7607
function.radius-put-string.php                     13-Apr-2024 02:05                8113
function.radius-put-vendor-addr.php                13-Apr-2024 02:05                5622
function.radius-put-vendor-attr.php                13-Apr-2024 02:05                7865
function.radius-put-vendor-int.php                 13-Apr-2024 02:05                6378
function.radius-put-vendor-string.php              13-Apr-2024 02:05                6896
function.radius-request-authenticator.php          13-Apr-2024 02:05                3218
function.radius-salt-encrypt-attr.php              13-Apr-2024 02:05                4249
function.radius-send-request.php                   13-Apr-2024 02:05                4114
function.radius-server-secret.php                  13-Apr-2024 02:05                2749
function.radius-strerror.php                       13-Apr-2024 02:05                2659
function.rand.php                                  13-Apr-2024 02:05               11052
function.random-bytes.php                          13-Apr-2024 02:05               10139
function.random-int.php                            13-Apr-2024 02:05               10028
function.range.php                                 13-Apr-2024 02:05               17018
function.rar-wrapper-cache-stats.php               13-Apr-2024 02:05                2379
function.rawurldecode.php                          13-Apr-2024 02:05                4717
function.rawurlencode.php                          13-Apr-2024 02:05                6479
function.read-exif-data.php                        13-Apr-2024 02:05                2505
function.readdir.php                               13-Apr-2024 02:05               10804
function.readfile.php                              13-Apr-2024 02:05               10240
function.readgzfile.php                            13-Apr-2024 02:05                4775
function.readline-add-history.php                  13-Apr-2024 02:05                2803
function.readline-callback-handler-install.php     13-Apr-2024 02:05                9941
function.readline-callback-handler-remove.php      13-Apr-2024 02:05                4064
function.readline-callback-read-char.php           13-Apr-2024 02:05                3976
function.readline-clear-history.php                13-Apr-2024 02:05                2558
function.readline-completion-function.php          13-Apr-2024 02:05                3124
function.readline-info.php                         13-Apr-2024 02:05                5047
function.readline-list-history.php                 13-Apr-2024 02:05                2399
function.readline-on-new-line.php                  13-Apr-2024 02:05                2779
function.readline-read-history.php                 13-Apr-2024 02:05                3555
function.readline-redisplay.php                    13-Apr-2024 02:05                2246
function.readline-write-history.php                13-Apr-2024 02:05                3511
function.readline.php                              13-Apr-2024 02:05                5246
function.readlink.php                              13-Apr-2024 02:05                4639
function.realpath-cache-get.php                    13-Apr-2024 02:05                4332
function.realpath-cache-size.php                   13-Apr-2024 02:05                3755
function.realpath.php                              13-Apr-2024 02:05                9166
function.recode-file.php                           13-Apr-2024 02:05                5871
function.recode-string.php                         13-Apr-2024 02:05                5246
function.recode.php                                13-Apr-2024 02:05                1706
function.register-shutdown-function.php            13-Apr-2024 02:05                8068
function.register-tick-function.php                13-Apr-2024 02:05                5489
function.rename.php                                13-Apr-2024 02:05                6219
function.require-once.php                          13-Apr-2024 02:05                1932
function.require.php                               13-Apr-2024 02:05                2124
function.reset.php                                 13-Apr-2024 02:05               10148
function.restore-error-handler.php                 13-Apr-2024 02:05                5839
function.restore-exception-handler.php             13-Apr-2024 02:05                6576
function.restore-include-path.php                  13-Apr-2024 02:05                5229
function.return.php                                13-Apr-2024 02:05                4819
function.rewind.php                                13-Apr-2024 02:05                6606
function.rewinddir.php                             13-Apr-2024 02:05                3623
function.rmdir.php                                 13-Apr-2024 02:05                5301
function.rnp-backend-string.php                    13-Apr-2024 02:05                2221
function.rnp-backend-version.php                   13-Apr-2024 02:05                2157
function.rnp-decrypt.php                           13-Apr-2024 02:05                3198
function.rnp-dump-packets-to-json.php              13-Apr-2024 02:05                3112
function.rnp-dump-packets.php                      13-Apr-2024 02:05                3066
function.rnp-ffi-create.php                        13-Apr-2024 02:05                3161
function.rnp-ffi-destroy.php                       13-Apr-2024 02:05                2385
function.rnp-ffi-set-pass-provider.php             13-Apr-2024 02:05                6696
function.rnp-import-keys.php                       13-Apr-2024 02:05                3450
function.rnp-import-signatures.php                 13-Apr-2024 02:05                3440
function.rnp-key-export-autocrypt.php              13-Apr-2024 02:05                4501
function.rnp-key-export-revocation.php             13-Apr-2024 02:05                5146
function.rnp-key-export.php                        13-Apr-2024 02:05                3420
function.rnp-key-get-info.php                      13-Apr-2024 02:05                7933
function.rnp-key-remove.php                        13-Apr-2024 02:05                3560
function.rnp-key-revoke.php                        13-Apr-2024 02:05                4792
function.rnp-list-keys.php                         13-Apr-2024 02:05                3103
function.rnp-load-keys-from-path.php               13-Apr-2024 02:05                3799
function.rnp-load-keys.php                         13-Apr-2024 02:05                3755
function.rnp-locate-key.php                        13-Apr-2024 02:05                3523
function.rnp-op-encrypt.php                        13-Apr-2024 02:05                7885
function.rnp-op-generate-key.php                   13-Apr-2024 02:05                7504
function.rnp-op-sign-cleartext.php                 13-Apr-2024 02:05                5154
function.rnp-op-sign-detached.php                  13-Apr-2024 02:05                5033
function.rnp-op-sign.php                           13-Apr-2024 02:05                6114
function.rnp-op-verify-detached.php                13-Apr-2024 02:05                7038
function.rnp-op-verify.php                         13-Apr-2024 02:05                6777
function.rnp-save-keys-to-path.php                 13-Apr-2024 02:05                3813
function.rnp-save-keys.php                         13-Apr-2024 02:05                3786
function.rnp-supported-features.php                13-Apr-2024 02:05                2880
function.rnp-version-string-full.php               13-Apr-2024 02:05                2242
function.rnp-version-string.php                    13-Apr-2024 02:05                2139
function.round.php                                 13-Apr-2024 02:05               24414
function.rpmaddtag.php                             13-Apr-2024 02:05                3289
function.rpmdbinfo.php                             13-Apr-2024 02:05                5162
function.rpmdbsearch.php                           13-Apr-2024 02:05                6062
function.rpmgetsymlink.php                         13-Apr-2024 02:05                2912
function.rpminfo.php                               13-Apr-2024 02:05                5344
function.rpmvercmp.php                             13-Apr-2024 02:05                4843
function.rrd-create.php                            13-Apr-2024 02:05                2916
function.rrd-error.php                             13-Apr-2024 02:05                2069
function.rrd-fetch.php                             13-Apr-2024 02:05                2890
function.rrd-first.php                             13-Apr-2024 02:05                2884
function.rrd-graph.php                             13-Apr-2024 02:05                3136
function.rrd-info.php                              13-Apr-2024 02:05                2469
function.rrd-last.php                              13-Apr-2024 02:05                2403
function.rrd-lastupdate.php                        13-Apr-2024 02:05                2599
function.rrd-restore.php                           13-Apr-2024 02:05                3305
function.rrd-tune.php                              13-Apr-2024 02:05                2987
function.rrd-update.php                            13-Apr-2024 02:05                3060
function.rrd-version.php                           13-Apr-2024 02:05                2163
function.rrd-xport.php                             13-Apr-2024 02:05                2643
function.rrdc-disconnect.php                       13-Apr-2024 02:05                2516
function.rsort.php                                 13-Apr-2024 02:05                9593
function.rtrim.php                                 13-Apr-2024 02:05                9697
function.runkit7-constant-add.php                  13-Apr-2024 02:05                4404
function.runkit7-constant-redefine.php             13-Apr-2024 02:05                4280
function.runkit7-constant-remove.php               13-Apr-2024 02:05                3614
function.runkit7-function-add.php                  13-Apr-2024 02:05                9702
function.runkit7-function-copy.php                 13-Apr-2024 02:05                5463
function.runkit7-function-redefine.php             13-Apr-2024 02:05               10162
function.runkit7-function-remove.php               13-Apr-2024 02:05                4111
function.runkit7-function-rename.php               13-Apr-2024 02:05                4388
function.runkit7-import.php                        13-Apr-2024 02:05                3797
function.runkit7-method-add.php                    13-Apr-2024 02:05               11722
function.runkit7-method-copy.php                   13-Apr-2024 02:05                7001
function.runkit7-method-redefine.php               13-Apr-2024 02:05               12158
function.runkit7-method-remove.php                 13-Apr-2024 02:05                6430
function.runkit7-method-rename.php                 13-Apr-2024 02:05                6592
function.runkit7-object-id.php                     13-Apr-2024 02:05                3720
function.runkit7-superglobals.php                  13-Apr-2024 02:05                2592
function.runkit7-zval-inspect.php                  13-Apr-2024 02:05                5048
function.sapi-windows-cp-conv.php                  13-Apr-2024 02:05                5000
function.sapi-windows-cp-get.php                   13-Apr-2024 02:05                3685
function.sapi-windows-cp-is-utf8.php               13-Apr-2024 02:05                2775
function.sapi-windows-cp-set.php                   13-Apr-2024 02:05                3131
function.sapi-windows-generate-ctrl-event.php      13-Apr-2024 02:05                8000
function.sapi-windows-set-ctrl-handler.php         13-Apr-2024 02:05                7984
function.sapi-windows-vt100-support.php            13-Apr-2024 02:05               11643
function.scandir.php                               13-Apr-2024 02:05                9155
function.scoutapm-get-calls.php                    13-Apr-2024 02:05                4581
function.scoutapm-list-instrumented-functions.php  13-Apr-2024 02:05                3824
function.seaslog-get-author.php                    13-Apr-2024 02:05                3084
function.seaslog-get-version.php                   13-Apr-2024 02:05                3085
function.sem-acquire.php                           13-Apr-2024 02:05                5461
function.sem-get.php                               13-Apr-2024 02:05                7447
function.sem-release.php                           13-Apr-2024 02:05                4393
function.sem-remove.php                            13-Apr-2024 02:05                4340
function.serialize.php                             13-Apr-2024 02:05               11307
function.session-abort.php                         13-Apr-2024 02:05                4337
function.session-cache-expire.php                  13-Apr-2024 02:05                7739
function.session-cache-limiter.php                 13-Apr-2024 02:05                9663
function.session-commit.php                        13-Apr-2024 02:05                1819
function.session-create-id.php                     13-Apr-2024 02:05               10928
function.session-decode.php                        13-Apr-2024 02:05                3935
function.session-destroy.php                       13-Apr-2024 02:05                9974
function.session-encode.php                        13-Apr-2024 02:05                4193
function.session-gc.php                            13-Apr-2024 02:05                8406
function.session-get-cookie-params.php             13-Apr-2024 02:05                5645
function.session-id.php                            13-Apr-2024 02:05                6657
function.session-module-name.php                   13-Apr-2024 02:05                4796
function.session-name.php                          13-Apr-2024 02:05                8619
function.session-regenerate-id.php                 13-Apr-2024 02:05               17353
function.session-register-shutdown.php             13-Apr-2024 02:05                2793
function.session-reset.php                         13-Apr-2024 02:05                4242
function.session-save-path.php                     13-Apr-2024 02:05                4978
function.session-set-cookie-params.php             13-Apr-2024 02:05               11267
function.session-set-save-handler.php              13-Apr-2024 02:05               25944
function.session-start.php                         13-Apr-2024 02:05               15455
function.session-status.php                        13-Apr-2024 02:05                3412
function.session-unset.php                         13-Apr-2024 02:05                5299
function.session-write-close.php                   13-Apr-2024 02:05                4451
function.set-error-handler.php                     13-Apr-2024 02:05               27527
function.set-exception-handler.php                 13-Apr-2024 02:05                7183
function.set-file-buffer.php                       13-Apr-2024 02:05                1791
function.set-include-path.php                      13-Apr-2024 02:05                6329
function.set-time-limit.php                        13-Apr-2024 02:05                4929
function.setcookie.php                             13-Apr-2024 02:05               29489
function.setlocale.php                             13-Apr-2024 02:05               16066
function.setrawcookie.php                          13-Apr-2024 02:05                6469
function.settype.php                               13-Apr-2024 02:05                6434
function.sha1-file.php                             13-Apr-2024 02:05                5777
function.sha1.php                                  13-Apr-2024 02:05                6039
function.shell-exec.php                            13-Apr-2024 02:05                6004
function.shm-attach.php                            13-Apr-2024 02:05                6384
function.shm-detach.php                            13-Apr-2024 02:05                4699
function.shm-get-var.php                           13-Apr-2024 02:05                4471
function.shm-has-var.php                           13-Apr-2024 02:05                4469
function.shm-put-var.php                           13-Apr-2024 02:05                5620
function.shm-remove-var.php                        13-Apr-2024 02:05                4344
function.shm-remove.php                            13-Apr-2024 02:05                4062
function.shmop-close.php                           13-Apr-2024 02:05                5008
function.shmop-delete.php                          13-Apr-2024 02:05                4310
function.shmop-open.php                            13-Apr-2024 02:05               10585
function.shmop-read.php                            13-Apr-2024 02:05                7042
function.shmop-size.php                            13-Apr-2024 02:05                4357
function.shmop-write.php                           13-Apr-2024 02:05                6454
function.show-source.php                           13-Apr-2024 02:05                1740
function.shuffle.php                               13-Apr-2024 02:05                7393
function.simdjson-decode.php                       13-Apr-2024 02:05               16946
function.simdjson-is-valid.php                     13-Apr-2024 02:05               10423
function.simdjson-key-count.php                    13-Apr-2024 02:05                4753
function.simdjson-key-exists.php                   13-Apr-2024 02:05                4548
function.simdjson-key-value.php                    13-Apr-2024 02:05                7286
function.similar-text.php                          13-Apr-2024 02:05                7700
function.simplexml-import-dom.php                  13-Apr-2024 02:05                6721
function.simplexml-load-file.php                   13-Apr-2024 02:05               10700
function.simplexml-load-string.php                 13-Apr-2024 02:05               10342
function.sin.php                                   13-Apr-2024 02:05                4610
function.sinh.php                                  13-Apr-2024 02:05                3363
function.sizeof.php                                13-Apr-2024 02:05                1626
function.sleep.php                                 13-Apr-2024 02:05                7383
function.snmp-get-quick-print.php                  13-Apr-2024 02:05                3762
function.snmp-get-valueretrieval.php               13-Apr-2024 02:05                4418
function.snmp-read-mib.php                         13-Apr-2024 02:05                4863
function.snmp-set-enum-print.php                   13-Apr-2024 02:05                5431
function.snmp-set-oid-numeric-print.php            13-Apr-2024 02:05                2313
function.snmp-set-oid-output-format.php            13-Apr-2024 02:05                7884
function.snmp-set-quick-print.php                  13-Apr-2024 02:05                7519
function.snmp-set-valueretrieval.php               13-Apr-2024 02:05                9624
function.snmp2-get.php                             13-Apr-2024 02:05                5847
function.snmp2-getnext.php                         13-Apr-2024 02:05                6271
function.snmp2-real-walk.php                       13-Apr-2024 02:05                6622
function.snmp2-set.php                             13-Apr-2024 02:05               11551
function.snmp2-walk.php                            13-Apr-2024 02:05                7306
function.snmp3-get.php                             13-Apr-2024 02:05                9088
function.snmp3-getnext.php                         13-Apr-2024 02:05                9474
function.snmp3-real-walk.php                       13-Apr-2024 02:05               10053
function.snmp3-set.php                             13-Apr-2024 02:05               14433
function.snmp3-walk.php                            13-Apr-2024 02:05               10819
function.snmpget.php                               13-Apr-2024 02:05                5874
function.snmpgetnext.php                           13-Apr-2024 02:05                6142
function.snmprealwalk.php                          13-Apr-2024 02:05                6522
function.snmpset.php                               13-Apr-2024 02:05               11609
function.snmpwalk.php                              13-Apr-2024 02:05                7443
function.snmpwalkoid.php                           13-Apr-2024 02:05                8126
function.socket-accept.php                         13-Apr-2024 02:05                7244
function.socket-addrinfo-bind.php                  13-Apr-2024 02:05                5639
function.socket-addrinfo-connect.php               13-Apr-2024 02:05                5415
function.socket-addrinfo-explain.php               13-Apr-2024 02:05                4589
function.socket-addrinfo-lookup.php                13-Apr-2024 02:05                6387
function.socket-atmark.php                         13-Apr-2024 02:05                5040
function.socket-bind.php                           13-Apr-2024 02:05               11414
function.socket-clear-error.php                    13-Apr-2024 02:05                4806
function.socket-close.php                          13-Apr-2024 02:05                4678
function.socket-cmsg-space.php                     13-Apr-2024 02:05                3805
function.socket-connect.php                        13-Apr-2024 02:05                8094
function.socket-create-listen.php                  13-Apr-2024 02:05                7494
function.socket-create-pair.php                    13-Apr-2024 02:05               20156
function.socket-create.php                         13-Apr-2024 02:05               14320
function.socket-export-stream.php                  13-Apr-2024 02:05                3588
function.socket-get-option.php                     13-Apr-2024 02:05               33401
function.socket-get-status.php                     13-Apr-2024 02:05                1821
function.socket-getopt.php                         13-Apr-2024 02:05                1796
function.socket-getpeername.php                    13-Apr-2024 02:05                8887
function.socket-getsockname.php                    13-Apr-2024 02:05                8190
function.socket-import-stream.php                  13-Apr-2024 02:05                5268
function.socket-last-error.php                     13-Apr-2024 02:05                7559
function.socket-listen.php                         13-Apr-2024 02:05                7695
function.socket-read.php                           13-Apr-2024 02:05                8459
function.socket-recv.php                           13-Apr-2024 02:05               16991
function.socket-recvfrom.php                       13-Apr-2024 02:05               14579
function.socket-recvmsg.php                        13-Apr-2024 02:05                4464
function.socket-select.php                         13-Apr-2024 02:05               17070
function.socket-send.php                           13-Apr-2024 02:05                7137
function.socket-sendmsg.php                        13-Apr-2024 02:05                4619
function.socket-sendto.php                         13-Apr-2024 02:05               10500
function.socket-set-block.php                      13-Apr-2024 02:05                6371
function.socket-set-blocking.php                   13-Apr-2024 02:05                1841
function.socket-set-nonblock.php                   13-Apr-2024 02:05                6793
function.socket-set-option.php                     13-Apr-2024 02:05               11638
function.socket-set-timeout.php                    13-Apr-2024 02:05                1809
function.socket-setopt.php                         13-Apr-2024 02:05                1790
function.socket-shutdown.php                       13-Apr-2024 02:05                5179
function.socket-strerror.php                       13-Apr-2024 02:05                7354
function.socket-write.php                          13-Apr-2024 02:05                7757
function.socket-wsaprotocol-info-export.php        13-Apr-2024 02:05                5200
function.socket-wsaprotocol-info-import.php        13-Apr-2024 02:05                4550
function.socket-wsaprotocol-info-release.php       13-Apr-2024 02:05                3660
function.sodium-add.php                            13-Apr-2024 02:05                3262
function.sodium-base642bin.php                     13-Apr-2024 02:05                4810
function.sodium-bin2base64.php                     13-Apr-2024 02:05                4387
function.sodium-bin2hex.php                        13-Apr-2024 02:05                2821
function.sodium-compare.php                        13-Apr-2024 02:05                3391
function.sodium-crypto-aead-aes256gcm-decrypt.php  13-Apr-2024 02:05                4983
function.sodium-crypto-aead-aes256gcm-encrypt.php  13-Apr-2024 02:05                4662
function.sodium-crypto-aead-aes256gcm-is-availa..> 13-Apr-2024 02:05                2925
function.sodium-crypto-aead-aes256gcm-keygen.php   13-Apr-2024 02:05                2877
function.sodium-crypto-aead-chacha20poly1305-de..> 13-Apr-2024 02:05                4832
function.sodium-crypto-aead-chacha20poly1305-en..> 13-Apr-2024 02:05                4471
function.sodium-crypto-aead-chacha20poly1305-ie..> 13-Apr-2024 02:05                5167
function.sodium-crypto-aead-chacha20poly1305-ie..> 13-Apr-2024 02:05                4736
function.sodium-crypto-aead-chacha20poly1305-ie..> 13-Apr-2024 02:05                3069
function.sodium-crypto-aead-chacha20poly1305-ke..> 13-Apr-2024 02:05                3004
function.sodium-crypto-aead-xchacha20poly1305-i..> 13-Apr-2024 02:05                5412
function.sodium-crypto-aead-xchacha20poly1305-i..> 13-Apr-2024 02:05                5013
function.sodium-crypto-aead-xchacha20poly1305-i..> 13-Apr-2024 02:05                3045
function.sodium-crypto-auth-keygen.php             13-Apr-2024 02:05                2687
function.sodium-crypto-auth-verify.php             13-Apr-2024 02:05                3956
function.sodium-crypto-auth.php                    13-Apr-2024 02:05                3403
function.sodium-crypto-box-keypair-from-secretk..> 13-Apr-2024 02:05                3439
function.sodium-crypto-box-keypair.php             13-Apr-2024 02:05                3063
function.sodium-crypto-box-open.php                13-Apr-2024 02:05                4179
function.sodium-crypto-box-publickey-from-secre..> 13-Apr-2024 02:05                3293
function.sodium-crypto-box-publickey.php           13-Apr-2024 02:05                2990
function.sodium-crypto-box-seal-open.php           13-Apr-2024 02:05                6124
function.sodium-crypto-box-seal.php                13-Apr-2024 02:05                7321
function.sodium-crypto-box-secretkey.php           13-Apr-2024 02:05                2953
function.sodium-crypto-box-seed-keypair.php        13-Apr-2024 02:05                3150
function.sodium-crypto-box.php                     13-Apr-2024 02:05                4549
function.sodium-crypto-core-ristretto255-add.php   13-Apr-2024 02:05                6135
function.sodium-crypto-core-ristretto255-from-h..> 13-Apr-2024 02:05                5542
function.sodium-crypto-core-ristretto255-is-val..> 13-Apr-2024 02:05                5749
function.sodium-crypto-core-ristretto255-random..> 13-Apr-2024 02:05                5639
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:05                6407
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:05                3596
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:05                5473
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:05                3889
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:05                5482
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:05                5802
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:05                3558
function.sodium-crypto-core-ristretto255-scalar..> 13-Apr-2024 02:05                6405
function.sodium-crypto-core-ristretto255-sub.php   13-Apr-2024 02:05                6165
function.sodium-crypto-generichash-final.php       13-Apr-2024 02:05                6924
function.sodium-crypto-generichash-init.php        13-Apr-2024 02:05                6888
function.sodium-crypto-generichash-keygen.php      13-Apr-2024 02:05                2489
function.sodium-crypto-generichash-update.php      13-Apr-2024 02:05                6597
function.sodium-crypto-generichash.php             13-Apr-2024 02:05                3886
function.sodium-crypto-kdf-derive-from-key.php     13-Apr-2024 02:05                4105
function.sodium-crypto-kdf-keygen.php              13-Apr-2024 02:05                2627
function.sodium-crypto-kx-client-session-keys.php  13-Apr-2024 02:05                3458
function.sodium-crypto-kx-keypair.php              13-Apr-2024 02:05                5098
function.sodium-crypto-kx-publickey.php            13-Apr-2024 02:05                2833
function.sodium-crypto-kx-secretkey.php            13-Apr-2024 02:05                2847
function.sodium-crypto-kx-seed-keypair.php         13-Apr-2024 02:05                2731
function.sodium-crypto-kx-server-session-keys.php  13-Apr-2024 02:05                3534
function.sodium-crypto-pwhash-scryptsalsa208sha..> 13-Apr-2024 02:05                3347
function.sodium-crypto-pwhash-scryptsalsa208sha..> 13-Apr-2024 02:05                3577
function.sodium-crypto-pwhash-scryptsalsa208sha..> 13-Apr-2024 02:05                6963
function.sodium-crypto-pwhash-str-needs-rehash.php 13-Apr-2024 02:05                4174
function.sodium-crypto-pwhash-str-verify.php       13-Apr-2024 02:05                5135
function.sodium-crypto-pwhash-str.php              13-Apr-2024 02:05                9374
function.sodium-crypto-pwhash.php                  13-Apr-2024 02:05               11071
function.sodium-crypto-scalarmult-base.php         13-Apr-2024 02:05                2038
function.sodium-crypto-scalarmult-ristretto255-..> 13-Apr-2024 02:05                3524
function.sodium-crypto-scalarmult-ristretto255.php 13-Apr-2024 02:05                3912
function.sodium-crypto-scalarmult.php              13-Apr-2024 02:05                3108
function.sodium-crypto-secretbox-keygen.php        13-Apr-2024 02:05                6373
function.sodium-crypto-secretbox-open.php          13-Apr-2024 02:05                9080
function.sodium-crypto-secretbox.php               13-Apr-2024 02:05                8926
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:05               11064
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:05               10403
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:05                2805
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:05                6178
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:05                6356
function.sodium-crypto-secretstream-xchacha20po..> 13-Apr-2024 02:05                3045
function.sodium-crypto-shorthash-keygen.php        13-Apr-2024 02:05                2760
function.sodium-crypto-shorthash.php               13-Apr-2024 02:05                3334
function.sodium-crypto-sign-detached.php           13-Apr-2024 02:05                3230
function.sodium-crypto-sign-ed25519-pk-to-curve..> 13-Apr-2024 02:05                2949
function.sodium-crypto-sign-ed25519-sk-to-curve..> 13-Apr-2024 02:05                3005
function.sodium-crypto-sign-keypair-from-secret..> 13-Apr-2024 02:05                3236
function.sodium-crypto-sign-keypair.php            13-Apr-2024 02:05                2492
function.sodium-crypto-sign-open.php               13-Apr-2024 02:05                3448
function.sodium-crypto-sign-publickey-from-secr..> 13-Apr-2024 02:05                2829
function.sodium-crypto-sign-publickey.php          13-Apr-2024 02:05                2875
function.sodium-crypto-sign-secretkey.php          13-Apr-2024 02:05                2851
function.sodium-crypto-sign-seed-keypair.php       13-Apr-2024 02:05                3177
function.sodium-crypto-sign-verify-detached.php    13-Apr-2024 02:05                3650
function.sodium-crypto-sign.php                    13-Apr-2024 02:05                3450
function.sodium-crypto-stream-keygen.php           13-Apr-2024 02:05                2666
function.sodium-crypto-stream-xchacha20-keygen.php 13-Apr-2024 02:05                2822
function.sodium-crypto-stream-xchacha20-xor-ic.php 13-Apr-2024 02:05                9899
function.sodium-crypto-stream-xchacha20-xor.php    13-Apr-2024 02:05                4895
function.sodium-crypto-stream-xchacha20.php        13-Apr-2024 02:05                3806
function.sodium-crypto-stream-xor.php              13-Apr-2024 02:05                3650
function.sodium-crypto-stream.php                  13-Apr-2024 02:05                3598
function.sodium-hex2bin.php                        13-Apr-2024 02:05                3382
function.sodium-increment.php                      13-Apr-2024 02:05                2588
function.sodium-memcmp.php                         13-Apr-2024 02:05                3662
function.sodium-memzero.php                        13-Apr-2024 02:05                2498
function.sodium-pad.php                            13-Apr-2024 02:05                2925
function.sodium-unpad.php                          13-Apr-2024 02:05                2843
function.solr-get-version.php                      13-Apr-2024 02:05                3983
function.sort.php                                  13-Apr-2024 02:05               12968
function.soundex.php                               13-Apr-2024 02:05                7364
function.spl-autoload-call.php                     13-Apr-2024 02:05                2698
function.spl-autoload-extensions.php               13-Apr-2024 02:05                5048
function.spl-autoload-functions.php                13-Apr-2024 02:05                3129
function.spl-autoload-register.php                 13-Apr-2024 02:05               13785
function.spl-autoload-unregister.php               13-Apr-2024 02:05                3251
function.spl-autoload.php                          13-Apr-2024 02:05                4680
function.spl-classes.php                           13-Apr-2024 02:05                3711
function.spl-object-hash.php                       13-Apr-2024 02:05                5511
function.spl-object-id.php                         13-Apr-2024 02:05                4381
function.sprintf.php                               13-Apr-2024 02:05               31320
function.sqlsrv-begin-transaction.php              13-Apr-2024 02:05               11240
function.sqlsrv-cancel.php                         13-Apr-2024 02:05               10299
function.sqlsrv-client-info.php                    13-Apr-2024 02:05                6696
function.sqlsrv-close.php                          13-Apr-2024 02:05                5568
function.sqlsrv-commit.php                         13-Apr-2024 02:05               11083
function.sqlsrv-configure.php                      13-Apr-2024 02:05                4712
function.sqlsrv-connect.php                        13-Apr-2024 02:05               12133
function.sqlsrv-errors.php                         13-Apr-2024 02:05                9985
function.sqlsrv-execute.php                        13-Apr-2024 02:05               10122
function.sqlsrv-fetch-array.php                    13-Apr-2024 02:05               16037
function.sqlsrv-fetch-object.php                   13-Apr-2024 02:05               12324
function.sqlsrv-fetch.php                          13-Apr-2024 02:05               10771
function.sqlsrv-field-metadata.php                 13-Apr-2024 02:05                8807
function.sqlsrv-free-stmt.php                      13-Apr-2024 02:05                7700
function.sqlsrv-get-config.php                     13-Apr-2024 02:05                3293
function.sqlsrv-get-field.php                      13-Apr-2024 02:05               10143
function.sqlsrv-has-rows.php                       13-Apr-2024 02:05                6300
function.sqlsrv-next-result.php                    13-Apr-2024 02:05                9216
function.sqlsrv-num-fields.php                     13-Apr-2024 02:05                8134
function.sqlsrv-num-rows.php                       13-Apr-2024 02:05                7861
function.sqlsrv-prepare.php                        13-Apr-2024 02:05               14479
function.sqlsrv-query.php                          13-Apr-2024 02:05               11832
function.sqlsrv-rollback.php                       13-Apr-2024 02:05               10553
function.sqlsrv-rows-affected.php                  13-Apr-2024 02:05                7911
function.sqlsrv-send-stream-data.php               13-Apr-2024 02:05                8480
function.sqlsrv-server-info.php                    13-Apr-2024 02:05                6096
function.sqrt.php                                  13-Apr-2024 02:05                4538
function.srand.php                                 13-Apr-2024 02:05                7698
function.sscanf.php                                13-Apr-2024 02:05               12095
function.ssdeep-fuzzy-compare.php                  13-Apr-2024 02:05                3235
function.ssdeep-fuzzy-hash-filename.php            13-Apr-2024 02:05                2960
function.ssdeep-fuzzy-hash.php                     13-Apr-2024 02:05                2804
function.ssh2-auth-agent.php                       13-Apr-2024 02:05                4795
function.ssh2-auth-hostbased-file.php              13-Apr-2024 02:05                7837
function.ssh2-auth-none.php                        13-Apr-2024 02:05                4897
function.ssh2-auth-password.php                    13-Apr-2024 02:05                5130
function.ssh2-auth-pubkey-file.php                 13-Apr-2024 02:05                7400
function.ssh2-connect.php                          13-Apr-2024 02:05               16429
function.ssh2-disconnect.php                       13-Apr-2024 02:05                3090
function.ssh2-exec.php                             13-Apr-2024 02:05                7716
function.ssh2-fetch-stream.php                     13-Apr-2024 02:05                5698
function.ssh2-fingerprint.php                      13-Apr-2024 02:05                5627
function.ssh2-forward-accept.php                   13-Apr-2024 02:05                3220
function.ssh2-forward-listen.php                   13-Apr-2024 02:05                4709
function.ssh2-methods-negotiated.php               13-Apr-2024 02:05                8036
function.ssh2-poll.php                             13-Apr-2024 02:05                3845
function.ssh2-publickey-add.php                    13-Apr-2024 02:05                8658
function.ssh2-publickey-init.php                   13-Apr-2024 02:05                4970
function.ssh2-publickey-list.php                   13-Apr-2024 02:05                9142
function.ssh2-publickey-remove.php                 13-Apr-2024 02:05                4879
function.ssh2-scp-recv.php                         13-Apr-2024 02:05                5598
function.ssh2-scp-send.php                         13-Apr-2024 02:05                6226
function.ssh2-send-eof.php                         13-Apr-2024 02:05                3669
function.ssh2-sftp-chmod.php                       13-Apr-2024 02:05                6087
function.ssh2-sftp-lstat.php                       13-Apr-2024 02:05                7491
function.ssh2-sftp-mkdir.php                       13-Apr-2024 02:05                7082
function.ssh2-sftp-readlink.php                    13-Apr-2024 02:05                5460
function.ssh2-sftp-realpath.php                    13-Apr-2024 02:05                5630
function.ssh2-sftp-rename.php                      13-Apr-2024 02:05                5651
function.ssh2-sftp-rmdir.php                       13-Apr-2024 02:05                5689
function.ssh2-sftp-stat.php                        13-Apr-2024 02:05                7406
function.ssh2-sftp-symlink.php                     13-Apr-2024 02:05                5903
function.ssh2-sftp-unlink.php                      13-Apr-2024 02:05                5089
function.ssh2-sftp.php                             13-Apr-2024 02:05                5562
function.ssh2-shell.php                            13-Apr-2024 02:05                8194
function.ssh2-tunnel.php                           13-Apr-2024 02:05                5445
function.stat.php                                  13-Apr-2024 02:05               17857
function.stats-absolute-deviation.php              13-Apr-2024 02:05                2793
function.stats-cdf-beta.php                        13-Apr-2024 02:05                5160
function.stats-cdf-binomial.php                    13-Apr-2024 02:05                5145
function.stats-cdf-cauchy.php                      13-Apr-2024 02:05                5180
function.stats-cdf-chisquare.php                   13-Apr-2024 02:05                4499
function.stats-cdf-exponential.php                 13-Apr-2024 02:05                4530
function.stats-cdf-f.php                           13-Apr-2024 02:05                5085
function.stats-cdf-gamma.php                       13-Apr-2024 02:05                5144
function.stats-cdf-laplace.php                     13-Apr-2024 02:05                5165
function.stats-cdf-logistic.php                    13-Apr-2024 02:05                5200
function.stats-cdf-negative-binomial.php           13-Apr-2024 02:05                5288
function.stats-cdf-noncentral-chisquare.php        13-Apr-2024 02:05                5390
function.stats-cdf-noncentral-f.php                13-Apr-2024 02:05                5964
function.stats-cdf-noncentral-t.php                13-Apr-2024 02:05                5250
function.stats-cdf-normal.php                      13-Apr-2024 02:05                5182
function.stats-cdf-poisson.php                     13-Apr-2024 02:05                4464
function.stats-cdf-t.php                           13-Apr-2024 02:05                4392
function.stats-cdf-uniform.php                     13-Apr-2024 02:05                5145
function.stats-cdf-weibull.php                     13-Apr-2024 02:05                5182
function.stats-covariance.php                      13-Apr-2024 02:05                2993
function.stats-dens-beta.php                       13-Apr-2024 02:05                3479
function.stats-dens-cauchy.php                     13-Apr-2024 02:05                3537
function.stats-dens-chisquare.php                  13-Apr-2024 02:05                3207
function.stats-dens-exponential.php                13-Apr-2024 02:05                3197
function.stats-dens-f.php                          13-Apr-2024 02:05                3477
function.stats-dens-gamma.php                      13-Apr-2024 02:05                3530
function.stats-dens-laplace.php                    13-Apr-2024 02:05                3564
function.stats-dens-logistic.php                   13-Apr-2024 02:05                3576
function.stats-dens-normal.php                     13-Apr-2024 02:05                3547
function.stats-dens-pmf-binomial.php               13-Apr-2024 02:05                3601
function.stats-dens-pmf-hypergeometric.php         13-Apr-2024 02:05                4253
function.stats-dens-pmf-negative-binomial.php      13-Apr-2024 02:05                3730
function.stats-dens-pmf-poisson.php                13-Apr-2024 02:05                3198
function.stats-dens-t.php                          13-Apr-2024 02:05                3111
function.stats-dens-uniform.php                    13-Apr-2024 02:05                3512
function.stats-dens-weibull.php                    13-Apr-2024 02:05                3544
function.stats-harmonic-mean.php                   13-Apr-2024 02:05                2692
function.stats-kurtosis.php                        13-Apr-2024 02:05                2700
function.stats-rand-gen-beta.php                   13-Apr-2024 02:05                3006
function.stats-rand-gen-chisquare.php              13-Apr-2024 02:05                2679
function.stats-rand-gen-exponential.php            13-Apr-2024 02:05                2677
function.stats-rand-gen-f.php                      13-Apr-2024 02:05                3060
function.stats-rand-gen-funiform.php               13-Apr-2024 02:05                2987
function.stats-rand-gen-gamma.php                  13-Apr-2024 02:05                3073
function.stats-rand-gen-ibinomial-negative.php     13-Apr-2024 02:05                3153
function.stats-rand-gen-ibinomial.php              13-Apr-2024 02:05                3077
function.stats-rand-gen-int.php                    13-Apr-2024 02:05                2267
function.stats-rand-gen-ipoisson.php               13-Apr-2024 02:05                2652
function.stats-rand-gen-iuniform.php               13-Apr-2024 02:05                3054
function.stats-rand-gen-noncentral-chisquare.php   13-Apr-2024 02:05                3195
function.stats-rand-gen-noncentral-f.php           13-Apr-2024 02:05                3548
function.stats-rand-gen-noncentral-t.php           13-Apr-2024 02:05                3108
function.stats-rand-gen-normal.php                 13-Apr-2024 02:05                3021
function.stats-rand-gen-t.php                      13-Apr-2024 02:05                2571
function.stats-rand-get-seeds.php                  13-Apr-2024 02:05                2310
function.stats-rand-phrase-to-seeds.php            13-Apr-2024 02:05                2660
function.stats-rand-ranf.php                       13-Apr-2024 02:05                2311
function.stats-rand-setall.php                     13-Apr-2024 02:05                2929
function.stats-skew.php                            13-Apr-2024 02:05                2666
function.stats-standard-deviation.php              13-Apr-2024 02:05                3837
function.stats-stat-binomial-coef.php              13-Apr-2024 02:05                2966
function.stats-stat-correlation.php                13-Apr-2024 02:05                3173
function.stats-stat-factorial.php                  13-Apr-2024 02:05                2539
function.stats-stat-independent-t.php              13-Apr-2024 02:05                3331
function.stats-stat-innerproduct.php               13-Apr-2024 02:05                3115
function.stats-stat-paired-t.php                   13-Apr-2024 02:05                3052
function.stats-stat-percentile.php                 13-Apr-2024 02:05                2918
function.stats-stat-powersum.php                   13-Apr-2024 02:05                2910
function.stats-variance.php                        13-Apr-2024 02:05                3337
function.stomp-connect-error.php                   13-Apr-2024 02:05                3688
function.stomp-version.php                         13-Apr-2024 02:05                3119
function.str-contains.php                          13-Apr-2024 02:05                8456
function.str-decrement.php                         13-Apr-2024 02:05                6751
function.str-ends-with.php                         13-Apr-2024 02:05                8394
function.str-getcsv.php                            13-Apr-2024 02:05                9714
function.str-increment.php                         13-Apr-2024 02:05                6395
function.str-ireplace.php                          13-Apr-2024 02:05                9972
function.str-pad.php                               13-Apr-2024 02:05                8485
function.str-repeat.php                            13-Apr-2024 02:05                4704
function.str-replace.php                           13-Apr-2024 02:05               17583
function.str-rot13.php                             13-Apr-2024 02:05                3683
function.str-shuffle.php                           13-Apr-2024 02:05                6307
function.str-split.php                             13-Apr-2024 02:05                8861
function.str-starts-with.php                       13-Apr-2024 02:05                8416
function.str-word-count.php                        13-Apr-2024 02:05                9380
function.strcasecmp.php                            13-Apr-2024 02:05                6517
function.strchr.php                                13-Apr-2024 02:05                1648
function.strcmp.php                                13-Apr-2024 02:05                6235
function.strcoll.php                               13-Apr-2024 02:05                5357
function.strcspn.php                               13-Apr-2024 02:05               11669
function.stream-bucket-append.php                  13-Apr-2024 02:05                2317
function.stream-bucket-make-writeable.php          13-Apr-2024 02:05                4518
function.stream-bucket-new.php                     13-Apr-2024 02:05                2354
function.stream-bucket-prepend.php                 13-Apr-2024 02:05                6388
function.stream-context-create.php                 13-Apr-2024 02:05                8118
function.stream-context-get-default.php            13-Apr-2024 02:05                9183
function.stream-context-get-options.php            13-Apr-2024 02:05                4582
function.stream-context-get-params.php             13-Apr-2024 02:05                5557
function.stream-context-set-default.php            13-Apr-2024 02:05                6558
function.stream-context-set-option.php             13-Apr-2024 02:05                5853
function.stream-context-set-options.php            13-Apr-2024 02:05                6561
function.stream-context-set-params.php             13-Apr-2024 02:05                4931
function.stream-copy-to-stream.php                 13-Apr-2024 02:05                8024
function.stream-filter-append.php                  13-Apr-2024 02:05               11858
function.stream-filter-prepend.php                 13-Apr-2024 02:05                9000
function.stream-filter-register.php                13-Apr-2024 02:05               19060
function.stream-filter-remove.php                  13-Apr-2024 02:05                6868
function.stream-get-contents.php                   13-Apr-2024 02:05                9420
function.stream-get-filters.php                    13-Apr-2024 02:05                4192
function.stream-get-line.php                       13-Apr-2024 02:05                5452
function.stream-get-meta-data.php                  13-Apr-2024 02:05               15388
function.stream-get-transports.php                 13-Apr-2024 02:05                4203
function.stream-get-wrappers.php                   13-Apr-2024 02:05                5036
function.stream-is-local.php                       13-Apr-2024 02:05                4274
function.stream-isatty.php                         13-Apr-2024 02:05                4217
function.stream-notification-callback.php          13-Apr-2024 02:05               22594
function.stream-register-wrapper.php               13-Apr-2024 02:05                1922
function.stream-resolve-include-path.php           13-Apr-2024 02:05                4361
function.stream-select.php                         13-Apr-2024 02:05               17943
function.stream-set-blocking.php                   13-Apr-2024 02:05                5345
function.stream-set-chunk-size.php                 13-Apr-2024 02:05                4521
function.stream-set-read-buffer.php                13-Apr-2024 02:05                4004
function.stream-set-timeout.php                    13-Apr-2024 02:05                8442
function.stream-set-write-buffer.php               13-Apr-2024 02:05                6197
function.stream-socket-accept.php                  13-Apr-2024 02:05                8175
function.stream-socket-client.php                  13-Apr-2024 02:05               19204
function.stream-socket-enable-crypto.php           13-Apr-2024 02:05               12288
function.stream-socket-get-name.php                13-Apr-2024 02:05                3970
function.stream-socket-pair.php                    13-Apr-2024 02:05               10109
function.stream-socket-recvfrom.php                13-Apr-2024 02:05               11371
function.stream-socket-sendto.php                  13-Apr-2024 02:05                7840
function.stream-socket-server.php                  13-Apr-2024 02:05               16760
function.stream-socket-shutdown.php                13-Apr-2024 02:05                6814
function.stream-supports-lock.php                  13-Apr-2024 02:05                3325
function.stream-wrapper-register.php               13-Apr-2024 02:05                9700
function.stream-wrapper-restore.php                13-Apr-2024 02:05                2971
function.stream-wrapper-unregister.php             13-Apr-2024 02:05                3237
function.strftime.php                              13-Apr-2024 02:05               56897
function.strip-tags.php                            13-Apr-2024 02:05               10061
function.stripcslashes.php                         13-Apr-2024 02:05                4037
function.stripos.php                               13-Apr-2024 02:05               12436
function.stripslashes.php                          13-Apr-2024 02:05                7766
function.stristr.php                               13-Apr-2024 02:05               10845
function.strlen.php                                13-Apr-2024 02:05                4931
function.strnatcasecmp.php                         13-Apr-2024 02:05                7911
function.strnatcmp.php                             13-Apr-2024 02:05                9202
function.strncasecmp.php                           13-Apr-2024 02:05                7192
function.strncmp.php                               13-Apr-2024 02:05                7007
function.strpbrk.php                               13-Apr-2024 02:05                5452
function.strpos.php                                13-Apr-2024 02:05               14413
function.strptime.php                              13-Apr-2024 02:05               13040
function.strrchr.php                               13-Apr-2024 02:05                8653
function.strrev.php                                13-Apr-2024 02:05                3202
function.strripos.php                              13-Apr-2024 02:05               11274
function.strrpos.php                               13-Apr-2024 02:05               13118
function.strspn.php                                13-Apr-2024 02:05               11001
function.strstr.php                                13-Apr-2024 02:05                9060
function.strtok.php                                13-Apr-2024 02:05               13903
function.strtolower.php                            13-Apr-2024 02:05                6077
function.strtotime.php                             13-Apr-2024 02:05               13768
function.strtoupper.php                            13-Apr-2024 02:05                6080
function.strtr.php                                 13-Apr-2024 02:05               11821
function.strval.php                                13-Apr-2024 02:05                6580
function.substr-compare.php                        13-Apr-2024 02:05               11316
function.substr-count.php                          13-Apr-2024 02:05                9753
function.substr-replace.php                        13-Apr-2024 02:05               16334
function.substr.php                                13-Apr-2024 02:05               23277
function.svn-add.php                               13-Apr-2024 02:05                6561
function.svn-auth-get-parameter.php                13-Apr-2024 02:05                4047
function.svn-auth-set-parameter.php                13-Apr-2024 02:05                5529
function.svn-blame.php                             13-Apr-2024 02:05                4989
function.svn-cat.php                               13-Apr-2024 02:05                5037
function.svn-checkout.php                          13-Apr-2024 02:05                7896
function.svn-cleanup.php                           13-Apr-2024 02:05                5552
function.svn-client-version.php                    13-Apr-2024 02:05                3677
function.svn-commit.php                            13-Apr-2024 02:05                8251
function.svn-delete.php                            13-Apr-2024 02:05                4906
function.svn-diff.php                              13-Apr-2024 02:05               14430
function.svn-export.php                            13-Apr-2024 02:05                5382
function.svn-fs-abort-txn.php                      13-Apr-2024 02:05                3385
function.svn-fs-apply-text.php                     13-Apr-2024 02:05                2910
function.svn-fs-begin-txn2.php                     13-Apr-2024 02:05                2898
function.svn-fs-change-node-prop.php               13-Apr-2024 02:05                3393
function.svn-fs-check-path.php                     13-Apr-2024 02:05                3006
function.svn-fs-contents-changed.php               13-Apr-2024 02:05                3480
function.svn-fs-copy.php                           13-Apr-2024 02:05                4398
function.svn-fs-delete.php                         13-Apr-2024 02:05                3675
function.svn-fs-dir-entries.php                    13-Apr-2024 02:05                3044
function.svn-fs-file-contents.php                  13-Apr-2024 02:05                3055
function.svn-fs-file-length.php                    13-Apr-2024 02:05                2942
function.svn-fs-is-dir.php                         13-Apr-2024 02:05                3744
function.svn-fs-is-file.php                        13-Apr-2024 02:05                3729
function.svn-fs-make-dir.php                       13-Apr-2024 02:05                3687
function.svn-fs-make-file.php                      13-Apr-2024 02:05                3702
function.svn-fs-node-created-rev.php               13-Apr-2024 02:05                2967
function.svn-fs-node-prop.php                      13-Apr-2024 02:05                3055
function.svn-fs-props-changed.php                  13-Apr-2024 02:05                3463
function.svn-fs-revision-prop.php                  13-Apr-2024 02:05                3087
function.svn-fs-revision-root.php                  13-Apr-2024 02:05                2993
function.svn-fs-txn-root.php                       13-Apr-2024 02:05                2739
function.svn-fs-youngest-rev.php                   13-Apr-2024 02:05                2765
function.svn-import.php                            13-Apr-2024 02:05                6453
function.svn-log.php                               13-Apr-2024 02:05                9685
function.svn-ls.php                                13-Apr-2024 02:05                7422
function.svn-mkdir.php                             13-Apr-2024 02:05                3344
function.svn-repos-create.php                      13-Apr-2024 02:05                3178
function.svn-repos-fs-begin-txn-for-commit.php     13-Apr-2024 02:05                3486
function.svn-repos-fs-commit-txn.php               13-Apr-2024 02:05                2854
function.svn-repos-fs.php                          13-Apr-2024 02:05                2761
function.svn-repos-hotcopy.php                     13-Apr-2024 02:05                3134
function.svn-repos-open.php                        13-Apr-2024 02:05                2661
function.svn-repos-recover.php                     13-Apr-2024 02:05                2705
function.svn-revert.php                            13-Apr-2024 02:05                3602
function.svn-status.php                            13-Apr-2024 02:05               15073
function.svn-update.php                            13-Apr-2024 02:05                6387
function.swoole-async-dns-lookup.php               13-Apr-2024 02:05                3849
function.swoole-async-read.php                     13-Apr-2024 02:05                4438
function.swoole-async-readfile.php                 13-Apr-2024 02:05                3874
function.swoole-async-set.php                      13-Apr-2024 02:05                2388
function.swoole-async-write.php                    13-Apr-2024 02:05                3754
function.swoole-async-writefile.php                13-Apr-2024 02:05                3782
function.swoole-clear-error.php                    13-Apr-2024 02:05                2268
function.swoole-client-select.php                  13-Apr-2024 02:05                3470
function.swoole-cpu-num.php                        13-Apr-2024 02:05                2119
function.swoole-errno.php                          13-Apr-2024 02:05                2096
function.swoole-error-log.php                      13-Apr-2024 02:05                3539
function.swoole-event-add.php                      13-Apr-2024 02:05                3477
function.swoole-event-defer.php                    13-Apr-2024 02:05                2637
function.swoole-event-del.php                      13-Apr-2024 02:05                2603
function.swoole-event-exit.php                     13-Apr-2024 02:05                2162
function.swoole-event-set.php                      13-Apr-2024 02:05                3465
function.swoole-event-wait.php                     13-Apr-2024 02:05                2133
function.swoole-event-write.php                    13-Apr-2024 02:05                2875
function.swoole-get-local-ip.php                   13-Apr-2024 02:05                2190
function.swoole-last-error.php                     13-Apr-2024 02:05                2145
function.swoole-load-module.php                    13-Apr-2024 02:05                2303
function.swoole-select.php                         13-Apr-2024 02:05                3437
function.swoole-set-process-name.php               13-Apr-2024 02:05                2610
function.swoole-strerror.php                       13-Apr-2024 02:05                2564
function.swoole-timer-after.php                    13-Apr-2024 02:05                2988
function.swoole-timer-exists.php                   13-Apr-2024 02:05                2401
function.swoole-timer-tick.php                     13-Apr-2024 02:05                2865
function.swoole-version.php                        13-Apr-2024 02:05                2124
function.symlink.php                               13-Apr-2024 02:05                5736
function.sys-get-temp-dir.php                      13-Apr-2024 02:05                4243
function.sys-getloadavg.php                        13-Apr-2024 02:05                4184
function.syslog.php                                13-Apr-2024 02:05                9666
function.system.php                                13-Apr-2024 02:05                8050
function.taint.php                                 13-Apr-2024 02:05                2743
function.tan.php                                   13-Apr-2024 02:05                4381
function.tanh.php                                  13-Apr-2024 02:05                3395
function.tcpwrap-check.php                         13-Apr-2024 02:05                6125
function.tempnam.php                               13-Apr-2024 02:05                7620
function.textdomain.php                            13-Apr-2024 02:05                3466
function.tidy-access-count.php                     13-Apr-2024 02:05                6598
function.tidy-config-count.php                     13-Apr-2024 02:05                4319
function.tidy-error-count.php                      13-Apr-2024 02:05                5370
function.tidy-get-output.php                       13-Apr-2024 02:05                4305
function.tidy-warning-count.php                    13-Apr-2024 02:05                4909
function.time-nanosleep.php                        13-Apr-2024 02:05                8779
function.time-sleep-until.php                      13-Apr-2024 02:05                5858
function.time.php                                  13-Apr-2024 02:05                4719
function.timezone-abbreviations-list.php           13-Apr-2024 02:05                1918
function.timezone-identifiers-list.php             13-Apr-2024 02:05                1934
function.timezone-location-get.php                 13-Apr-2024 02:05                1890
function.timezone-name-from-abbr.php               13-Apr-2024 02:05                6472
function.timezone-name-get.php                     13-Apr-2024 02:05                1834
function.timezone-offset-get.php                   13-Apr-2024 02:05                1832
function.timezone-open.php                         13-Apr-2024 02:05                1820
function.timezone-transitions-get.php              13-Apr-2024 02:05                1893
function.timezone-version-get.php                  13-Apr-2024 02:05                4606
function.tmpfile.php                               13-Apr-2024 02:05                5725
function.token-get-all.php                         13-Apr-2024 02:05               12145
function.token-name.php                            13-Apr-2024 02:05                4172
function.touch.php                                 13-Apr-2024 02:05                8337
function.trader-acos.php                           13-Apr-2024 02:05                2441
function.trader-ad.php                             13-Apr-2024 02:05                3344
function.trader-add.php                            13-Apr-2024 02:05                2775
function.trader-adosc.php                          13-Apr-2024 02:05                4204
function.trader-adx.php                            13-Apr-2024 02:05                3433
function.trader-adxr.php                           13-Apr-2024 02:05                3444
function.trader-apo.php                            13-Apr-2024 02:05                3644
function.trader-aroon.php                          13-Apr-2024 02:05                3007
function.trader-aroonosc.php                       13-Apr-2024 02:05                3044
function.trader-asin.php                           13-Apr-2024 02:05                2459
function.trader-atan.php                           13-Apr-2024 02:05                2452
function.trader-atr.php                            13-Apr-2024 02:05                3423
function.trader-avgprice.php                       13-Apr-2024 02:05                3398
function.trader-bbands.php                         13-Apr-2024 02:05                4403
function.trader-beta.php                           13-Apr-2024 02:05                2980
function.trader-bop.php                            13-Apr-2024 02:05                3347
function.trader-cci.php                            13-Apr-2024 02:05                3428
function.trader-cdl2crows.php                      13-Apr-2024 02:05                3420
function.trader-cdl3blackcrows.php                 13-Apr-2024 02:05                3482
function.trader-cdl3inside.php                     13-Apr-2024 02:05                3463
function.trader-cdl3linestrike.php                 13-Apr-2024 02:05                3486
function.trader-cdl3outside.php                    13-Apr-2024 02:05                3478
function.trader-cdl3starsinsouth.php               13-Apr-2024 02:05                3527
function.trader-cdl3whitesoldiers.php              13-Apr-2024 02:05                3551
function.trader-cdlabandonedbaby.php               13-Apr-2024 02:05                3939
function.trader-cdladvanceblock.php                13-Apr-2024 02:05                3504
function.trader-cdlbelthold.php                    13-Apr-2024 02:05                3460
function.trader-cdlbreakaway.php                   13-Apr-2024 02:05                3474
function.trader-cdlclosingmarubozu.php             13-Apr-2024 02:05                3545
function.trader-cdlconcealbabyswall.php            13-Apr-2024 02:05                3568
function.trader-cdlcounterattack.php               13-Apr-2024 02:05                3532
function.trader-cdldarkcloudcover.php              13-Apr-2024 02:05                3933
function.trader-cdldoji.php                        13-Apr-2024 02:05                3417
function.trader-cdldojistar.php                    13-Apr-2024 02:05                3452
function.trader-cdldragonflydoji.php               13-Apr-2024 02:05                3507
function.trader-cdlengulfing.php                   13-Apr-2024 02:05                3492
function.trader-cdleveningdojistar.php             13-Apr-2024 02:05                3950
function.trader-cdleveningstar.php                 13-Apr-2024 02:05                3927
function.trader-cdlgapsidesidewhite.php            13-Apr-2024 02:05                3575
function.trader-cdlgravestonedoji.php              13-Apr-2024 02:05                3528
function.trader-cdlhammer.php                      13-Apr-2024 02:05                3443
function.trader-cdlhangingman.php                  13-Apr-2024 02:05                3464
function.trader-cdlharami.php                      13-Apr-2024 02:05                3445
function.trader-cdlharamicross.php                 13-Apr-2024 02:05                3487
function.trader-cdlhighwave.php                    13-Apr-2024 02:05                3461
function.trader-cdlhikkake.php                     13-Apr-2024 02:05                3450
function.trader-cdlhikkakemod.php                  13-Apr-2024 02:05                3491
function.trader-cdlhomingpigeon.php                13-Apr-2024 02:05                3512
function.trader-cdlidentical3crows.php             13-Apr-2024 02:05                3536
function.trader-cdlinneck.php                      13-Apr-2024 02:05                3462
function.trader-cdlinvertedhammer.php              13-Apr-2024 02:05                3510
function.trader-cdlkicking.php                     13-Apr-2024 02:05                3464
function.trader-cdlkickingbylength.php             13-Apr-2024 02:05                3570
function.trader-cdlladderbottom.php                13-Apr-2024 02:05                3520
function.trader-cdllongleggeddoji.php              13-Apr-2024 02:05                3525
function.trader-cdllongline.php                    13-Apr-2024 02:05                3469
function.trader-cdlmarubozu.php                    13-Apr-2024 02:05                3455
function.trader-cdlmatchinglow.php                 13-Apr-2024 02:05                3481
function.trader-cdlmathold.php                     13-Apr-2024 02:05                3873
function.trader-cdlmorningdojistar.php             13-Apr-2024 02:05                3946
function.trader-cdlmorningstar.php                 13-Apr-2024 02:05                3907
function.trader-cdlonneck.php                      13-Apr-2024 02:05                3442
function.trader-cdlpiercing.php                    13-Apr-2024 02:05                3459
function.trader-cdlrickshawman.php                 13-Apr-2024 02:05                3499
function.trader-cdlrisefall3methods.php            13-Apr-2024 02:05                3569
function.trader-cdlseparatinglines.php             13-Apr-2024 02:05                3551
function.trader-cdlshootingstar.php                13-Apr-2024 02:05                3510
function.trader-cdlshortline.php                   13-Apr-2024 02:05                3482
function.trader-cdlspinningtop.php                 13-Apr-2024 02:05                3497
function.trader-cdlstalledpattern.php              13-Apr-2024 02:05                3532
function.trader-cdlsticksandwich.php               13-Apr-2024 02:05                3513
function.trader-cdltakuri.php                      13-Apr-2024 02:05                3484
function.trader-cdltasukigap.php                   13-Apr-2024 02:05                3459
function.trader-cdlthrusting.php                   13-Apr-2024 02:05                3468
function.trader-cdltristar.php                     13-Apr-2024 02:05                3456
function.trader-cdlunique3river.php                13-Apr-2024 02:05                3507
function.trader-cdlupsidegap2crows.php             13-Apr-2024 02:05                3555
function.trader-cdlxsidegap3methods.php            13-Apr-2024 02:05                3554
function.trader-ceil.php                           13-Apr-2024 02:05                2476
function.trader-cmo.php                            13-Apr-2024 02:05                2693
function.trader-correl.php                         13-Apr-2024 02:05                3032
function.trader-cos.php                            13-Apr-2024 02:05                2442
function.trader-cosh.php                           13-Apr-2024 02:05                2458
function.trader-dema.php                           13-Apr-2024 02:05                2704
function.trader-div.php                            13-Apr-2024 02:05                2791
function.trader-dx.php                             13-Apr-2024 02:05                3409
function.trader-ema.php                            13-Apr-2024 02:05                2687
function.trader-errno.php                          13-Apr-2024 02:05                2189
function.trader-exp.php                            13-Apr-2024 02:05                2486
function.trader-floor.php                          13-Apr-2024 02:05                2468
function.trader-get-compat.php                     13-Apr-2024 02:05                2379
function.trader-get-unstable-period.php            13-Apr-2024 02:05                2690
function.trader-ht-dcperiod.php                    13-Apr-2024 02:05                2456
function.trader-ht-dcphase.php                     13-Apr-2024 02:05                2427
function.trader-ht-phasor.php                      13-Apr-2024 02:05                2408
function.trader-ht-sine.php                        13-Apr-2024 02:05                2387
function.trader-ht-trendline.php                   13-Apr-2024 02:05                2448
function.trader-ht-trendmode.php                   13-Apr-2024 02:05                2438
function.trader-kama.php                           13-Apr-2024 02:05                2742
function.trader-linearreg-angle.php                13-Apr-2024 02:05                2836
function.trader-linearreg-intercept.php            13-Apr-2024 02:05                2894
function.trader-linearreg-slope.php                13-Apr-2024 02:05                2846
function.trader-linearreg.php                      13-Apr-2024 02:05                2758
function.trader-ln.php                             13-Apr-2024 02:05                2444
function.trader-log10.php                          13-Apr-2024 02:05                2448
function.trader-ma.php                             13-Apr-2024 02:05                3108
function.trader-macd.php                           13-Apr-2024 02:05                3629
function.trader-macdext.php                        13-Apr-2024 02:05                5122
function.trader-macdfix.php                        13-Apr-2024 02:05                2788
function.trader-mama.php                           13-Apr-2024 02:05                3129
function.trader-mavp.php                           13-Apr-2024 02:05                4036
function.trader-max.php                            13-Apr-2024 02:05                2708
function.trader-maxindex.php                       13-Apr-2024 02:05                2765
function.trader-medprice.php                       13-Apr-2024 02:05                2674
function.trader-mfi.php                            13-Apr-2024 02:05                3769
function.trader-midpoint.php                       13-Apr-2024 02:05                2739
function.trader-midprice.php                       13-Apr-2024 02:05                3058
function.trader-min.php                            13-Apr-2024 02:05                2715
function.trader-minindex.php                       13-Apr-2024 02:05                2760
function.trader-minmax.php                         13-Apr-2024 02:05                2764
function.trader-minmaxindex.php                    13-Apr-2024 02:05                2815
function.trader-minus-di.php                       13-Apr-2024 02:05                3496
function.trader-minus-dm.php                       13-Apr-2024 02:05                3058
function.trader-mom.php                            13-Apr-2024 02:05                2679
function.trader-mult.php                           13-Apr-2024 02:05                2791
function.trader-natr.php                           13-Apr-2024 02:05                3434
function.trader-obv.php                            13-Apr-2024 02:05                2629
function.trader-plus-di.php                        13-Apr-2024 02:05                3467
function.trader-plus-dm.php                        13-Apr-2024 02:05                3045
function.trader-ppo.php                            13-Apr-2024 02:05                3648
function.trader-roc.php                            13-Apr-2024 02:05                2703
function.trader-rocp.php                           13-Apr-2024 02:05                2731
function.trader-rocr.php                           13-Apr-2024 02:05                2716
function.trader-rocr100.php                        13-Apr-2024 02:05                2756
function.trader-rsi.php                            13-Apr-2024 02:05                2684
function.trader-sar.php                            13-Apr-2024 02:05                3689
function.trader-sarext.php                         13-Apr-2024 02:05                7101
function.trader-set-compat.php                     13-Apr-2024 02:05                2597
function.trader-set-unstable-period.php            13-Apr-2024 02:05                3185
function.trader-sin.php                            13-Apr-2024 02:05                2466
function.trader-sinh.php                           13-Apr-2024 02:05                2454
function.trader-sma.php                            13-Apr-2024 02:05                2684
function.trader-sqrt.php                           13-Apr-2024 02:05                2447
function.trader-stddev.php                         13-Apr-2024 02:05                3028
function.trader-stoch.php                          13-Apr-2024 02:05                5301
function.trader-stochf.php                         13-Apr-2024 02:05                4408
function.trader-stochrsi.php                       13-Apr-2024 02:05                4161
function.trader-sub.php                            13-Apr-2024 02:05                2796
function.trader-sum.php                            13-Apr-2024 02:05                2666
function.trader-t3.php                             13-Apr-2024 02:05                3045
function.trader-tan.php                            13-Apr-2024 02:05                2435
function.trader-tanh.php                           13-Apr-2024 02:05                2459
function.trader-tema.php                           13-Apr-2024 02:05                2710
function.trader-trange.php                         13-Apr-2024 02:05                2956
function.trader-trima.php                          13-Apr-2024 02:05                2712
function.trader-trix.php                           13-Apr-2024 02:05                2722
function.trader-tsf.php                            13-Apr-2024 02:05                2691
function.trader-typprice.php                       13-Apr-2024 02:05                2979
function.trader-ultosc.php                         13-Apr-2024 02:05                4291
function.trader-var.php                            13-Apr-2024 02:05                2998
function.trader-wclprice.php                       13-Apr-2024 02:05                2984
function.trader-willr.php                          13-Apr-2024 02:05                3440
function.trader-wma.php                            13-Apr-2024 02:05                2708
function.trait-exists.php                          13-Apr-2024 02:05                3159
function.trigger-error.php                         13-Apr-2024 02:05                6745
function.trim.php                                  13-Apr-2024 02:05               13950
function.uasort.php                                13-Apr-2024 02:05               10773
function.ucfirst.php                               13-Apr-2024 02:05                6056
function.ucwords.php                               13-Apr-2024 02:05                9926
function.ui-draw-text-font-fontfamilies.php        13-Apr-2024 02:05                2389
function.ui-quit.php                               13-Apr-2024 02:05                2029
function.ui-run.php                                13-Apr-2024 02:05                2390
function.uksort.php                                13-Apr-2024 02:05               10137
function.umask.php                                 13-Apr-2024 02:05                5960
function.uniqid.php                                13-Apr-2024 02:05                8823
function.unixtojd.php                              13-Apr-2024 02:05                4088
function.unlink.php                                13-Apr-2024 02:05                6402
function.unpack.php                                13-Apr-2024 02:05               11109
function.unregister-tick-function.php              13-Apr-2024 02:05                3208
function.unserialize.php                           13-Apr-2024 02:05               19111
function.unset.php                                 13-Apr-2024 02:05               15746
function.untaint.php                               13-Apr-2024 02:05                2543
function.uopz-add-function.php                     13-Apr-2024 02:05                7126
function.uopz-allow-exit.php                       13-Apr-2024 02:05                4586
function.uopz-backup.php                           13-Apr-2024 02:05                4559
function.uopz-compose.php                          13-Apr-2024 02:05                6831
function.uopz-copy.php                             13-Apr-2024 02:05                5146
function.uopz-del-function.php                     13-Apr-2024 02:05                6566
function.uopz-delete.php                           13-Apr-2024 02:05                5988
function.uopz-extend.php                           13-Apr-2024 02:05                5144
function.uopz-flags.php                            13-Apr-2024 02:05               11331
function.uopz-function.php                         13-Apr-2024 02:05                7306
function.uopz-get-exit-status.php                  13-Apr-2024 02:05                4159
function.uopz-get-hook.php                         13-Apr-2024 02:05                5308
function.uopz-get-mock.php                         13-Apr-2024 02:05                4991
function.uopz-get-property.php                     13-Apr-2024 02:05                6171
function.uopz-get-return.php                       13-Apr-2024 02:05                4412
function.uopz-get-static.php                       13-Apr-2024 02:05                5119
function.uopz-implement.php                        13-Apr-2024 02:05                5170
function.uopz-overload.php                         13-Apr-2024 02:05                3912
function.uopz-redefine.php                         13-Apr-2024 02:05                5177
function.uopz-rename.php                           13-Apr-2024 02:05                6761
function.uopz-restore.php                          13-Apr-2024 02:05                4933
function.uopz-set-hook.php                         13-Apr-2024 02:05                5648
function.uopz-set-mock.php                         13-Apr-2024 02:05               11140
function.uopz-set-property.php                     13-Apr-2024 02:05                7465
function.uopz-set-return.php                       13-Apr-2024 02:05                9622
function.uopz-set-static.php                       13-Apr-2024 02:05                5718
function.uopz-undefine.php                         13-Apr-2024 02:05                4692
function.uopz-unset-hook.php                       13-Apr-2024 02:05                5539
function.uopz-unset-mock.php                       13-Apr-2024 02:05                5429
function.uopz-unset-return.php                     13-Apr-2024 02:05                4888
function.urldecode.php                             13-Apr-2024 02:05                6491
function.urlencode.php                             13-Apr-2024 02:05               10067
function.use-soap-error-handler.php                13-Apr-2024 02:05                4171
function.user-error.php                            13-Apr-2024 02:05                1706
function.usleep.php                                13-Apr-2024 02:05                7155
function.usort.php                                 13-Apr-2024 02:05               27659
function.utf8-decode.php                           13-Apr-2024 02:05               19489
function.utf8-encode.php                           13-Apr-2024 02:05               16161
function.var-dump.php                              13-Apr-2024 02:05                7034
function.var-export.php                            13-Apr-2024 02:05               17230
function.var-representation.php                    13-Apr-2024 02:05               13301
function.variant-abs.php                           13-Apr-2024 02:05                4355
function.variant-add.php                           13-Apr-2024 02:05                5724
function.variant-and.php                           13-Apr-2024 02:05                7829
function.variant-cast.php                          13-Apr-2024 02:05                3585
function.variant-cat.php                           13-Apr-2024 02:05                4936
function.variant-cmp.php                           13-Apr-2024 02:05                8461
function.variant-date-from-timestamp.php           13-Apr-2024 02:05                3737
function.variant-date-to-timestamp.php             13-Apr-2024 02:05                3913
function.variant-div.php                           13-Apr-2024 02:05                6675
function.variant-eqv.php                           13-Apr-2024 02:05                4725
function.variant-fix.php                           13-Apr-2024 02:05                5705
function.variant-get-type.php                      13-Apr-2024 02:05                3663
function.variant-idiv.php                          13-Apr-2024 02:05                5976
function.variant-imp.php                           13-Apr-2024 02:05                7351
function.variant-int.php                           13-Apr-2024 02:05                5154
function.variant-mod.php                           13-Apr-2024 02:05                4969
function.variant-mul.php                           13-Apr-2024 02:05                6112
function.variant-neg.php                           13-Apr-2024 02:05                4059
function.variant-not.php                           13-Apr-2024 02:05                4351
function.variant-or.php                            13-Apr-2024 02:05                7963
function.variant-pow.php                           13-Apr-2024 02:05                4794
function.variant-round.php                         13-Apr-2024 02:05                4730
function.variant-set-type.php                      13-Apr-2024 02:05                3670
function.variant-set.php                           13-Apr-2024 02:05                2921
function.variant-sub.php                           13-Apr-2024 02:05                5649
function.variant-xor.php                           13-Apr-2024 02:05                6700
function.version-compare.php                       13-Apr-2024 02:05               12189
function.vfprintf.php                              13-Apr-2024 02:05               22299
function.virtual.php                               13-Apr-2024 02:05                5776
function.vprintf.php                               13-Apr-2024 02:05               21713
function.vsprintf.php                              13-Apr-2024 02:05               21547
function.wddx-add-vars.php                         13-Apr-2024 02:05                3865
function.wddx-deserialize.php                      13-Apr-2024 02:05                3910
function.wddx-packet-end.php                       13-Apr-2024 02:05                2901
function.wddx-packet-start.php                     13-Apr-2024 02:05                3145
function.wddx-serialize-value.php                  13-Apr-2024 02:05                3339
function.wddx-serialize-vars.php                   13-Apr-2024 02:05                6070
function.win32-continue-service.php                13-Apr-2024 02:05                7186
function.win32-create-service.php                  13-Apr-2024 02:05               30438
function.win32-delete-service.php                  13-Apr-2024 02:05                7678
function.win32-get-last-control-message.php        13-Apr-2024 02:05                9219
function.win32-pause-service.php                   13-Apr-2024 02:05                7152
function.win32-query-service-status.php            13-Apr-2024 02:05                9372
function.win32-send-custom-control.php             13-Apr-2024 02:05                7392
function.win32-set-service-exit-code.php           13-Apr-2024 02:05                5852
function.win32-set-service-exit-mode.php           13-Apr-2024 02:05                6000
function.win32-set-service-status.php              13-Apr-2024 02:05               10170
function.win32-start-service-ctrl-dispatcher.php   13-Apr-2024 02:05               12359
function.win32-start-service.php                   13-Apr-2024 02:05                7154
function.win32-stop-service.php                    13-Apr-2024 02:05                7067
function.wincache-fcache-fileinfo.php              13-Apr-2024 02:05                9937
function.wincache-fcache-meminfo.php               13-Apr-2024 02:05                7690
function.wincache-lock.php                         13-Apr-2024 02:05                9233
function.wincache-ocache-fileinfo.php              13-Apr-2024 02:05               10620
function.wincache-ocache-meminfo.php               13-Apr-2024 02:05                7843
function.wincache-refresh-if-changed.php           13-Apr-2024 02:05                8411
function.wincache-rplist-fileinfo.php              13-Apr-2024 02:05                8137
function.wincache-rplist-meminfo.php               13-Apr-2024 02:05                7784
function.wincache-scache-info.php                  13-Apr-2024 02:05               10227
function.wincache-scache-meminfo.php               13-Apr-2024 02:05                7227
function.wincache-ucache-add.php                   13-Apr-2024 02:05               14479
function.wincache-ucache-cas.php                   13-Apr-2024 02:05                6575
function.wincache-ucache-clear.php                 13-Apr-2024 02:05                7891
function.wincache-ucache-dec.php                   13-Apr-2024 02:05                6523
function.wincache-ucache-delete.php                13-Apr-2024 02:05               11744
function.wincache-ucache-exists.php                13-Apr-2024 02:05                6428
function.wincache-ucache-get.php                   13-Apr-2024 02:05               11083
function.wincache-ucache-inc.php                   13-Apr-2024 02:05                6515
function.wincache-ucache-info.php                  13-Apr-2024 02:05               12165
function.wincache-ucache-meminfo.php               13-Apr-2024 02:05                7452
function.wincache-ucache-set.php                   13-Apr-2024 02:05               14403
function.wincache-unlock.php                       13-Apr-2024 02:05                8330
function.wordwrap.php                              13-Apr-2024 02:05                9344
function.xattr-get.php                             13-Apr-2024 02:05                6300
function.xattr-list.php                            13-Apr-2024 02:05                6712
function.xattr-remove.php                          13-Apr-2024 02:05                6516
function.xattr-set.php                             13-Apr-2024 02:05                8348
function.xattr-supported.php                       13-Apr-2024 02:05                5623
function.xdiff-file-bdiff-size.php                 13-Apr-2024 02:05                4993
function.xdiff-file-bdiff.php                      13-Apr-2024 02:05                6361
function.xdiff-file-bpatch.php                     13-Apr-2024 02:05                6885
function.xdiff-file-diff-binary.php                13-Apr-2024 02:05                6820
function.xdiff-file-diff.php                       13-Apr-2024 02:05                7660
function.xdiff-file-merge3.php                     13-Apr-2024 02:05                6978
function.xdiff-file-patch-binary.php               13-Apr-2024 02:05                6995
function.xdiff-file-patch.php                      13-Apr-2024 02:05                9335
function.xdiff-file-rabdiff.php                    13-Apr-2024 02:05                6970
function.xdiff-string-bdiff-size.php               13-Apr-2024 02:05                5284
function.xdiff-string-bdiff.php                    13-Apr-2024 02:05                4084
function.xdiff-string-bpatch.php                   13-Apr-2024 02:05                4150
function.xdiff-string-diff-binary.php              13-Apr-2024 02:05                4614
function.xdiff-string-diff.php                     13-Apr-2024 02:05                7924
function.xdiff-string-merge3.php                   13-Apr-2024 02:05                4975
function.xdiff-string-patch-binary.php             13-Apr-2024 02:05                4726
function.xdiff-string-patch.php                    13-Apr-2024 02:05                8697
function.xdiff-string-rabdiff.php                  13-Apr-2024 02:05                4745
function.xhprof-disable.php                        13-Apr-2024 02:05                3961
function.xhprof-enable.php                         13-Apr-2024 02:05                7277
function.xhprof-sample-disable.php                 13-Apr-2024 02:05                4643
function.xhprof-sample-enable.php                  13-Apr-2024 02:05                3627
function.xml-error-string.php                      13-Apr-2024 02:05                3389
function.xml-get-current-byte-index.php            13-Apr-2024 02:05                4724
function.xml-get-current-column-number.php         13-Apr-2024 02:05                4418
function.xml-get-current-line-number.php           13-Apr-2024 02:05                4236
function.xml-get-error-code.php                    13-Apr-2024 02:05                3893
function.xml-parse-into-struct.php                 13-Apr-2024 02:05               19922
function.xml-parse.php                             13-Apr-2024 02:05                8898
function.xml-parser-create-ns.php                  13-Apr-2024 02:05                5683
function.xml-parser-create.php                     13-Apr-2024 02:05                5232
function.xml-parser-free.php                       13-Apr-2024 02:05                4395
function.xml-parser-get-option.php                 13-Apr-2024 02:05                6278
function.xml-parser-set-option.php                 13-Apr-2024 02:05                8532
function.xml-set-character-data-handler.php        13-Apr-2024 02:05                5951
function.xml-set-default-handler.php               13-Apr-2024 02:05                5843
function.xml-set-element-handler.php               13-Apr-2024 02:05                9293
function.xml-set-end-namespace-decl-handler.php    13-Apr-2024 02:05                6811
function.xml-set-external-entity-ref-handler.php   13-Apr-2024 02:05                9846
function.xml-set-notation-decl-handler.php         13-Apr-2024 02:05                7932
function.xml-set-object.php                        13-Apr-2024 02:05                9419
function.xml-set-processing-instruction-handler..> 13-Apr-2024 02:05                6953
function.xml-set-start-namespace-decl-handler.php  13-Apr-2024 02:05                7079
function.xml-set-unparsed-entity-decl-handler.php  13-Apr-2024 02:05                8895
function.xmlrpc-decode-request.php                 13-Apr-2024 02:05                2910
function.xmlrpc-decode.php                         13-Apr-2024 02:05                4246
function.xmlrpc-encode-request.php                 13-Apr-2024 02:05                8739
function.xmlrpc-encode.php                         13-Apr-2024 02:05                2486
function.xmlrpc-get-type.php                       13-Apr-2024 02:05                6379
function.xmlrpc-is-fault.php                       13-Apr-2024 02:05                4030
function.xmlrpc-parse-method-descriptions.php      13-Apr-2024 02:05                2685
function.xmlrpc-server-add-introspection-data.php  13-Apr-2024 02:05                2883
function.xmlrpc-server-call-method.php             13-Apr-2024 02:05                3307
function.xmlrpc-server-create.php                  13-Apr-2024 02:05                2400
function.xmlrpc-server-destroy.php                 13-Apr-2024 02:05                2612
function.xmlrpc-server-register-introspection-c..> 13-Apr-2024 02:05                2962
function.xmlrpc-server-register-method.php         13-Apr-2024 02:05                3049
function.xmlrpc-set-type.php                       13-Apr-2024 02:05                5695
function.yaml-emit-file.php                        13-Apr-2024 02:05                6693
function.yaml-emit.php                             13-Apr-2024 02:05               12192
function.yaml-parse-file.php                       13-Apr-2024 02:05                6263
function.yaml-parse-url.php                        13-Apr-2024 02:05                6589
function.yaml-parse.php                            13-Apr-2024 02:05               10031
function.yaz-addinfo.php                           13-Apr-2024 02:05                3468
function.yaz-ccl-conf.php                          13-Apr-2024 02:05                5825
function.yaz-ccl-parse.php                         13-Apr-2024 02:05                6901
function.yaz-close.php                             13-Apr-2024 02:05                3584
function.yaz-connect.php                           13-Apr-2024 02:05                9963
function.yaz-database.php                          13-Apr-2024 02:05                3484
function.yaz-element.php                           13-Apr-2024 02:05                4037
function.yaz-errno.php                             13-Apr-2024 02:05                3766
function.yaz-error.php                             13-Apr-2024 02:05                3403
function.yaz-es-result.php                         13-Apr-2024 02:05                3360
function.yaz-es.php                                13-Apr-2024 02:05                7453
function.yaz-get-option.php                        13-Apr-2024 02:05                3479
function.yaz-hits.php                              13-Apr-2024 02:05                5222
function.yaz-itemorder.php                         13-Apr-2024 02:05                7231
function.yaz-present.php                           13-Apr-2024 02:05                3080
function.yaz-range.php                             13-Apr-2024 02:05                3656
function.yaz-record.php                            13-Apr-2024 02:05               15552
function.yaz-scan-result.php                       13-Apr-2024 02:05                4091
function.yaz-scan.php                              13-Apr-2024 02:05                9583
function.yaz-schema.php                            13-Apr-2024 02:05                3534
function.yaz-search.php                            13-Apr-2024 02:05                9339
function.yaz-set-option.php                        13-Apr-2024 02:05                7476
function.yaz-sort.php                              13-Apr-2024 02:05                5749
function.yaz-syntax.php                            13-Apr-2024 02:05                3451
function.yaz-wait.php                              13-Apr-2024 02:05                4386
function.zend-thread-id.php                        13-Apr-2024 02:05                3813
function.zend-version.php                          13-Apr-2024 02:05                3955
function.zip-close.php                             13-Apr-2024 02:05                4074
function.zip-entry-close.php                       13-Apr-2024 02:05                4349
function.zip-entry-compressedsize.php              13-Apr-2024 02:05                4647
function.zip-entry-compressionmethod.php           13-Apr-2024 02:05                4729
function.zip-entry-filesize.php                    13-Apr-2024 02:05                4603
function.zip-entry-name.php                        13-Apr-2024 02:05                4513
function.zip-entry-open.php                        13-Apr-2024 02:05                6112
function.zip-entry-read.php                        13-Apr-2024 02:05                5341
function.zip-open.php                              13-Apr-2024 02:05                4717
function.zip-read.php                              13-Apr-2024 02:05                4956
function.zlib-decode.php                           13-Apr-2024 02:05                3540
function.zlib-encode.php                           13-Apr-2024 02:05                5451
function.zlib-get-coding-type.php                  13-Apr-2024 02:05                2927
function.zookeeper-dispatch.php                    13-Apr-2024 02:05                8271
functional.parallel.php                            13-Apr-2024 02:05                2540
functions.anonymous.php                            13-Apr-2024 02:05               24610
functions.arguments.php                            13-Apr-2024 02:05               43795
functions.arrow.php                                13-Apr-2024 02:05               10315
functions.first_class_callable_syntax.php          13-Apr-2024 02:05               11666
functions.internal.php                             13-Apr-2024 02:05                8583
functions.returning-values.php                     13-Apr-2024 02:05                6326
functions.user-defined.php                         13-Apr-2024 02:05                9964
functions.variable-functions.php                   13-Apr-2024 02:05               11529
gearman.configuration.php                          13-Apr-2024 02:05                1190
gearman.constants.php                              13-Apr-2024 02:05               23844
gearman.examples-reverse-bg.php                    13-Apr-2024 02:05               10666
gearman.examples-reverse-task.php                  13-Apr-2024 02:05               17315
gearman.examples-reverse.php                       13-Apr-2024 02:05               12736
gearman.examples.php                               13-Apr-2024 02:05                1532
gearman.installation.php                           13-Apr-2024 02:05                1653
gearman.requirements.php                           13-Apr-2024 02:05                1477
gearman.resources.php                              13-Apr-2024 02:05                1195
gearman.setup.php                                  13-Apr-2024 02:05                1553
gearmanclient.addoptions.php                       13-Apr-2024 02:05                3305
gearmanclient.addserver.php                        13-Apr-2024 02:05                5466
gearmanclient.addservers.php                       13-Apr-2024 02:05                4882
gearmanclient.addtask.php                          13-Apr-2024 02:05               15155
gearmanclient.addtaskbackground.php                13-Apr-2024 02:05               20887
gearmanclient.addtaskhigh.php                      13-Apr-2024 02:05               11651
gearmanclient.addtaskhighbackground.php            13-Apr-2024 02:05                6558
gearmanclient.addtasklow.php                       13-Apr-2024 02:05               11633
gearmanclient.addtasklowbackground.php             13-Apr-2024 02:05                6551
gearmanclient.addtaskstatus.php                    13-Apr-2024 02:05                9782
gearmanclient.clearcallbacks.php                   13-Apr-2024 02:05                4331
gearmanclient.clone.php                            13-Apr-2024 02:05                2634
gearmanclient.construct.php                        13-Apr-2024 02:05                2805
gearmanclient.context.php                          13-Apr-2024 02:05                2873
gearmanclient.data.php                             13-Apr-2024 02:05                3140
gearmanclient.do.php                               13-Apr-2024 02:05               22153
gearmanclient.dobackground.php                     13-Apr-2024 02:05                9631
gearmanclient.dohigh.php                           13-Apr-2024 02:05                5081
gearmanclient.dohighbackground.php                 13-Apr-2024 02:05                4908
gearmanclient.dojobhandle.php                      13-Apr-2024 02:05                2930
gearmanclient.dolow.php                            13-Apr-2024 02:05                5067
gearmanclient.dolowbackground.php                  13-Apr-2024 02:05                4890
gearmanclient.donormal.php                         13-Apr-2024 02:05               22721
gearmanclient.dostatus.php                         13-Apr-2024 02:05                8115
gearmanclient.echo.php                             13-Apr-2024 02:05                2974
gearmanclient.error.php                            13-Apr-2024 02:05                2865
gearmanclient.geterrno.php                         13-Apr-2024 02:05                2640
gearmanclient.jobstatus.php                        13-Apr-2024 02:05                8304
gearmanclient.ping.php                             13-Apr-2024 02:05                2947
gearmanclient.removeoptions.php                    13-Apr-2024 02:05                2653
gearmanclient.returncode.php                       13-Apr-2024 02:05                2290
gearmanclient.runtasks.php                         13-Apr-2024 02:05                3713
gearmanclient.setclientcallback.php                13-Apr-2024 02:05                5345
gearmanclient.setcompletecallback.php              13-Apr-2024 02:05                5229
gearmanclient.setcontext.php                       13-Apr-2024 02:05                3191
gearmanclient.setcreatedcallback.php               13-Apr-2024 02:05                4768
gearmanclient.setdata.php                          13-Apr-2024 02:05                3391
gearmanclient.setdatacallback.php                  13-Apr-2024 02:05                4753
gearmanclient.setexceptioncallback.php             13-Apr-2024 02:05                4673
gearmanclient.setfailcallback.php                  13-Apr-2024 02:05                4759
gearmanclient.setoptions.php                       13-Apr-2024 02:05                2639
gearmanclient.setstatuscallback.php                13-Apr-2024 02:05                4759
gearmanclient.settimeout.php                       13-Apr-2024 02:05                2683
gearmanclient.setwarningcallback.php               13-Apr-2024 02:05                4762
gearmanclient.setworkloadcallback.php              13-Apr-2024 02:05                4916
gearmanclient.timeout.php                          13-Apr-2024 02:05                2735
gearmanclient.wait.php                             13-Apr-2024 02:05                2782
gearmanjob.complete.php                            13-Apr-2024 02:05                3568
gearmanjob.construct.php                           13-Apr-2024 02:05                2324
gearmanjob.data.php                                13-Apr-2024 02:05                3528
gearmanjob.exception.php                           13-Apr-2024 02:05                3735
gearmanjob.fail.php                                13-Apr-2024 02:05                3676
gearmanjob.functionname.php                        13-Apr-2024 02:05                2911
gearmanjob.handle.php                              13-Apr-2024 02:05                2798
gearmanjob.returncode.php                          13-Apr-2024 02:05                2595
gearmanjob.sendcomplete.php                        13-Apr-2024 02:05                3287
gearmanjob.senddata.php                            13-Apr-2024 02:05                3254
gearmanjob.sendexception.php                       13-Apr-2024 02:05                3467
gearmanjob.sendfail.php                            13-Apr-2024 02:05                3393
gearmanjob.sendstatus.php                          13-Apr-2024 02:05                3982
gearmanjob.sendwarning.php                         13-Apr-2024 02:05                3463
gearmanjob.setreturn.php                           13-Apr-2024 02:05                2525
gearmanjob.status.php                              13-Apr-2024 02:05                4265
gearmanjob.unique.php                              13-Apr-2024 02:05                3035
gearmanjob.warning.php                             13-Apr-2024 02:05                3746
gearmanjob.workload.php                            13-Apr-2024 02:05                2793
gearmanjob.workloadsize.php                        13-Apr-2024 02:05                2611
gearmantask.construct.php                          13-Apr-2024 02:05                2349
gearmantask.create.php                             13-Apr-2024 02:05                2798
gearmantask.data.php                               13-Apr-2024 02:05                2772
gearmantask.datasize.php                           13-Apr-2024 02:05                2795
gearmantask.function.php                           13-Apr-2024 02:05                2636
gearmantask.functionname.php                       13-Apr-2024 02:05                2571
gearmantask.isknown.php                            13-Apr-2024 02:05                2447
gearmantask.isrunning.php                          13-Apr-2024 02:05                2447
gearmantask.jobhandle.php                          13-Apr-2024 02:05                2944
gearmantask.recvdata.php                           13-Apr-2024 02:05                3549
gearmantask.returncode.php                         13-Apr-2024 02:05                2622
gearmantask.senddata.php                           13-Apr-2024 02:05                3362
gearmantask.sendworkload.php                       13-Apr-2024 02:05                3511
gearmantask.taskdenominator.php                    13-Apr-2024 02:05                2988
gearmantask.tasknumerator.php                      13-Apr-2024 02:05                2960
gearmantask.unique.php                             13-Apr-2024 02:05                3205
gearmantask.uuid.php                               13-Apr-2024 02:05                3380
gearmanworker.addfunction.php                      13-Apr-2024 02:05                7868
gearmanworker.addoptions.php                       13-Apr-2024 02:05                3359
gearmanworker.addserver.php                        13-Apr-2024 02:05                5193
gearmanworker.addservers.php                       13-Apr-2024 02:05                4604
gearmanworker.clone.php                            13-Apr-2024 02:05                2305
gearmanworker.construct.php                        13-Apr-2024 02:05                2778
gearmanworker.echo.php                             13-Apr-2024 02:05                2985
gearmanworker.error.php                            13-Apr-2024 02:05                2832
gearmanworker.geterrno.php                         13-Apr-2024 02:05                2607
gearmanworker.options.php                          13-Apr-2024 02:05                2614
gearmanworker.register.php                         13-Apr-2024 02:05                3742
gearmanworker.removeoptions.php                    13-Apr-2024 02:05                3381
gearmanworker.returncode.php                       13-Apr-2024 02:05                2802
gearmanworker.setid.php                            13-Apr-2024 02:05                4081
gearmanworker.setoptions.php                       13-Apr-2024 02:05                3514
gearmanworker.settimeout.php                       13-Apr-2024 02:05                7750
gearmanworker.timeout.php                          13-Apr-2024 02:05                2714
gearmanworker.unregister.php                       13-Apr-2024 02:05                3306
gearmanworker.unregisterall.php                    13-Apr-2024 02:05                2978
gearmanworker.wait.php                             13-Apr-2024 02:05                7861
gearmanworker.work.php                             13-Apr-2024 02:05                5563
gender-gender.connect.php                          13-Apr-2024 02:05                2620
gender-gender.construct.php                        13-Apr-2024 02:05                2510
gender-gender.country.php                          13-Apr-2024 02:05                3800
gender-gender.get.php                              13-Apr-2024 02:05                2879
gender-gender.isnick.php                           13-Apr-2024 02:05                3527
gender-gender.similarnames.php                     13-Apr-2024 02:05                3001
gender.example.admin.php                           13-Apr-2024 02:05                8183
gender.examples.php                                13-Apr-2024 02:05                1313
gender.installation.php                            13-Apr-2024 02:05                2106
gender.setup.php                                   13-Apr-2024 02:05                1365
generator.current.php                              13-Apr-2024 02:05                2106
generator.getreturn.php                            13-Apr-2024 02:05                3832
generator.key.php                                  13-Apr-2024 02:05                3917
generator.next.php                                 13-Apr-2024 02:05                2463
generator.rewind.php                               13-Apr-2024 02:05                2194
generator.send.php                                 13-Apr-2024 02:05                5540
generator.throw.php                                13-Apr-2024 02:05                5145
generator.valid.php                                13-Apr-2024 02:05                2367
generator.wakeup.php                               13-Apr-2024 02:05                2218
geoip.configuration.php                            13-Apr-2024 02:05                2507
geoip.constants.php                                13-Apr-2024 02:05                6323
geoip.installation.php                             13-Apr-2024 02:05                1817
geoip.requirements.php                             13-Apr-2024 02:05                1928
geoip.resources.php                                13-Apr-2024 02:05                1151
geoip.setup.php                                    13-Apr-2024 02:05                1514
gettext.configuration.php                          13-Apr-2024 02:05                1190
gettext.constants.php                              13-Apr-2024 02:05                1118
gettext.installation.php                           13-Apr-2024 02:05                1468
gettext.requirements.php                           13-Apr-2024 02:05                1421
gettext.resources.php                              13-Apr-2024 02:05                1165
gettext.setup.php                                  13-Apr-2024 02:05                1558
getting-started.php                                13-Apr-2024 02:05                1950
globiterator.construct.php                         13-Apr-2024 02:05                7911
globiterator.count.php                             13-Apr-2024 02:05                4532
gmagick.addimage.php                               13-Apr-2024 02:05                2978
gmagick.addnoiseimage.php                          13-Apr-2024 02:05                2989
gmagick.annotateimage.php                          13-Apr-2024 02:05                4572
gmagick.blurimage.php                              13-Apr-2024 02:05                3390
gmagick.borderimage.php                            13-Apr-2024 02:05                3815
gmagick.charcoalimage.php                          13-Apr-2024 02:05                3299
gmagick.chopimage.php                              13-Apr-2024 02:05                3945
gmagick.clear.php                                  13-Apr-2024 02:05                2728
gmagick.commentimage.php                           13-Apr-2024 02:05                2903
gmagick.compositeimage.php                         13-Apr-2024 02:05                4122
gmagick.configuration.php                          13-Apr-2024 02:05                1193
gmagick.constants.php                              13-Apr-2024 02:05              103147
gmagick.construct.php                              13-Apr-2024 02:05                2660
gmagick.cropimage.php                              13-Apr-2024 02:05                4017
gmagick.cropthumbnailimage.php                     13-Apr-2024 02:05                3388
gmagick.current.php                                13-Apr-2024 02:05                2605
gmagick.cyclecolormapimage.php                     13-Apr-2024 02:05                3038
gmagick.deconstructimages.php                      13-Apr-2024 02:05                2756
gmagick.despeckleimage.php                         13-Apr-2024 02:05                3550
gmagick.destroy.php                                13-Apr-2024 02:05                2808
gmagick.drawimage.php                              13-Apr-2024 02:05                3057
gmagick.edgeimage.php                              13-Apr-2024 02:05                2970
gmagick.embossimage.php                            13-Apr-2024 02:05                3562
gmagick.enhanceimage.php                           13-Apr-2024 02:05                2694
gmagick.equalizeimage.php                          13-Apr-2024 02:05                2635
gmagick.examples.php                               13-Apr-2024 02:05                3500
gmagick.flipimage.php                              13-Apr-2024 02:05                2999
gmagick.flopimage.php                              13-Apr-2024 02:05                2993
gmagick.frameimage.php                             13-Apr-2024 02:05                4625
gmagick.gammaimage.php                             13-Apr-2024 02:05                3312
gmagick.getcopyright.php                           13-Apr-2024 02:05                2620
gmagick.getfilename.php                            13-Apr-2024 02:05                2620
gmagick.getimagebackgroundcolor.php                13-Apr-2024 02:05                2676
gmagick.getimageblueprimary.php                    13-Apr-2024 02:05                2944
gmagick.getimagebordercolor.php                    13-Apr-2024 02:05                2748
gmagick.getimagechanneldepth.php                   13-Apr-2024 02:05                2816
gmagick.getimagecolors.php                         13-Apr-2024 02:05                2613
gmagick.getimagecolorspace.php                     13-Apr-2024 02:05                2577
gmagick.getimagecompose.php                        13-Apr-2024 02:05                2619
gmagick.getimagedelay.php                          13-Apr-2024 02:05                2518
gmagick.getimagedepth.php                          13-Apr-2024 02:05                2519
gmagick.getimagedispose.php                        13-Apr-2024 02:05                2558
gmagick.getimageextrema.php                        13-Apr-2024 02:05                2716
gmagick.getimagefilename.php                       13-Apr-2024 02:05                2653
gmagick.getimageformat.php                         13-Apr-2024 02:05                2661
gmagick.getimagegamma.php                          13-Apr-2024 02:05                2552
gmagick.getimagegreenprimary.php                   13-Apr-2024 02:05                2763
gmagick.getimageheight.php                         13-Apr-2024 02:05                2561
gmagick.getimagehistogram.php                      13-Apr-2024 02:05                3005
gmagick.getimageindex.php                          13-Apr-2024 02:05                2768
gmagick.getimageinterlacescheme.php                13-Apr-2024 02:05                2723
gmagick.getimageiterations.php                     13-Apr-2024 02:05                2607
gmagick.getimagematte.php                          13-Apr-2024 02:05                3074
gmagick.getimagemattecolor.php                     13-Apr-2024 02:05                2717
gmagick.getimageprofile.php                        13-Apr-2024 02:05                2806
gmagick.getimageredprimary.php                     13-Apr-2024 02:05                2767
gmagick.getimagerenderingintent.php                13-Apr-2024 02:05                2700
gmagick.getimageresolution.php                     13-Apr-2024 02:05                2629
gmagick.getimagescene.php                          13-Apr-2024 02:05                2546
gmagick.getimagesignature.php                      13-Apr-2024 02:05                2689
gmagick.getimagetype.php                           13-Apr-2024 02:05                2507
gmagick.getimageunits.php                          13-Apr-2024 02:05                2283
gmagick.getimagewhitepoint.php                     13-Apr-2024 02:05                2763
gmagick.getimagewidth.php                          13-Apr-2024 02:05                2512
gmagick.getpackagename.php                         13-Apr-2024 02:05                2596
gmagick.getquantumdepth.php                        13-Apr-2024 02:05                2740
gmagick.getreleasedate.php                         13-Apr-2024 02:05                2612
gmagick.getsamplingfactors.php                     13-Apr-2024 02:05                2731
gmagick.getsize.php                                13-Apr-2024 02:05                2891
gmagick.getversion.php                             13-Apr-2024 02:05                2573
gmagick.hasnextimage.php                           13-Apr-2024 02:05                3020
gmagick.haspreviousimage.php                       13-Apr-2024 02:05                3072
gmagick.implodeimage.php                           13-Apr-2024 02:05                3043
gmagick.installation.php                           13-Apr-2024 02:05                2058
gmagick.labelimage.php                             13-Apr-2024 02:05                2798
gmagick.levelimage.php                             13-Apr-2024 02:05                4840
gmagick.magnifyimage.php                           13-Apr-2024 02:05                2622
gmagick.mapimage.php                               13-Apr-2024 02:05                3293
gmagick.medianfilterimage.php                      13-Apr-2024 02:05                3132
gmagick.minifyimage.php                            13-Apr-2024 02:05                2639
gmagick.modulateimage.php                          13-Apr-2024 02:05                3892
gmagick.motionblurimage.php                        13-Apr-2024 02:05                4154
gmagick.newimage.php                               13-Apr-2024 02:05                3975
gmagick.nextimage.php                              13-Apr-2024 02:05                2801
gmagick.normalizeimage.php                         13-Apr-2024 02:05                3060
gmagick.oilpaintimage.php                          13-Apr-2024 02:05                3056
gmagick.previousimage.php                          13-Apr-2024 02:05                2800
gmagick.profileimage.php                           13-Apr-2024 02:05                3780
gmagick.quantizeimage.php                          13-Apr-2024 02:05                5536
gmagick.quantizeimages.php                         13-Apr-2024 02:05                5571
gmagick.queryfontmetrics.php                       13-Apr-2024 02:05                2999
gmagick.queryfonts.php                             13-Apr-2024 02:05                2749
gmagick.queryformats.php                           13-Apr-2024 02:05                3105
gmagick.radialblurimage.php                        13-Apr-2024 02:05                3295
gmagick.raiseimage.php                             13-Apr-2024 02:05                4540
gmagick.read.php                                   13-Apr-2024 02:05                2796
gmagick.readimage.php                              13-Apr-2024 02:05                2846
gmagick.readimageblob.php                          13-Apr-2024 02:05                3278
gmagick.readimagefile.php                          13-Apr-2024 02:05                3197
gmagick.reducenoiseimage.php                       13-Apr-2024 02:05                3285
gmagick.removeimage.php                            13-Apr-2024 02:05                2622
gmagick.removeimageprofile.php                     13-Apr-2024 02:05                2995
gmagick.requirements.php                           13-Apr-2024 02:05                1772
gmagick.resampleimage.php                          13-Apr-2024 02:05                4066
gmagick.resizeimage.php                            13-Apr-2024 02:05                4305
gmagick.rollimage.php                              13-Apr-2024 02:05                3066
gmagick.rotateimage.php                            13-Apr-2024 02:05                3191
gmagick.scaleimage.php                             13-Apr-2024 02:05                3583
gmagick.separateimagechannel.php                   13-Apr-2024 02:05                3283
gmagick.setcompressionquality.php                  13-Apr-2024 02:05                4257
gmagick.setfilename.php                            13-Apr-2024 02:05                2966
gmagick.setimagebackgroundcolor.php                13-Apr-2024 02:05                3011
gmagick.setimageblueprimary.php                    13-Apr-2024 02:05                3308
gmagick.setimagebordercolor.php                    13-Apr-2024 02:05                2992
gmagick.setimagechanneldepth.php                   13-Apr-2024 02:05                3495
gmagick.setimagecolorspace.php                     13-Apr-2024 02:05                3124
gmagick.setimagecompose.php                        13-Apr-2024 02:05                2884
gmagick.setimagedelay.php                          13-Apr-2024 02:05                2911
gmagick.setimagedepth.php                          13-Apr-2024 02:05                2911
gmagick.setimagedispose.php                        13-Apr-2024 02:05                2929
gmagick.setimagefilename.php                       13-Apr-2024 02:05                3004
gmagick.setimageformat.php                         13-Apr-2024 02:05                2978
gmagick.setimagegamma.php                          13-Apr-2024 02:05                2898
gmagick.setimagegreenprimary.php                   13-Apr-2024 02:05                3286
gmagick.setimageindex.php                          13-Apr-2024 02:05                3067
gmagick.setimageinterlacescheme.php                13-Apr-2024 02:05                3214
gmagick.setimageiterations.php                     13-Apr-2024 02:05                2996
gmagick.setimageprofile.php                        13-Apr-2024 02:05                3605
gmagick.setimageredprimary.php                     13-Apr-2024 02:05                3234
gmagick.setimagerenderingintent.php                13-Apr-2024 02:05                3251
gmagick.setimageresolution.php                     13-Apr-2024 02:05                3238
gmagick.setimagescene.php                          13-Apr-2024 02:05                2893
gmagick.setimagetype.php                           13-Apr-2024 02:05                3026
gmagick.setimageunits.php                          13-Apr-2024 02:05                3208
gmagick.setimagewhitepoint.php                     13-Apr-2024 02:05                3261
gmagick.setsamplingfactors.php                     13-Apr-2024 02:05                3132
gmagick.setsize.php                                13-Apr-2024 02:05                3671
gmagick.setup.php                                  13-Apr-2024 02:05                1479
gmagick.shearimage.php                             13-Apr-2024 02:05                4013
gmagick.solarizeimage.php                          13-Apr-2024 02:05                3148
gmagick.spreadimage.php                            13-Apr-2024 02:05                3017
gmagick.stripimage.php                             13-Apr-2024 02:05                2639
gmagick.swirlimage.php                             13-Apr-2024 02:05                3070
gmagick.thumbnailimage.php                         13-Apr-2024 02:05                3981
gmagick.trimimage.php                              13-Apr-2024 02:05                3206
gmagick.write.php                                  13-Apr-2024 02:05                1732
gmagick.writeimage.php                             13-Apr-2024 02:05                3574
gmagickdraw.annotate.php                           13-Apr-2024 02:05                3267
gmagickdraw.arc.php                                13-Apr-2024 02:05                4294
gmagickdraw.bezier.php                             13-Apr-2024 02:05                2632
gmagickdraw.ellipse.php                            13-Apr-2024 02:05                4264
gmagickdraw.getfillcolor.php                       13-Apr-2024 02:05                2475
gmagickdraw.getfillopacity.php                     13-Apr-2024 02:05                2417
gmagickdraw.getfont.php                            13-Apr-2024 02:05                2460
gmagickdraw.getfontsize.php                        13-Apr-2024 02:05                2501
gmagickdraw.getfontstyle.php                       13-Apr-2024 02:05                2618
gmagickdraw.getfontweight.php                      13-Apr-2024 02:05                2450
gmagickdraw.getstrokecolor.php                     13-Apr-2024 02:05                2504
gmagickdraw.getstrokeopacity.php                   13-Apr-2024 02:05                2490
gmagickdraw.getstrokewidth.php                     13-Apr-2024 02:05                2494
gmagickdraw.gettextdecoration.php                  13-Apr-2024 02:05                2513
gmagickdraw.gettextencoding.php                    13-Apr-2024 02:05                2611
gmagickdraw.line.php                               13-Apr-2024 02:05                3659
gmagickdraw.point.php                              13-Apr-2024 02:05                2894
gmagickdraw.polygon.php                            13-Apr-2024 02:05                2723
gmagickdraw.polyline.php                           13-Apr-2024 02:05                2760
gmagickdraw.rectangle.php                          13-Apr-2024 02:05                3715
gmagickdraw.rotate.php                             13-Apr-2024 02:05                2671
gmagickdraw.roundrectangle.php                     13-Apr-2024 02:05                4505
gmagickdraw.scale.php                              13-Apr-2024 02:05                2951
gmagickdraw.setfillcolor.php                       13-Apr-2024 02:05                2909
gmagickdraw.setfillopacity.php                     13-Apr-2024 02:05                2850
gmagickdraw.setfont.php                            13-Apr-2024 02:05                2744
gmagickdraw.setfontsize.php                        13-Apr-2024 02:05                2794
gmagickdraw.setfontstyle.php                       13-Apr-2024 02:05                2941
gmagickdraw.setfontweight.php                      13-Apr-2024 02:05                2791
gmagickdraw.setstrokecolor.php                     13-Apr-2024 02:05                2934
gmagickdraw.setstrokeopacity.php                   13-Apr-2024 02:05                2831
gmagickdraw.setstrokewidth.php                     13-Apr-2024 02:05                2781
gmagickdraw.settextdecoration.php                  13-Apr-2024 02:05                2925
gmagickdraw.settextencoding.php                    13-Apr-2024 02:05                3237
gmagickpixel.construct.php                         13-Apr-2024 02:05                2596
gmagickpixel.getcolor.php                          13-Apr-2024 02:05                3933
gmagickpixel.getcolorcount.php                     13-Apr-2024 02:05                2519
gmagickpixel.getcolorvalue.php                     13-Apr-2024 02:05                2935
gmagickpixel.setcolor.php                          13-Apr-2024 02:05                3016
gmagickpixel.setcolorvalue.php                     13-Apr-2024 02:05                3358
gmp.configuration.php                              13-Apr-2024 02:05                1165
gmp.constants.php                                  13-Apr-2024 02:05                4169
gmp.construct.php                                  13-Apr-2024 02:05                4050
gmp.examples.php                                   13-Apr-2024 02:05                3016
gmp.installation.php                               13-Apr-2024 02:05                1397
gmp.requirements.php                               13-Apr-2024 02:05                1840
gmp.serialize.php                                  13-Apr-2024 02:05                2306
gmp.setup.php                                      13-Apr-2024 02:05                1442
gmp.unserialize.php                                13-Apr-2024 02:05                2593
gnupg.configuration.php                            13-Apr-2024 02:05                1174
gnupg.constants.php                                13-Apr-2024 02:05                9344
gnupg.examples-clearsign.php                       13-Apr-2024 02:05                6592
gnupg.examples.php                                 13-Apr-2024 02:05                1334
gnupg.installation.php                             13-Apr-2024 02:05                1634
gnupg.requirements.php                             13-Apr-2024 02:05                1269
gnupg.resources.php                                13-Apr-2024 02:05                1151
gnupg.setup.php                                    13-Apr-2024 02:05                1533
hash.configuration.php                             13-Apr-2024 02:05                1169
hash.constants.php                                 13-Apr-2024 02:05                1875
hash.installation.php                              13-Apr-2024 02:05                1777
hash.requirements.php                              13-Apr-2024 02:05                1187
hash.resources.php                                 13-Apr-2024 02:05                1341
hash.setup.php                                     13-Apr-2024 02:05                1512
hashcontext.construct.php                          13-Apr-2024 02:05                1934
hashcontext.serialize.php                          13-Apr-2024 02:05                2435
hashcontext.unserialize.php                        13-Apr-2024 02:05                2703
history.php                                        13-Apr-2024 02:05                2360
history.php.books.php                              13-Apr-2024 02:05                3077
history.php.php                                    13-Apr-2024 02:05               13292
history.php.publications.php                       13-Apr-2024 02:05                1898
history.php.related.php                            13-Apr-2024 02:05                7379
hrtime-performancecounter.getfrequency.php         13-Apr-2024 02:05                2723
hrtime-performancecounter.getticks.php             13-Apr-2024 02:05                2596
hrtime-performancecounter.gettickssince.php        13-Apr-2024 02:05                2885
hrtime-stopwatch.getelapsedticks.php               13-Apr-2024 02:05                2498
hrtime-stopwatch.getelapsedtime.php                13-Apr-2024 02:05                2880
hrtime-stopwatch.getlastelapsedticks.php           13-Apr-2024 02:05                2566
hrtime-stopwatch.getlastelapsedtime.php            13-Apr-2024 02:05                2904
hrtime-stopwatch.isrunning.php                     13-Apr-2024 02:05                2459
hrtime-stopwatch.start.php                         13-Apr-2024 02:05                2360
hrtime-stopwatch.stop.php                          13-Apr-2024 02:05                2239
hrtime.example.basic.php                           13-Apr-2024 02:05                5403
hrtime.examples.php                                13-Apr-2024 02:05                1317
hrtime.installation.php                            13-Apr-2024 02:05                2083
hrtime.setup.php                                   13-Apr-2024 02:05                1362
ibase.configuration.php                            13-Apr-2024 02:05                8205
ibase.constants.php                                13-Apr-2024 02:05               22403
ibase.installation.php                             13-Apr-2024 02:05                3993
ibase.requirements.php                             13-Apr-2024 02:05                1150
ibase.resources.php                                13-Apr-2024 02:05                1151
ibase.setup.php                                    13-Apr-2024 02:05                1553
ibm-db2.configuration.php                          13-Apr-2024 02:05               22769
ibm-db2.constants.php                              13-Apr-2024 02:05                9369
ibm-db2.installation.php                           13-Apr-2024 02:05                4152
ibm-db2.requirements.php                           13-Apr-2024 02:05                3622
ibm-db2.resources.php                              13-Apr-2024 02:05                1271
ibm-db2.setup.php                                  13-Apr-2024 02:05                1563
iconv.configuration.php                            13-Apr-2024 02:05                5063
iconv.constants.php                                13-Apr-2024 02:05                3686
iconv.installation.php                             13-Apr-2024 02:05                1649
iconv.requirements.php                             13-Apr-2024 02:05                1576
iconv.resources.php                                13-Apr-2024 02:05                1151
iconv.setup.php                                    13-Apr-2024 02:05                1540
igbinary.configuration.php                         13-Apr-2024 02:05                3571
igbinary.installation.php                          13-Apr-2024 02:05                2114
igbinary.requirements.php                          13-Apr-2024 02:05                1171
igbinary.setup.php                                 13-Apr-2024 02:05                1488
image.configuration.php                            13-Apr-2024 02:05                3478
image.constants.php                                13-Apr-2024 02:05               53923
image.examples-png.php                             13-Apr-2024 02:05                4850
image.examples-watermark.php                       13-Apr-2024 02:05                6037
image.examples.merged-watermark.php                13-Apr-2024 02:05                8755
image.examples.php                                 13-Apr-2024 02:05                1566
image.installation.php                             13-Apr-2024 02:05                6856
image.requirements.php                             13-Apr-2024 02:05                4776
image.resources.php                                13-Apr-2024 02:05                2079
image.setup.php                                    13-Apr-2024 02:05                1538
imagick.adaptiveblurimage.php                      13-Apr-2024 02:05                7216
imagick.adaptiveresizeimage.php                    13-Apr-2024 02:05                9650
imagick.adaptivesharpenimage.php                   13-Apr-2024 02:05                6653
imagick.adaptivethresholdimage.php                 13-Apr-2024 02:05                6196
imagick.addimage.php                               13-Apr-2024 02:05                3035
imagick.addnoiseimage.php                          13-Apr-2024 02:05                5658
imagick.affinetransformimage.php                   13-Apr-2024 02:05                6623
imagick.animateimages.php                          13-Apr-2024 02:05                3247
imagick.annotateimage.php                          13-Apr-2024 02:05                8895
imagick.appendimages.php                           13-Apr-2024 02:05                6854
imagick.autolevelimage.php                         13-Apr-2024 02:05                4429
imagick.averageimages.php                          13-Apr-2024 02:05                2797
imagick.blackthresholdimage.php                    13-Apr-2024 02:05                5375
imagick.blueshiftimage.php                         13-Apr-2024 02:05                4474
imagick.blurimage.php                              13-Apr-2024 02:05                5992
imagick.borderimage.php                            13-Apr-2024 02:05                6148
imagick.brightnesscontrastimage.php                13-Apr-2024 02:05                5634
imagick.charcoalimage.php                          13-Apr-2024 02:05                4991
imagick.chopimage.php                              13-Apr-2024 02:05                7072
imagick.clampimage.php                             13-Apr-2024 02:05                2710
imagick.clear.php                                  13-Apr-2024 02:05                2361
imagick.clipimage.php                              13-Apr-2024 02:05                2592
imagick.clipimagepath.php                          13-Apr-2024 02:05                3150
imagick.clippathimage.php                          13-Apr-2024 02:05                3676
imagick.clone.php                                  13-Apr-2024 02:05                4192
imagick.clutimage.php                              13-Apr-2024 02:05                6286
imagick.coalesceimages.php                         13-Apr-2024 02:05                2996
imagick.colorfloodfillimage.php                    13-Apr-2024 02:05                5541
imagick.colorizeimage.php                          13-Apr-2024 02:05                7043
imagick.colormatriximage.php                       13-Apr-2024 02:05                7597
imagick.combineimages.php                          13-Apr-2024 02:05                3472
imagick.commentimage.php                           13-Apr-2024 02:05                5093
imagick.compareimagechannels.php                   13-Apr-2024 02:05                4045
imagick.compareimagelayers.php                     13-Apr-2024 02:05                5593
imagick.compareimages.php                          13-Apr-2024 02:05                5666
imagick.compositeimage.php                         13-Apr-2024 02:05                8173
imagick.configuration.php                          13-Apr-2024 02:05                4651
imagick.constants.php                              13-Apr-2024 02:05              166190
imagick.construct.php                              13-Apr-2024 02:05                2716
imagick.contrastimage.php                          13-Apr-2024 02:05                5059
imagick.contraststretchimage.php                   13-Apr-2024 02:05                4084
imagick.convolveimage.php                          13-Apr-2024 02:05                5983
imagick.count.php                                  13-Apr-2024 02:05                2677
imagick.cropimage.php                              13-Apr-2024 02:05                6100
imagick.cropthumbnailimage.php                     13-Apr-2024 02:05                3598
imagick.current.php                                13-Apr-2024 02:05                2543
imagick.cyclecolormapimage.php                     13-Apr-2024 02:05                3040
imagick.decipherimage.php                          13-Apr-2024 02:05                3307
imagick.deconstructimages.php                      13-Apr-2024 02:05                2633
imagick.deleteimageartifact.php                    13-Apr-2024 02:05                3857
imagick.deleteimageproperty.php                    13-Apr-2024 02:05                2632
imagick.deskewimage.php                            13-Apr-2024 02:05               11045
imagick.despeckleimage.php                         13-Apr-2024 02:05                4293
imagick.destroy.php                                13-Apr-2024 02:05                2481
imagick.displayimage.php                           13-Apr-2024 02:05                2836
imagick.displayimages.php                          13-Apr-2024 02:05                2897
imagick.distortimage.php                           13-Apr-2024 02:05               12005
imagick.drawimage.php                              13-Apr-2024 02:05                2683
imagick.edgeimage.php                              13-Apr-2024 02:05                4689
imagick.embossimage.php                            13-Apr-2024 02:05                5447
imagick.encipherimage.php                          13-Apr-2024 02:05                3297
imagick.enhanceimage.php                           13-Apr-2024 02:05                4267
imagick.equalizeimage.php                          13-Apr-2024 02:05                4226
imagick.evaluateimage.php                          13-Apr-2024 02:05                6080
imagick.examples-1.php                             13-Apr-2024 02:05               31357
imagick.examples.php                               13-Apr-2024 02:05                1336
imagick.exportimagepixels.php                      13-Apr-2024 02:05                8248
imagick.extentimage.php                            13-Apr-2024 02:05                5569
imagick.filter.php                                 13-Apr-2024 02:05                7658
imagick.flattenimages.php                          13-Apr-2024 02:05                2959
imagick.flipimage.php                              13-Apr-2024 02:05                4582
imagick.floodfillpaintimage.php                    13-Apr-2024 02:05               11904
imagick.flopimage.php                              13-Apr-2024 02:05                4612
imagick.forwardfouriertransformimage.php           13-Apr-2024 02:05               12061
imagick.frameimage.php                             13-Apr-2024 02:05                8403
imagick.functionimage.php                          13-Apr-2024 02:05               13794
imagick.fximage.php                                13-Apr-2024 02:05                6090
imagick.gammaimage.php                             13-Apr-2024 02:05                5897
imagick.gaussianblurimage.php                      13-Apr-2024 02:05                6428
imagick.getcolorspace.php                          13-Apr-2024 02:05                2518
imagick.getcompression.php                         13-Apr-2024 02:05                2296
imagick.getcompressionquality.php                  13-Apr-2024 02:05                2364
imagick.getcopyright.php                           13-Apr-2024 02:05                2389
imagick.getfilename.php                            13-Apr-2024 02:05                2521
imagick.getfont.php                                13-Apr-2024 02:05                3235
imagick.getformat.php                              13-Apr-2024 02:05                2464
imagick.getgravity.php                             13-Apr-2024 02:05                2507
imagick.gethomeurl.php                             13-Apr-2024 02:05                2284
imagick.getimage.php                               13-Apr-2024 02:05                2543
imagick.getimagealphachannel.php                   13-Apr-2024 02:05                3759
imagick.getimageartifact.php                       13-Apr-2024 02:05                3761
imagick.getimageattribute.php                      13-Apr-2024 02:05                2817
imagick.getimagebackgroundcolor.php                13-Apr-2024 02:05                2610
imagick.getimageblob.php                           13-Apr-2024 02:05                2796
imagick.getimageblueprimary.php                    13-Apr-2024 02:05                2854
imagick.getimagebordercolor.php                    13-Apr-2024 02:05                2647
imagick.getimagechanneldepth.php                   13-Apr-2024 02:05                3256
imagick.getimagechanneldistortion.php              13-Apr-2024 02:05                4187
imagick.getimagechanneldistortions.php             13-Apr-2024 02:05                4626
imagick.getimagechannelextrema.php                 13-Apr-2024 02:05                3804
imagick.getimagechannelkurtosis.php                13-Apr-2024 02:05                3693
imagick.getimagechannelmean.php                    13-Apr-2024 02:05                3299
imagick.getimagechannelrange.php                   13-Apr-2024 02:05                3588
imagick.getimagechannelstatistics.php              13-Apr-2024 02:05                2644
imagick.getimageclipmask.php                       13-Apr-2024 02:05                3093
imagick.getimagecolormapcolor.php                  13-Apr-2024 02:05                3035
imagick.getimagecolors.php                         13-Apr-2024 02:05                2442
imagick.getimagecolorspace.php                     13-Apr-2024 02:05                2399
imagick.getimagecompose.php                        13-Apr-2024 02:05                2407
imagick.getimagecompression.php                    13-Apr-2024 02:05                2365
imagick.getimagecompressionquality.php             13-Apr-2024 02:05                2441
imagick.getimagedelay.php                          13-Apr-2024 02:05                2473
imagick.getimagedepth.php                          13-Apr-2024 02:05                2236
imagick.getimagedispose.php                        13-Apr-2024 02:05                2509
imagick.getimagedistortion.php                     13-Apr-2024 02:05                3303
imagick.getimageextrema.php                        13-Apr-2024 02:05                2962
imagick.getimagefilename.php                       13-Apr-2024 02:05                2581
imagick.getimageformat.php                         13-Apr-2024 02:05                2589
imagick.getimagegamma.php                          13-Apr-2024 02:05                2478
imagick.getimagegeometry.php                       13-Apr-2024 02:05                4145
imagick.getimagegravity.php                        13-Apr-2024 02:05                2818
imagick.getimagegreenprimary.php                   13-Apr-2024 02:05                2767
imagick.getimageheight.php                         13-Apr-2024 02:05                2489
imagick.getimagehistogram.php                      13-Apr-2024 02:05               17253
imagick.getimageindex.php                          13-Apr-2024 02:05                3129
imagick.getimageinterlacescheme.php                13-Apr-2024 02:05                2571
imagick.getimageinterpolatemethod.php              13-Apr-2024 02:05                2756
imagick.getimageiterations.php                     13-Apr-2024 02:05                2550
imagick.getimagelength.php                         13-Apr-2024 02:05                3418
imagick.getimagematte.php                          13-Apr-2024 02:05                2986
imagick.getimagemattecolor.php                     13-Apr-2024 02:05                2878
imagick.getimagemimetype.php                       13-Apr-2024 02:05                2259
imagick.getimageorientation.php                    13-Apr-2024 02:05                2677
imagick.getimagepage.php                           13-Apr-2024 02:05                2741
imagick.getimagepixelcolor.php                     13-Apr-2024 02:05                3160
imagick.getimageprofile.php                        13-Apr-2024 02:05                2864
imagick.getimageprofiles.php                       13-Apr-2024 02:05                3717
imagick.getimageproperties.php                     13-Apr-2024 02:05                5954
imagick.getimageproperty.php                       13-Apr-2024 02:05                5085
imagick.getimageredprimary.php                     13-Apr-2024 02:05                2811
imagick.getimageregion.php                         13-Apr-2024 02:05                3921
imagick.getimagerenderingintent.php                13-Apr-2024 02:05                2712
imagick.getimageresolution.php                     13-Apr-2024 02:05                2581
imagick.getimagesblob.php                          13-Apr-2024 02:05                2653
imagick.getimagescene.php                          13-Apr-2024 02:05                2464
imagick.getimagesignature.php                      13-Apr-2024 02:05                2622
imagick.getimagesize.php                           13-Apr-2024 02:05                2744
imagick.getimagetickspersecond.php                 13-Apr-2024 02:05                2604
imagick.getimagetotalinkdensity.php                13-Apr-2024 02:05                2513
imagick.getimagetype.php                           13-Apr-2024 02:05                4872
imagick.getimageunits.php                          13-Apr-2024 02:05                2511
imagick.getimagevirtualpixelmethod.php             13-Apr-2024 02:05                2684
imagick.getimagewhitepoint.php                     13-Apr-2024 02:05                2722
imagick.getimagewidth.php                          13-Apr-2024 02:05                2449
imagick.getinterlacescheme.php                     13-Apr-2024 02:05                2667
imagick.getiteratorindex.php                       13-Apr-2024 02:05                6261
imagick.getnumberimages.php                        13-Apr-2024 02:05                2589
imagick.getoption.php                              13-Apr-2024 02:05                2767
imagick.getpackagename.php                         13-Apr-2024 02:05                2532
imagick.getpage.php                                13-Apr-2024 02:05                2644
imagick.getpixeliterator.php                       13-Apr-2024 02:05                5997
imagick.getpixelregioniterator.php                 13-Apr-2024 02:05                6735
imagick.getpointsize.php                           13-Apr-2024 02:05                2906
imagick.getquantum.php                             13-Apr-2024 02:05                2287
imagick.getquantumdepth.php                        13-Apr-2024 02:05                2649
imagick.getquantumrange.php                        13-Apr-2024 02:05                2900
imagick.getregistry.php                            13-Apr-2024 02:05                2486
imagick.getreleasedate.php                         13-Apr-2024 02:05                2556
imagick.getresource.php                            13-Apr-2024 02:05                2995
imagick.getresourcelimit.php                       13-Apr-2024 02:05                3402
imagick.getsamplingfactors.php                     13-Apr-2024 02:05                2667
imagick.getsize.php                                13-Apr-2024 02:05                5825
imagick.getsizeoffset.php                          13-Apr-2024 02:05                2653
imagick.getversion.php                             13-Apr-2024 02:05                2543
imagick.haldclutimage.php                          13-Apr-2024 02:05                6213
imagick.hasnextimage.php                           13-Apr-2024 02:05                2751
imagick.haspreviousimage.php                       13-Apr-2024 02:05                2797
imagick.identifyformat.php                         13-Apr-2024 02:05                4439
imagick.identifyimage.php                          13-Apr-2024 02:05                4055
imagick.implodeimage.php                           13-Apr-2024 02:05                4715
imagick.importimagepixels.php                      13-Apr-2024 02:05               11795
imagick.installation.php                           13-Apr-2024 02:05                3242
imagick.inversefouriertransformimage.php           13-Apr-2024 02:05                3521
imagick.labelimage.php                             13-Apr-2024 02:05                2607
imagick.levelimage.php                             13-Apr-2024 02:05                7855
imagick.linearstretchimage.php                     13-Apr-2024 02:05                5667
imagick.liquidrescaleimage.php                     13-Apr-2024 02:05                4684
imagick.listregistry.php                           13-Apr-2024 02:05                2346
imagick.magnifyimage.php                           13-Apr-2024 02:05                4203
imagick.mapimage.php                               13-Apr-2024 02:05                3280
imagick.mattefloodfillimage.php                    13-Apr-2024 02:05                5861
imagick.medianfilterimage.php                      13-Apr-2024 02:05                5210
imagick.mergeimagelayers.php                       13-Apr-2024 02:05                6596
imagick.minifyimage.php                            13-Apr-2024 02:05                2365
imagick.modulateimage.php                          13-Apr-2024 02:05                5629
imagick.montageimage.php                           13-Apr-2024 02:05                4680
imagick.morphimages.php                            13-Apr-2024 02:05                2862
imagick.morphology.php                             13-Apr-2024 02:05               66379
imagick.mosaicimages.php                           13-Apr-2024 02:05                2805
imagick.motionblurimage.php                        13-Apr-2024 02:05                7057
imagick.negateimage.php                            13-Apr-2024 02:05                5634
imagick.newimage.php                               13-Apr-2024 02:05                6492
imagick.newpseudoimage.php                         13-Apr-2024 02:05                5865
imagick.nextimage.php                              13-Apr-2024 02:05                2343
imagick.normalizeimage.php                         13-Apr-2024 02:05                6458
imagick.oilpaintimage.php                          13-Apr-2024 02:05                4580
imagick.opaquepaintimage.php                       13-Apr-2024 02:05                5185
imagick.optimizeimagelayers.php                    13-Apr-2024 02:05                5467
imagick.orderedposterizeimage.php                  13-Apr-2024 02:05                6952
imagick.paintfloodfillimage.php                    13-Apr-2024 02:05                5836
imagick.paintopaqueimage.php                       13-Apr-2024 02:05                5652
imagick.painttransparentimage.php                  13-Apr-2024 02:05                4806
imagick.pingimage.php                              13-Apr-2024 02:05                2740
imagick.pingimageblob.php                          13-Apr-2024 02:05                6186
imagick.pingimagefile.php                          13-Apr-2024 02:05                6049
imagick.polaroidimage.php                          13-Apr-2024 02:05                4855
imagick.posterizeimage.php                         13-Apr-2024 02:05                5600
imagick.previewimages.php                          13-Apr-2024 02:05                3209
imagick.previousimage.php                          13-Apr-2024 02:05                2401
imagick.profileimage.php                           13-Apr-2024 02:05                3347
imagick.quantizeimage.php                          13-Apr-2024 02:05                6679
imagick.quantizeimages.php                         13-Apr-2024 02:05                4035
imagick.queryfontmetrics.php                       13-Apr-2024 02:05                5749
imagick.queryfonts.php                             13-Apr-2024 02:05                4717
imagick.queryformats.php                           13-Apr-2024 02:05                7142
imagick.radialblurimage.php                        13-Apr-2024 02:05                5590
imagick.raiseimage.php                             13-Apr-2024 02:05                6569
imagick.randomthresholdimage.php                   13-Apr-2024 02:05                6513
imagick.readimage.php                              13-Apr-2024 02:05                2577
imagick.readimageblob.php                          13-Apr-2024 02:05                5467
imagick.readimagefile.php                          13-Apr-2024 02:05                3302
imagick.readimages.php                             13-Apr-2024 02:05                2587
imagick.recolorimage.php                           13-Apr-2024 02:05                6420
imagick.reducenoiseimage.php                       13-Apr-2024 02:05                5282
imagick.remapimage.php                             13-Apr-2024 02:05                3541
imagick.removeimage.php                            13-Apr-2024 02:05                2552
imagick.removeimageprofile.php                     13-Apr-2024 02:05                2844
imagick.render.php                                 13-Apr-2024 02:05                2355
imagick.requirements.php                           13-Apr-2024 02:05                1633
imagick.resampleimage.php                          13-Apr-2024 02:05                5655
imagick.resetimagepage.php                         13-Apr-2024 02:05                2882
imagick.resizeimage.php                            13-Apr-2024 02:05               11691
imagick.resources.php                              13-Apr-2024 02:05                1165
imagick.rollimage.php                              13-Apr-2024 02:05                4810
imagick.rotateimage.php                            13-Apr-2024 02:05                5672
imagick.rotationalblurimage.php                    13-Apr-2024 02:05                5770
imagick.roundcorners.php                           13-Apr-2024 02:05                6872
imagick.sampleimage.php                            13-Apr-2024 02:05                3084
imagick.scaleimage.php                             13-Apr-2024 02:05                7267
imagick.segmentimage.php                           13-Apr-2024 02:05                6799
imagick.selectiveblurimage.php                     13-Apr-2024 02:05                6633
imagick.separateimagechannel.php                   13-Apr-2024 02:05                5454
imagick.sepiatoneimage.php                         13-Apr-2024 02:05                4932
imagick.setbackgroundcolor.php                     13-Apr-2024 02:05                3366
imagick.setcolorspace.php                          13-Apr-2024 02:05                3082
imagick.setcompression.php                         13-Apr-2024 02:05                2806
imagick.setcompressionquality.php                  13-Apr-2024 02:05                7050
imagick.setfilename.php                            13-Apr-2024 02:05                2650
imagick.setfirstiterator.php                       13-Apr-2024 02:05                2397
imagick.setfont.php                                13-Apr-2024 02:05                5927
imagick.setformat.php                              13-Apr-2024 02:05                2584
imagick.setgravity.php                             13-Apr-2024 02:05                2790
imagick.setimage.php                               13-Apr-2024 02:05                4802
imagick.setimagealphachannel.php                   13-Apr-2024 02:05                3790
imagick.setimageartifact.php                       13-Apr-2024 02:05                7495
imagick.setimageattribute.php                      13-Apr-2024 02:05                3184
imagick.setimagebackgroundcolor.php                13-Apr-2024 02:05                3596
imagick.setimagebias.php                           13-Apr-2024 02:05                6858
imagick.setimagebiasquantum.php                    13-Apr-2024 02:05                2892
imagick.setimageblueprimary.php                    13-Apr-2024 02:05                3152
imagick.setimagebordercolor.php                    13-Apr-2024 02:05                3580
imagick.setimagechanneldepth.php                   13-Apr-2024 02:05                3203
imagick.setimageclipmask.php                       13-Apr-2024 02:05                8850
imagick.setimagecolormapcolor.php                  13-Apr-2024 02:05                3246
imagick.setimagecolorspace.php                     13-Apr-2024 02:05                3313
imagick.setimagecompose.php                        13-Apr-2024 02:05                2987
imagick.setimagecompression.php                    13-Apr-2024 02:05                2967
imagick.setimagecompressionquality.php             13-Apr-2024 02:05                4879
imagick.setimagedelay.php                          13-Apr-2024 02:05                6174
imagick.setimagedepth.php                          13-Apr-2024 02:05                2790
imagick.setimagedispose.php                        13-Apr-2024 02:05                2826
imagick.setimageextent.php                         13-Apr-2024 02:05                3125
imagick.setimagefilename.php                       13-Apr-2024 02:05                2891
imagick.setimageformat.php                         13-Apr-2024 02:05                2821
imagick.setimagegamma.php                          13-Apr-2024 02:05                2800
imagick.setimagegravity.php                        13-Apr-2024 02:05                2989
imagick.setimagegreenprimary.php                   13-Apr-2024 02:05                3143
imagick.setimageindex.php                          13-Apr-2024 02:05                3477
imagick.setimageinterlacescheme.php                13-Apr-2024 02:05                2963
imagick.setimageinterpolatemethod.php              13-Apr-2024 02:05                3051
imagick.setimageiterations.php                     13-Apr-2024 02:05                5031
imagick.setimagematte.php                          13-Apr-2024 02:05                2861
imagick.setimagemattecolor.php                     13-Apr-2024 02:05                3841
imagick.setimageopacity.php                        13-Apr-2024 02:05                5191
imagick.setimageorientation.php                    13-Apr-2024 02:05                4697
imagick.setimagepage.php                           13-Apr-2024 02:05                3760
imagick.setimageprofile.php                        13-Apr-2024 02:05                3453
imagick.setimageproperty.php                       13-Apr-2024 02:05                5273
imagick.setimageredprimary.php                     13-Apr-2024 02:05                3143
imagick.setimagerenderingintent.php                13-Apr-2024 02:05                2974
imagick.setimageresolution.php                     13-Apr-2024 02:05                5013
imagick.setimagescene.php                          13-Apr-2024 02:05                2820
imagick.setimagetickspersecond.php                 13-Apr-2024 02:05                7724
imagick.setimagetype.php                           13-Apr-2024 02:05                2583
imagick.setimageunits.php                          13-Apr-2024 02:05                2619
imagick.setimagevirtualpixelmethod.php             13-Apr-2024 02:05                2761
imagick.setimagewhitepoint.php                     13-Apr-2024 02:05                3165
imagick.setinterlacescheme.php                     13-Apr-2024 02:05                2659
imagick.setiteratorindex.php                       13-Apr-2024 02:05                6370
imagick.setlastiterator.php                        13-Apr-2024 02:05                2413
imagick.setoption.php                              13-Apr-2024 02:05               11525
imagick.setpage.php                                13-Apr-2024 02:05                3504
imagick.setpointsize.php                           13-Apr-2024 02:05                5467
imagick.setprogressmonitor.php                     13-Apr-2024 02:05               10206
imagick.setregistry.php                            13-Apr-2024 02:05                3044
imagick.setresolution.php                          13-Apr-2024 02:05                3816
imagick.setresourcelimit.php                       13-Apr-2024 02:05                3681
imagick.setsamplingfactors.php                     13-Apr-2024 02:05                6778
imagick.setsize.php                                13-Apr-2024 02:05                2950
imagick.setsizeoffset.php                          13-Apr-2024 02:05                3532
imagick.settype.php                                13-Apr-2024 02:05                2527
imagick.setup.php                                  13-Apr-2024 02:05                1557
imagick.shadeimage.php                             13-Apr-2024 02:05                5682
imagick.shadowimage.php                            13-Apr-2024 02:05                5446
imagick.sharpenimage.php                           13-Apr-2024 02:05                5661
imagick.shaveimage.php                             13-Apr-2024 02:05                4753
imagick.shearimage.php                             13-Apr-2024 02:05                6580
imagick.sigmoidalcontrastimage.php                 13-Apr-2024 02:05                8117
imagick.sketchimage.php                            13-Apr-2024 02:05                6017
imagick.smushimages.php                            13-Apr-2024 02:05                5745
imagick.solarizeimage.php                          13-Apr-2024 02:05                4827
imagick.sparsecolorimage.php                       13-Apr-2024 02:05               26740
imagick.spliceimage.php                            13-Apr-2024 02:05                5774
imagick.spreadimage.php                            13-Apr-2024 02:05                4689
imagick.statisticimage.php                         13-Apr-2024 02:05                6703
imagick.steganoimage.php                           13-Apr-2024 02:05                3076
imagick.stereoimage.php                            13-Apr-2024 02:05                2879
imagick.stripimage.php                             13-Apr-2024 02:05                2587
imagick.subimagematch.php                          13-Apr-2024 02:05                7459
imagick.swirlimage.php                             13-Apr-2024 02:05                4749
imagick.textureimage.php                           13-Apr-2024 02:05                6177
imagick.thresholdimage.php                         13-Apr-2024 02:05                5258
imagick.thumbnailimage.php                         13-Apr-2024 02:05                7769
imagick.tintimage.php                              13-Apr-2024 02:05                7949
imagick.tostring.php                               13-Apr-2024 02:05                2930
imagick.transformimage.php                         13-Apr-2024 02:05                6224
imagick.transformimagecolorspace.php               13-Apr-2024 02:05                5697
imagick.transparentpaintimage.php                  13-Apr-2024 02:05                7304
imagick.transposeimage.php                         13-Apr-2024 02:05                4655
imagick.transverseimage.php                        13-Apr-2024 02:05                4642
imagick.trimimage.php                              13-Apr-2024 02:05                5894
imagick.uniqueimagecolors.php                      13-Apr-2024 02:05                5601
imagick.unsharpmaskimage.php                       13-Apr-2024 02:05                6816
imagick.valid.php                                  13-Apr-2024 02:05                2305
imagick.vignetteimage.php                          13-Apr-2024 02:05                6650
imagick.waveimage.php                              13-Apr-2024 02:05                6406
imagick.whitethresholdimage.php                    13-Apr-2024 02:05                5307
imagick.writeimage.php                             13-Apr-2024 02:05                3067
imagick.writeimagefile.php                         13-Apr-2024 02:05                4032
imagick.writeimages.php                            13-Apr-2024 02:05                2911
imagick.writeimagesfile.php                        13-Apr-2024 02:05                4111
imagickdraw.affine.php                             13-Apr-2024 02:05               16912
imagickdraw.annotation.php                         13-Apr-2024 02:05                3382
imagickdraw.arc.php                                13-Apr-2024 02:05                9614
imagickdraw.bezier.php                             13-Apr-2024 02:05               16839
imagickdraw.circle.php                             13-Apr-2024 02:05                9045
imagickdraw.clear.php                              13-Apr-2024 02:05                2385
imagickdraw.clone.php                              13-Apr-2024 02:05                2436
imagickdraw.color.php                              13-Apr-2024 02:05                3521
imagickdraw.comment.php                            13-Apr-2024 02:05                2779
imagickdraw.composite.php                          13-Apr-2024 02:05               11852
imagickdraw.construct.php                          13-Apr-2024 02:05                2248
imagickdraw.destroy.php                            13-Apr-2024 02:05                2403
imagickdraw.ellipse.php                            13-Apr-2024 02:05               12230
imagickdraw.getclippath.php                        13-Apr-2024 02:05                2407
imagickdraw.getcliprule.php                        13-Apr-2024 02:05                2518
imagickdraw.getclipunits.php                       13-Apr-2024 02:05                2330
imagickdraw.getfillcolor.php                       13-Apr-2024 02:05                2440
imagickdraw.getfillopacity.php                     13-Apr-2024 02:05                2398
imagickdraw.getfillrule.php                        13-Apr-2024 02:05                2448
imagickdraw.getfont.php                            13-Apr-2024 02:05                2368
imagickdraw.getfontfamily.php                      13-Apr-2024 02:05                2483
imagickdraw.getfontsize.php                        13-Apr-2024 02:05                2522
imagickdraw.getfontstretch.php                     13-Apr-2024 02:05                2354
imagickdraw.getfontstyle.php                       13-Apr-2024 02:05                2723
imagickdraw.getfontweight.php                      13-Apr-2024 02:05                2409
imagickdraw.getgravity.php                         13-Apr-2024 02:05                2573
imagickdraw.getstrokeantialias.php                 13-Apr-2024 02:05                2911
imagickdraw.getstrokecolor.php                     13-Apr-2024 02:05                2816
imagickdraw.getstrokedasharray.php                 13-Apr-2024 02:05                2511
imagickdraw.getstrokedashoffset.php                13-Apr-2024 02:05                2520
imagickdraw.getstrokelinecap.php                   13-Apr-2024 02:05                2647
imagickdraw.getstrokelinejoin.php                  13-Apr-2024 02:05                2661
imagickdraw.getstrokemiterlimit.php                13-Apr-2024 02:05                2802
imagickdraw.getstrokeopacity.php                   13-Apr-2024 02:05                2482
imagickdraw.getstrokewidth.php                     13-Apr-2024 02:05                2497
imagickdraw.gettextalignment.php                   13-Apr-2024 02:05                2550
imagickdraw.gettextantialias.php                   13-Apr-2024 02:05                2851
imagickdraw.gettextdecoration.php                  13-Apr-2024 02:05                2601
imagickdraw.gettextencoding.php                    13-Apr-2024 02:05                2572
imagickdraw.gettextinterlinespacing.php            13-Apr-2024 02:05                2391
imagickdraw.gettextinterwordspacing.php            13-Apr-2024 02:05                2415
imagickdraw.gettextkerning.php                     13-Apr-2024 02:05                2310
imagickdraw.gettextundercolor.php                  13-Apr-2024 02:05                2510
imagickdraw.getvectorgraphics.php                  13-Apr-2024 02:05                2645
imagickdraw.line.php                               13-Apr-2024 02:05                8375
imagickdraw.matte.php                              13-Apr-2024 02:05                8359
imagickdraw.pathclose.php                          13-Apr-2024 02:05                2455
imagickdraw.pathcurvetoabsolute.php                13-Apr-2024 02:05                4910
imagickdraw.pathcurvetoquadraticbezierabsolute.php 13-Apr-2024 02:05               11154
imagickdraw.pathcurvetoquadraticbezierrelative.php 13-Apr-2024 02:05                4337
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 13-Apr-2024 02:05               10478
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 13-Apr-2024 02:05               10449
imagickdraw.pathcurvetorelative.php                13-Apr-2024 02:05                4938
imagickdraw.pathcurvetosmoothabsolute.php          13-Apr-2024 02:05                4641
imagickdraw.pathcurvetosmoothrelative.php          13-Apr-2024 02:05                4649
imagickdraw.pathellipticarcabsolute.php            13-Apr-2024 02:05                5874
imagickdraw.pathellipticarcrelative.php            13-Apr-2024 02:05                5844
imagickdraw.pathfinish.php                         13-Apr-2024 02:05                2293
imagickdraw.pathlinetoabsolute.php                 13-Apr-2024 02:05                3230
imagickdraw.pathlinetohorizontalabsolute.php       13-Apr-2024 02:05                3065
imagickdraw.pathlinetohorizontalrelative.php       13-Apr-2024 02:05                3065
imagickdraw.pathlinetorelative.php                 13-Apr-2024 02:05                3278
imagickdraw.pathlinetoverticalabsolute.php         13-Apr-2024 02:05                3041
imagickdraw.pathlinetoverticalrelative.php         13-Apr-2024 02:05                3041
imagickdraw.pathmovetoabsolute.php                 13-Apr-2024 02:05                3261
imagickdraw.pathmovetorelative.php                 13-Apr-2024 02:05                3227
imagickdraw.pathstart.php                          13-Apr-2024 02:05               11864
imagickdraw.point.php                              13-Apr-2024 02:05                6854
imagickdraw.polygon.php                            13-Apr-2024 02:05                9040
imagickdraw.polyline.php                           13-Apr-2024 02:05                9067
imagickdraw.pop.php                                13-Apr-2024 02:05                2821
imagickdraw.popclippath.php                        13-Apr-2024 02:05                2264
imagickdraw.popdefs.php                            13-Apr-2024 02:05                7719
imagickdraw.poppattern.php                         13-Apr-2024 02:05                2457
imagickdraw.push.php                               13-Apr-2024 02:05                8524
imagickdraw.pushclippath.php                       13-Apr-2024 02:05                3017
imagickdraw.pushdefs.php                           13-Apr-2024 02:05                2595
imagickdraw.pushpattern.php                        13-Apr-2024 02:05               14695
imagickdraw.rectangle.php                          13-Apr-2024 02:05                8514
imagickdraw.render.php                             13-Apr-2024 02:05                2557
imagickdraw.resetvectorgraphics.php                13-Apr-2024 02:05                2420
imagickdraw.rotate.php                             13-Apr-2024 02:05                7723
imagickdraw.roundrectangle.php                     13-Apr-2024 02:05                9424
imagickdraw.scale.php                              13-Apr-2024 02:05                8087
imagickdraw.setclippath.php                        13-Apr-2024 02:05                8472
imagickdraw.setcliprule.php                        13-Apr-2024 02:05                9492
imagickdraw.setclipunits.php                       13-Apr-2024 02:05                8822
imagickdraw.setfillalpha.php                       13-Apr-2024 02:05                7826
imagickdraw.setfillcolor.php                       13-Apr-2024 02:05                7776
imagickdraw.setfillopacity.php                     13-Apr-2024 02:05                7873
imagickdraw.setfillpatternurl.php                  13-Apr-2024 02:05                3444
imagickdraw.setfillrule.php                        13-Apr-2024 02:05               13029
imagickdraw.setfont.php                            13-Apr-2024 02:05                9321
imagickdraw.setfontfamily.php                      13-Apr-2024 02:05                9996
imagickdraw.setfontsize.php                        13-Apr-2024 02:05                8353
imagickdraw.setfontstretch.php                     13-Apr-2024 02:05                9804
imagickdraw.setfontstyle.php                       13-Apr-2024 02:05                9109
imagickdraw.setfontweight.php                      13-Apr-2024 02:05                9178
imagickdraw.setgravity.php                         13-Apr-2024 02:05               10613
imagickdraw.setresolution.php                      13-Apr-2024 02:05                2886
imagickdraw.setstrokealpha.php                     13-Apr-2024 02:05                8434
imagickdraw.setstrokeantialias.php                 13-Apr-2024 02:05                9128
imagickdraw.setstrokecolor.php                     13-Apr-2024 02:05                8505
imagickdraw.setstrokedasharray.php                 13-Apr-2024 02:05               13476
imagickdraw.setstrokedashoffset.php                13-Apr-2024 02:05                9894
imagickdraw.setstrokelinecap.php                   13-Apr-2024 02:05                8586
imagickdraw.setstrokelinejoin.php                  13-Apr-2024 02:05               11458
imagickdraw.setstrokemiterlimit.php                13-Apr-2024 02:05               11312
imagickdraw.setstrokeopacity.php                   13-Apr-2024 02:05               10254
imagickdraw.setstrokepatternurl.php                13-Apr-2024 02:05                3039
imagickdraw.setstrokewidth.php                     13-Apr-2024 02:05                8484
imagickdraw.settextalignment.php                   13-Apr-2024 02:05                9447
imagickdraw.settextantialias.php                   13-Apr-2024 02:05                8982
imagickdraw.settextdecoration.php                  13-Apr-2024 02:05                7491
imagickdraw.settextencoding.php                    13-Apr-2024 02:05                3295
imagickdraw.settextinterlinespacing.php            13-Apr-2024 02:05                2957
imagickdraw.settextinterwordspacing.php            13-Apr-2024 02:05                2750
imagickdraw.settextkerning.php                     13-Apr-2024 02:05                2866
imagickdraw.settextundercolor.php                  13-Apr-2024 02:05                7764
imagickdraw.setvectorgraphics.php                  13-Apr-2024 02:05                9108
imagickdraw.setviewbox.php                         13-Apr-2024 02:05               10465
imagickdraw.skewx.php                              13-Apr-2024 02:05                8108
imagickdraw.skewy.php                              13-Apr-2024 02:05                8101
imagickdraw.translate.php                          13-Apr-2024 02:05                8438
imagickkernel.addkernel.php                        13-Apr-2024 02:05                6975
imagickkernel.addunitykernel.php                   13-Apr-2024 02:05               13636
imagickkernel.frombuiltin.php                      13-Apr-2024 02:05               26180
imagickkernel.frommatrix.php                       13-Apr-2024 02:05               23112
imagickkernel.getmatrix.php                        13-Apr-2024 02:05                7050
imagickkernel.scale.php                            13-Apr-2024 02:05               13142
imagickkernel.separate.php                         13-Apr-2024 02:05                9662
imagickpixel.clear.php                             13-Apr-2024 02:05                2480
imagickpixel.construct.php                         13-Apr-2024 02:05               11915
imagickpixel.destroy.php                           13-Apr-2024 02:05                2600
imagickpixel.getcolor.php                          13-Apr-2024 02:05                8025
imagickpixel.getcolorasstring.php                  13-Apr-2024 02:05                4888
imagickpixel.getcolorcount.php                     13-Apr-2024 02:05                4992
imagickpixel.getcolorquantum.php                   13-Apr-2024 02:05                2911
imagickpixel.getcolorvalue.php                     13-Apr-2024 02:05                8705
imagickpixel.getcolorvaluequantum.php              13-Apr-2024 02:05                6066
imagickpixel.gethsl.php                            13-Apr-2024 02:05                4500
imagickpixel.getindex.php                          13-Apr-2024 02:05                2257
imagickpixel.ispixelsimilar.php                    13-Apr-2024 02:05                3607
imagickpixel.ispixelsimilarquantum.php             13-Apr-2024 02:05                3191
imagickpixel.issimilar.php                         13-Apr-2024 02:05               16692
imagickpixel.setcolor.php                          13-Apr-2024 02:05                7542
imagickpixel.setcolorcount.php                     13-Apr-2024 02:05                2659
imagickpixel.setcolorvalue.php                     13-Apr-2024 02:05                5275
imagickpixel.setcolorvaluequantum.php              13-Apr-2024 02:05                8464
imagickpixel.sethsl.php                            13-Apr-2024 02:05                7609
imagickpixel.setindex.php                          13-Apr-2024 02:05                2588
imagickpixeliterator.clear.php                     13-Apr-2024 02:05                6347
imagickpixeliterator.construct.php                 13-Apr-2024 02:05                6006
imagickpixeliterator.destroy.php                   13-Apr-2024 02:05                2604
imagickpixeliterator.getcurrentiteratorrow.php     13-Apr-2024 02:05                2676
imagickpixeliterator.getiteratorrow.php            13-Apr-2024 02:05                2589
imagickpixeliterator.getnextiteratorrow.php        13-Apr-2024 02:05                6755
imagickpixeliterator.getpreviousiteratorrow.php    13-Apr-2024 02:05                2723
imagickpixeliterator.newpixeliterator.php          13-Apr-2024 02:05                2824
imagickpixeliterator.newpixelregioniterator.php    13-Apr-2024 02:05                4357
imagickpixeliterator.resetiterator.php             13-Apr-2024 02:05                8773
imagickpixeliterator.setiteratorfirstrow.php       13-Apr-2024 02:05                2630
imagickpixeliterator.setiteratorlastrow.php        13-Apr-2024 02:05                2625
imagickpixeliterator.setiteratorrow.php            13-Apr-2024 02:05                7151
imagickpixeliterator.synciterator.php              13-Apr-2024 02:05                2492
imap.configuration.php                             13-Apr-2024 02:05                3401
imap.constants.php                                 13-Apr-2024 02:05               26101
imap.installation.php                              13-Apr-2024 02:05                2963
imap.requirements.php                              13-Apr-2024 02:05                3634
imap.resources.php                                 13-Apr-2024 02:05                1417
imap.setup.php                                     13-Apr-2024 02:05                1528
index.php                                          13-Apr-2024 02:05               13182
indexes.examples.php                               13-Apr-2024 02:05              735056
indexes.functions.php                              13-Apr-2024 02:05             1240680
indexes.php                                        13-Apr-2024 02:05                1356
infiniteiterator.construct.php                     13-Apr-2024 02:05                4951
infiniteiterator.next.php                          13-Apr-2024 02:05                3095
info.configuration.php                             13-Apr-2024 02:05               14482
info.constants.php                                 13-Apr-2024 02:05               22158
info.installation.php                              13-Apr-2024 02:05                1203
info.requirements.php                              13-Apr-2024 02:05                1143
info.resources.php                                 13-Apr-2024 02:05                1144
info.setup.php                                     13-Apr-2024 02:05                1515
ini.core.php                                       13-Apr-2024 02:05               81571
ini.list.php                                       13-Apr-2024 02:05              107415
ini.php                                            13-Apr-2024 02:05                1609
ini.sections.php                                   13-Apr-2024 02:05                4389
inotify.configuration.php                          13-Apr-2024 02:05                1186
inotify.constants.php                              13-Apr-2024 02:05               11184
inotify.install.php                                13-Apr-2024 02:05                1827
inotify.requirements.php                           13-Apr-2024 02:05                1210
inotify.resources.php                              13-Apr-2024 02:05                1329
inotify.setup.php                                  13-Apr-2024 02:05                1547
install.cloud.azure.php                            13-Apr-2024 02:05                4648
install.cloud.digitalocean.php                     13-Apr-2024 02:05                3403
install.cloud.ec2.php                              13-Apr-2024 02:05                1480
install.cloud.php                                  13-Apr-2024 02:05                1801
install.fpm.configuration.php                      13-Apr-2024 02:05               40473
install.fpm.install.php                            13-Apr-2024 02:05                3504
install.fpm.php                                    13-Apr-2024 02:05                3933
install.general.php                                13-Apr-2024 02:05                5592
install.macosx.bundled.php                         13-Apr-2024 02:05               11900
install.macosx.compile.php                         13-Apr-2024 02:05                1466
install.macosx.packages.php                        13-Apr-2024 02:05                3288
install.macosx.php                                 13-Apr-2024 02:05                2101
install.pecl.downloads.php                         13-Apr-2024 02:05                4117
install.pecl.intro.php                             13-Apr-2024 02:05                3449
install.pecl.pear.php                              13-Apr-2024 02:05                3333
install.pecl.php                                   13-Apr-2024 02:05                2075
install.pecl.php-config.php                        13-Apr-2024 02:05                4548
install.pecl.phpize.php                            13-Apr-2024 02:05                3577
install.pecl.static.php                            13-Apr-2024 02:05                3705
install.pecl.windows.php                           13-Apr-2024 02:05               11147
install.php                                        13-Apr-2024 02:05                5952
install.problems.bugs.php                          13-Apr-2024 02:05                1922
install.problems.faq.php                           13-Apr-2024 02:05                1357
install.problems.php                               13-Apr-2024 02:05                1552
install.problems.support.php                       13-Apr-2024 02:05                2639
install.unix.apache2.php                           13-Apr-2024 02:05               14974
install.unix.commandline.php                       13-Apr-2024 02:05                4322
install.unix.debian.php                            13-Apr-2024 02:05                7679
install.unix.lighttpd-14.php                       13-Apr-2024 02:05                6645
install.unix.litespeed.php                         13-Apr-2024 02:05               10641
install.unix.nginx.php                             13-Apr-2024 02:05                9758
install.unix.openbsd.php                           13-Apr-2024 02:05                6716
install.unix.php                                   13-Apr-2024 02:05                8178
install.unix.solaris.php                           13-Apr-2024 02:05                4220
install.windows.apache2.php                        13-Apr-2024 02:05                7864
install.windows.building.php                       13-Apr-2024 02:05                1811
install.windows.commandline.php                    13-Apr-2024 02:05                9166
install.windows.manual.php                         13-Apr-2024 02:05                5871
install.windows.pecl.php                           13-Apr-2024 02:05                1676
install.windows.php                                13-Apr-2024 02:05                3339
install.windows.recommended.php                    13-Apr-2024 02:05                5899
install.windows.requirements.php                   13-Apr-2024 02:05                2681
install.windows.tools.php                          13-Apr-2024 02:05                1959
install.windows.troubleshooting.php                13-Apr-2024 02:05                1980
internaliterator.construct.php                     13-Apr-2024 02:05                1993
internaliterator.current.php                       13-Apr-2024 02:05                2268
internaliterator.key.php                           13-Apr-2024 02:05                2251
internaliterator.next.php                          13-Apr-2024 02:05                2230
internaliterator.rewind.php                        13-Apr-2024 02:05                2286
internaliterator.valid.php                         13-Apr-2024 02:05                2280
intl.configuration.php                             13-Apr-2024 02:05                5596
intl.constants.php                                 13-Apr-2024 02:05                9996
intl.examples.basic.php                            13-Apr-2024 02:05                4373
intl.examples.php                                  13-Apr-2024 02:05                1312
intl.installation.php                              13-Apr-2024 02:05                1845
intl.requirements.php                              13-Apr-2024 02:05                1394
intl.resources.php                                 13-Apr-2024 02:05                1144
intl.setup.php                                     13-Apr-2024 02:05                1526
intlbreakiterator.construct.php                    13-Apr-2024 02:05                4147
intlbreakiterator.createcharacterinstance.php      13-Apr-2024 02:05                3348
intlbreakiterator.createcodepointinstance.php      13-Apr-2024 02:05                2808
intlbreakiterator.createlineinstance.php           13-Apr-2024 02:05                3292
intlbreakiterator.createsentenceinstance.php       13-Apr-2024 02:05                3288
intlbreakiterator.createtitleinstance.php          13-Apr-2024 02:05                3288
intlbreakiterator.createwordinstance.php           13-Apr-2024 02:05                3238
intlbreakiterator.current.php                      13-Apr-2024 02:05                2504
intlbreakiterator.first.php                        13-Apr-2024 02:05                2479
intlbreakiterator.following.php                    13-Apr-2024 02:05                2772
intlbreakiterator.geterrorcode.php                 13-Apr-2024 02:05                3053
intlbreakiterator.geterrormessage.php              13-Apr-2024 02:05                3105
intlbreakiterator.getlocale.php                    13-Apr-2024 02:05                2901
intlbreakiterator.getpartsiterator.php             13-Apr-2024 02:05                3860
intlbreakiterator.gettext.php                      13-Apr-2024 02:05                2621
intlbreakiterator.isboundary.php                   13-Apr-2024 02:05                2753
intlbreakiterator.last.php                         13-Apr-2024 02:05                2480
intlbreakiterator.next.php                         13-Apr-2024 02:05                2889
intlbreakiterator.preceding.php                    13-Apr-2024 02:05                2767
intlbreakiterator.previous.php                     13-Apr-2024 02:05                2530
intlbreakiterator.settext.php                      13-Apr-2024 02:05                3721
intlcalendar.add.php                               13-Apr-2024 02:05                9230
intlcalendar.after.php                             13-Apr-2024 02:05                7047
intlcalendar.before.php                            13-Apr-2024 02:05                4459
intlcalendar.clear.php                             13-Apr-2024 02:05               19347
intlcalendar.construct.php                         13-Apr-2024 02:05                2423
intlcalendar.createinstance.php                    13-Apr-2024 02:05               14036
intlcalendar.equals.php                            13-Apr-2024 02:05               11229
intlcalendar.fielddifference.php                   13-Apr-2024 02:05               11515
intlcalendar.fromdatetime.php                      13-Apr-2024 02:05                8145
intlcalendar.get.php                               13-Apr-2024 02:05                8913
intlcalendar.getactualmaximum.php                  13-Apr-2024 02:05                8936
intlcalendar.getactualminimum.php                  13-Apr-2024 02:05                6115
intlcalendar.getavailablelocales.php               13-Apr-2024 02:05                4410
intlcalendar.getdayofweektype.php                  13-Apr-2024 02:05               10758
intlcalendar.geterrorcode.php                      13-Apr-2024 02:05                9627
intlcalendar.geterrormessage.php                   13-Apr-2024 02:05                6425
intlcalendar.getfirstdayofweek.php                 13-Apr-2024 02:05                8861
intlcalendar.getgreatestminimum.php                13-Apr-2024 02:05                4939
intlcalendar.getkeywordvaluesforlocale.php         13-Apr-2024 02:05                7727
intlcalendar.getleastmaximum.php                   13-Apr-2024 02:05                8591
intlcalendar.getlocale.php                         13-Apr-2024 02:05                6661
intlcalendar.getmaximum.php                        13-Apr-2024 02:05                5625
intlcalendar.getminimaldaysinfirstweek.php         13-Apr-2024 02:05                8980
intlcalendar.getminimum.php                        13-Apr-2024 02:05                4847
intlcalendar.getnow.php                            13-Apr-2024 02:05                5419
intlcalendar.getrepeatedwalltimeoption.php         13-Apr-2024 02:05               10494
intlcalendar.getskippedwalltimeoption.php          13-Apr-2024 02:05               12944
intlcalendar.gettime.php                           13-Apr-2024 02:05                6729
intlcalendar.gettimezone.php                       13-Apr-2024 02:05                7721
intlcalendar.gettype.php                           13-Apr-2024 02:05                5837
intlcalendar.getweekendtransition.php              13-Apr-2024 02:05                5482
intlcalendar.indaylighttime.php                    13-Apr-2024 02:05                8857
intlcalendar.isequivalentto.php                    13-Apr-2024 02:05                8673
intlcalendar.islenient.php                         13-Apr-2024 02:05                8556
intlcalendar.isset.php                             13-Apr-2024 02:05                5170
intlcalendar.isweekend.php                         13-Apr-2024 02:05                9295
intlcalendar.roll.php                              13-Apr-2024 02:05                9813
intlcalendar.set.php                               13-Apr-2024 02:05               16545
intlcalendar.setdate.php                           13-Apr-2024 02:05                4892
intlcalendar.setdatetime.php                       13-Apr-2024 02:05                6709
intlcalendar.setfirstdayofweek.php                 13-Apr-2024 02:05                9027
intlcalendar.setlenient.php                        13-Apr-2024 02:05                5386
intlcalendar.setminimaldaysinfirstweek.php         13-Apr-2024 02:05                5602
intlcalendar.setrepeatedwalltimeoption.php         13-Apr-2024 02:05                6823
intlcalendar.setskippedwalltimeoption.php          13-Apr-2024 02:05                7803
intlcalendar.settime.php                           13-Apr-2024 02:05                8759
intlcalendar.settimezone.php                       13-Apr-2024 02:05               11815
intlcalendar.todatetime.php                        13-Apr-2024 02:05                7391
intlchar.charage.php                               13-Apr-2024 02:05                6056
intlchar.chardigitvalue.php                        13-Apr-2024 02:05                5609
intlchar.chardirection.php                         13-Apr-2024 02:05               10837
intlchar.charfromname.php                          13-Apr-2024 02:05                7443
intlchar.charmirror.php                            13-Apr-2024 02:05                6933
intlchar.charname.php                              13-Apr-2024 02:05                7812
intlchar.chartype.php                              13-Apr-2024 02:05               11591
intlchar.chr.php                                   13-Apr-2024 02:05                5781
intlchar.digit.php                                 13-Apr-2024 02:05                8956
intlchar.enumcharnames.php                         13-Apr-2024 02:05                9284
intlchar.enumchartypes.php                         13-Apr-2024 02:05                6108
intlchar.foldcase.php                              13-Apr-2024 02:05                4295
intlchar.fordigit.php                              13-Apr-2024 02:05                7098
intlchar.getbidipairedbracket.php                  13-Apr-2024 02:05                6401
intlchar.getblockcode.php                          13-Apr-2024 02:05                5655
intlchar.getcombiningclass.php                     13-Apr-2024 02:05                5039
intlchar.getfc-nfkc-closure.php                    13-Apr-2024 02:05                5070
intlchar.getintpropertymaxvalue.php                13-Apr-2024 02:05                6566
intlchar.getintpropertyminvalue.php                13-Apr-2024 02:05                6553
intlchar.getintpropertyvalue.php                   13-Apr-2024 02:05                8388
intlchar.getnumericvalue.php                       13-Apr-2024 02:05                5898
intlchar.getpropertyenum.php                       13-Apr-2024 02:05                7037
intlchar.getpropertyname.php                       13-Apr-2024 02:05                9729
intlchar.getpropertyvalueenum.php                  13-Apr-2024 02:05                8357
intlchar.getpropertyvaluename.php                  13-Apr-2024 02:05               11767
intlchar.getunicodeversion.php                     13-Apr-2024 02:05                4042
intlchar.hasbinaryproperty.php                     13-Apr-2024 02:05                9494
intlchar.isalnum.php                               13-Apr-2024 02:05                6066
intlchar.isalpha.php                               13-Apr-2024 02:05                5993
intlchar.isbase.php                                13-Apr-2024 02:05                6337
intlchar.isblank.php                               13-Apr-2024 02:05                7186
intlchar.iscntrl.php                               13-Apr-2024 02:05                7011
intlchar.isdefined.php                             13-Apr-2024 02:05                7229
intlchar.isdigit.php                               13-Apr-2024 02:05                6366
intlchar.isgraph.php                               13-Apr-2024 02:05                6210
intlchar.isidignorable.php                         13-Apr-2024 02:05                6589
intlchar.isidpart.php                              13-Apr-2024 02:05                7160
intlchar.isidstart.php                             13-Apr-2024 02:05                6623
intlchar.isisocontrol.php                          13-Apr-2024 02:05                5844
intlchar.isjavaidpart.php                          13-Apr-2024 02:05                7253
intlchar.isjavaidstart.php                         13-Apr-2024 02:05                6964
intlchar.isjavaspacechar.php                       13-Apr-2024 02:05                7112
intlchar.islower.php                               13-Apr-2024 02:05                7637
intlchar.ismirrored.php                            13-Apr-2024 02:05                5890
intlchar.isprint.php                               13-Apr-2024 02:05                6381
intlchar.ispunct.php                               13-Apr-2024 02:05                5979
intlchar.isspace.php                               13-Apr-2024 02:05                6805
intlchar.istitle.php                               13-Apr-2024 02:05                7755
intlchar.isualphabetic.php                         13-Apr-2024 02:05                6165
intlchar.isulowercase.php                          13-Apr-2024 02:05                7235
intlchar.isupper.php                               13-Apr-2024 02:05                7629
intlchar.isuuppercase.php                          13-Apr-2024 02:05                7282
intlchar.isuwhitespace.php                         13-Apr-2024 02:05                7695
intlchar.iswhitespace.php                          13-Apr-2024 02:05                7558
intlchar.isxdigit.php                              13-Apr-2024 02:05                7432
intlchar.ord.php                                   13-Apr-2024 02:05                5546
intlchar.tolower.php                               13-Apr-2024 02:05                7778
intlchar.totitle.php                               13-Apr-2024 02:05                8005
intlchar.toupper.php                               13-Apr-2024 02:05                7653
intlcodepointbreakiterator.getlastcodepoint.php    13-Apr-2024 02:05                2775
intldateformatter.create.php                       13-Apr-2024 02:05               29964
intldateformatter.format.php                       13-Apr-2024 02:05               27064
intldateformatter.formatobject.php                 13-Apr-2024 02:05               15046
intldateformatter.getcalendar.php                  13-Apr-2024 02:05               11205
intldateformatter.getcalendarobject.php            13-Apr-2024 02:05                7897
intldateformatter.getdatetype.php                  13-Apr-2024 02:05               11652
intldateformatter.geterrorcode.php                 13-Apr-2024 02:05                8669
intldateformatter.geterrormessage.php              13-Apr-2024 02:05                8614
intldateformatter.getlocale.php                    13-Apr-2024 02:05               12271
intldateformatter.getpattern.php                   13-Apr-2024 02:05               10408
intldateformatter.gettimetype.php                  13-Apr-2024 02:05               11642
intldateformatter.gettimezone.php                  13-Apr-2024 02:05                8874
intldateformatter.gettimezoneid.php                13-Apr-2024 02:05                8957
intldateformatter.islenient.php                    13-Apr-2024 02:05               14794
intldateformatter.localtime.php                    13-Apr-2024 02:05               11962
intldateformatter.parse.php                        13-Apr-2024 02:05               12699
intldateformatter.setcalendar.php                  13-Apr-2024 02:05               14764
intldateformatter.setlenient.php                   13-Apr-2024 02:05               15696
intldateformatter.setpattern.php                   13-Apr-2024 02:05               11669
intldateformatter.settimezone.php                  13-Apr-2024 02:05               12794
intldatepatterngenerator.create.php                13-Apr-2024 02:05                4450
intldatepatterngenerator.getbestpattern.php        13-Apr-2024 02:05                7008
intlgregoriancalendar.construct.php                13-Apr-2024 02:05                5680
intlgregoriancalendar.createfromdate.php           13-Apr-2024 02:05                7527
intlgregoriancalendar.createfromdatetime.php       13-Apr-2024 02:05                9125
intlgregoriancalendar.getgregorianchange.php       13-Apr-2024 02:05                2726
intlgregoriancalendar.isleapyear.php               13-Apr-2024 02:05                3132
intlgregoriancalendar.setgregorianchange.php       13-Apr-2024 02:05                3112
intliterator.current.php                           13-Apr-2024 02:05                2369
intliterator.key.php                               13-Apr-2024 02:05                2342
intliterator.next.php                              13-Apr-2024 02:05                2336
intliterator.rewind.php                            13-Apr-2024 02:05                2377
intliterator.valid.php                             13-Apr-2024 02:05                2358
intlpartsiterator.getbreakiterator.php             13-Apr-2024 02:05                2603
intlrulebasedbreakiterator.construct.php           13-Apr-2024 02:05                3214
intlrulebasedbreakiterator.getbinaryrules.php      13-Apr-2024 02:05                2859
intlrulebasedbreakiterator.getrules.php            13-Apr-2024 02:05                2832
intlrulebasedbreakiterator.getrulestatus.php       13-Apr-2024 02:05                2767
intlrulebasedbreakiterator.getrulestatusvec.php    13-Apr-2024 02:05                2890
intltimezone.construct.php                         13-Apr-2024 02:05                1982
intltimezone.countequivalentids.php                13-Apr-2024 02:05                3691
intltimezone.createdefault.php                     13-Apr-2024 02:05                3050
intltimezone.createenumeration.php                 13-Apr-2024 02:05                4787
intltimezone.createtimezone.php                    13-Apr-2024 02:05                3680
intltimezone.createtimezoneidenumeration.php       13-Apr-2024 02:05                5906
intltimezone.fromdatetimezone.php                  13-Apr-2024 02:05                3800
intltimezone.getcanonicalid.php                    13-Apr-2024 02:05                4462
intltimezone.getdisplayname.php                    13-Apr-2024 02:05                5603
intltimezone.getdstsavings.php                     13-Apr-2024 02:05                3181
intltimezone.getequivalentid.php                   13-Apr-2024 02:05                4091
intltimezone.geterrorcode.php                      13-Apr-2024 02:05                3337
intltimezone.geterrormessage.php                   13-Apr-2024 02:05                3368
intltimezone.getgmt.php                            13-Apr-2024 02:05                2885
intltimezone.getid.php                             13-Apr-2024 02:05                3230
intltimezone.getidforwindowsid.php                 13-Apr-2024 02:05                6032
intltimezone.getoffset.php                         13-Apr-2024 02:05                5104
intltimezone.getrawoffset.php                      13-Apr-2024 02:05                3105
intltimezone.getregion.php                         13-Apr-2024 02:05                3743
intltimezone.gettzdataversion.php                  13-Apr-2024 02:05                3278
intltimezone.getunknown.php                        13-Apr-2024 02:05                3198
intltimezone.getwindowsid.php                      13-Apr-2024 02:05                4590
intltimezone.hassamerules.php                      13-Apr-2024 02:05                3590
intltimezone.todatetimezone.php                    13-Apr-2024 02:05                3473
intltimezone.usedaylighttime.php                   13-Apr-2024 02:05                3164
intro-whatcando.php                                13-Apr-2024 02:05                9292
intro-whatis.php                                   13-Apr-2024 02:05                4626
intro.apache.php                                   13-Apr-2024 02:05                1174
intro.apcu.php                                     13-Apr-2024 02:05                2118
intro.array.php                                    13-Apr-2024 02:05                1994
intro.bc.php                                       13-Apr-2024 02:05                4776
intro.bzip2.php                                    13-Apr-2024 02:05                1177
intro.calendar.php                                 13-Apr-2024 02:05                2330
intro.classobj.php                                 13-Apr-2024 02:05                1913
intro.cmark.php                                    13-Apr-2024 02:05                7300
intro.com.php                                      13-Apr-2024 02:05                3829
intro.componere.php                                13-Apr-2024 02:05                6626
intro.ctype.php                                    13-Apr-2024 02:05                4431
intro.cubrid.php                                   13-Apr-2024 02:05                1523
intro.curl.php                                     13-Apr-2024 02:05                1731
intro.datetime.php                                 13-Apr-2024 02:05                2903
intro.dba.php                                      13-Apr-2024 02:05                1566
intro.dbase.php                                    13-Apr-2024 02:05                6808
intro.dio.php                                      13-Apr-2024 02:05                1733
intro.dom.php                                      13-Apr-2024 02:05                1759
intro.ds.php                                       13-Apr-2024 02:05                1413
intro.eio.php                                      13-Apr-2024 02:05               15343
intro.enchant.php                                  13-Apr-2024 02:05                2858
intro.errorfunc.php                                13-Apr-2024 02:05                2179
intro.ev.php                                       13-Apr-2024 02:05                2590
intro.event.php                                    13-Apr-2024 02:05                1920
intro.exec.php                                     13-Apr-2024 02:05                1879
intro.exif.php                                     13-Apr-2024 02:05                1519
intro.expect.php                                   13-Apr-2024 02:05                1473
intro.fann.php                                     13-Apr-2024 02:05                1366
intro.fdf.php                                      13-Apr-2024 02:05                4451
intro.ffi.php                                      13-Apr-2024 02:05                2809
intro.fileinfo.php                                 13-Apr-2024 02:05                1416
intro.filesystem.php                               13-Apr-2024 02:05                1536
intro.filter.php                                   13-Apr-2024 02:05                3121
intro.fpm.php                                      13-Apr-2024 02:05                1327
intro.ftp.php                                      13-Apr-2024 02:05                1924
intro.funchand.php                                 13-Apr-2024 02:05                1164
intro.gearman.php                                  13-Apr-2024 02:05                1860
intro.gender.php                                   13-Apr-2024 02:05                1398
intro.geoip.php                                    13-Apr-2024 02:05                1611
intro.gettext.php                                  13-Apr-2024 02:05                1583
intro.gmagick.php                                  13-Apr-2024 02:05                1838
intro.gmp.php                                      13-Apr-2024 02:05                3353
intro.gnupg.php                                    13-Apr-2024 02:05                1209
intro.hash.php                                     13-Apr-2024 02:05                1297
intro.hrtime.php                                   13-Apr-2024 02:05                1619
intro.ibase.php                                    13-Apr-2024 02:05                3674
intro.ibm-db2.php                                  13-Apr-2024 02:05                1292
intro.iconv.php                                    13-Apr-2024 02:05                2201
intro.igbinary.php                                 13-Apr-2024 02:05                1790
intro.image.php                                    13-Apr-2024 02:05                7806
intro.imagick.php                                  13-Apr-2024 02:05                1863
intro.imap.php                                     13-Apr-2024 02:05                1799
intro.info.php                                     13-Apr-2024 02:05                1520
intro.inotify.php                                  13-Apr-2024 02:05                2454
intro.intl.php                                     13-Apr-2024 02:05                5285
intro.json.php                                     13-Apr-2024 02:05                1697
intro.ldap.php                                     13-Apr-2024 02:05                4615
intro.libxml.php                                   13-Apr-2024 02:05                1801
intro.lua.php                                      13-Apr-2024 02:05                1298
intro.luasandbox.php                               13-Apr-2024 02:05                2319
intro.lzf.php                                      13-Apr-2024 02:05                1558
intro.mail.php                                     13-Apr-2024 02:05                1210
intro.mailparse.php                                13-Apr-2024 02:05                2181
intro.math.php                                     13-Apr-2024 02:05                2022
intro.mbstring.php                                 13-Apr-2024 02:05                3189
intro.mcrypt.php                                   13-Apr-2024 02:05                2414
intro.memcache.php                                 13-Apr-2024 02:05                1827
intro.memcached.php                                13-Apr-2024 02:05                2043
intro.mhash.php                                    13-Apr-2024 02:05                3183
intro.misc.php                                     13-Apr-2024 02:05                1154
intro.mqseries.php                                 13-Apr-2024 02:05                1907
intro.mysql-xdevapi.php                            13-Apr-2024 02:05                2118
intro.mysql.php                                    13-Apr-2024 02:05                1986
intro.mysqli.php                                   13-Apr-2024 02:05                2380
intro.mysqlnd.php                                  13-Apr-2024 02:05                2276
intro.network.php                                  13-Apr-2024 02:05                1157
intro.oauth.php                                    13-Apr-2024 02:05                1455
intro.oci8.php                                     13-Apr-2024 02:05                1649
intro.opcache.php                                  13-Apr-2024 02:05                1594
intro.openal.php                                   13-Apr-2024 02:05                1262
intro.openssl.php                                  13-Apr-2024 02:05                1693
intro.outcontrol.php                               13-Apr-2024 02:05                1888
intro.parallel.php                                 13-Apr-2024 02:05                6844
intro.parle.php                                    13-Apr-2024 02:05                3393
intro.password.php                                 13-Apr-2024 02:05                1461
intro.pcntl.php                                    13-Apr-2024 02:05                2975
intro.pcre.php                                     13-Apr-2024 02:05                2995
intro.pdo.php                                      13-Apr-2024 02:05                2594
intro.pgsql.php                                    13-Apr-2024 02:05                1865
intro.phar.php                                     13-Apr-2024 02:05               11641
intro.phpdbg.php                                   13-Apr-2024 02:05                7125
intro.posix.php                                    13-Apr-2024 02:05                1780
intro.ps.php                                       13-Apr-2024 02:05                1944
intro.pspell.php                                   13-Apr-2024 02:05                1202
intro.pthreads.php                                 13-Apr-2024 02:05               10835
intro.quickhash.php                                13-Apr-2024 02:05                1221
intro.radius.php                                   13-Apr-2024 02:05                2225
intro.random.php                                   13-Apr-2024 02:05                1063
intro.rar.php                                      13-Apr-2024 02:05                1677
intro.readline.php                                 13-Apr-2024 02:05                2240
intro.recode.php                                   13-Apr-2024 02:05                2530
intro.reflection.php                               13-Apr-2024 02:05                2054
intro.rnp.php                                      13-Apr-2024 02:05                1234
intro.rpminfo.php                                  13-Apr-2024 02:05                1351
intro.rrd.php                                      13-Apr-2024 02:05                1390
intro.runkit7.php                                  13-Apr-2024 02:05                1433
intro.scoutapm.php                                 13-Apr-2024 02:05                1517
intro.seaslog.php                                  13-Apr-2024 02:05                3887
intro.sem.php                                      13-Apr-2024 02:05                3621
intro.session.php                                  13-Apr-2024 02:05                5524
intro.shmop.php                                    13-Apr-2024 02:05                1236
intro.simdjson.php                                 13-Apr-2024 02:05                1183
intro.simplexml.php                                13-Apr-2024 02:05                1394
intro.snmp.php                                     13-Apr-2024 02:05                1723
intro.soap.php                                     13-Apr-2024 02:05                1539
intro.sockets.php                                  13-Apr-2024 02:05                2940
intro.sodium.php                                   13-Apr-2024 02:05                1395
intro.solr.php                                     13-Apr-2024 02:05                1945
intro.spl.php                                      13-Apr-2024 02:05                1573
intro.sqlite3.php                                  13-Apr-2024 02:05                1148
intro.sqlsrv.php                                   13-Apr-2024 02:05                2322
intro.ssdeep.php                                   13-Apr-2024 02:05                1713
intro.ssh2.php                                     13-Apr-2024 02:05                1370
intro.stats.php                                    13-Apr-2024 02:05                1465
intro.stomp.php                                    13-Apr-2024 02:05                1298
intro.stream.php                                   13-Apr-2024 02:05                5265
intro.strings.php                                  13-Apr-2024 02:05                1673
intro.svm.php                                      13-Apr-2024 02:05                1274
intro.svn.php                                      13-Apr-2024 02:05                1895
intro.swoole.php                                   13-Apr-2024 02:05                1616
intro.sync.php                                     13-Apr-2024 02:05                2308
intro.taint.php                                    13-Apr-2024 02:05                4393
intro.tcpwrap.php                                  13-Apr-2024 02:05                1305
intro.tidy.php                                     13-Apr-2024 02:05                1445
intro.tokenizer.php                                13-Apr-2024 02:05                1526
intro.trader.php                                   13-Apr-2024 02:05                2342
intro.ui.php                                       13-Apr-2024 02:05                1155
intro.uodbc.php                                    13-Apr-2024 02:05                2922
intro.uopz.php                                     13-Apr-2024 02:05                2558
intro.url.php                                      13-Apr-2024 02:05                1118
intro.v8js.php                                     13-Apr-2024 02:05                1212
intro.var.php                                      13-Apr-2024 02:05                1322
intro.var_representation.php                       13-Apr-2024 02:05                1383
intro.varnish.php                                  13-Apr-2024 02:05                1380
intro.wddx.php                                     13-Apr-2024 02:05                2461
intro.win32service.php                             13-Apr-2024 02:05                1403
intro.wincache.php                                 13-Apr-2024 02:05                6100
intro.wkhtmltox.php                                13-Apr-2024 02:05                1317
intro.xattr.php                                    13-Apr-2024 02:05                1150
intro.xdiff.php                                    13-Apr-2024 02:05                3186
intro.xhprof.php                                   13-Apr-2024 02:05                3221
intro.xlswriter.php                                13-Apr-2024 02:05                1169
intro.xml.php                                      13-Apr-2024 02:05                2501
intro.xmldiff.php                                  13-Apr-2024 02:05                1365
intro.xmlreader.php                                13-Apr-2024 02:05                1643
intro.xmlrpc.php                                   13-Apr-2024 02:05                2050
intro.xmlwriter.php                                13-Apr-2024 02:05                1657
intro.xsl.php                                      13-Apr-2024 02:05                1333
intro.yac.php                                      13-Apr-2024 02:05                1156
intro.yaconf.php                                   13-Apr-2024 02:05                2832
intro.yaf.php                                      13-Apr-2024 02:05                1601
intro.yaml.php                                     13-Apr-2024 02:05                1443
intro.yar.php                                      13-Apr-2024 02:05                1225
intro.yaz.php                                      13-Apr-2024 02:05                2932
intro.zip.php                                      13-Apr-2024 02:05                1205
intro.zlib.php                                     13-Apr-2024 02:05                1753
intro.zmq.php                                      13-Apr-2024 02:05                1341
intro.zookeeper.php                                13-Apr-2024 02:05                1402
introduction.php                                   13-Apr-2024 02:05                1398
iterator.current.php                               13-Apr-2024 02:05                2149
iterator.key.php                                   13-Apr-2024 02:05                2543
iterator.next.php                                  13-Apr-2024 02:05                2395
iterator.rewind.php                                13-Apr-2024 02:05                2606
iterator.valid.php                                 13-Apr-2024 02:05                2808
iteratoraggregate.getiterator.php                  13-Apr-2024 02:05                2897
iteratoriterator.construct.php                     13-Apr-2024 02:05                3494
iteratoriterator.current.php                       13-Apr-2024 02:05                2708
iteratoriterator.getinneriterator.php              13-Apr-2024 02:05                3225
iteratoriterator.key.php                           13-Apr-2024 02:05                2666
iteratoriterator.next.php                          13-Apr-2024 02:05                2812
iteratoriterator.rewind.php                        13-Apr-2024 02:05                2836
iteratoriterator.valid.php                         13-Apr-2024 02:05                3081
json.configuration.php                             13-Apr-2024 02:05                1169
json.constants.php                                 13-Apr-2024 02:05               17494
json.installation.php                              13-Apr-2024 02:05                1916
json.requirements.php                              13-Apr-2024 02:05                1187
json.resources.php                                 13-Apr-2024 02:05                1144
json.setup.php                                     13-Apr-2024 02:05                1496
jsonserializable.jsonserialize.php                 13-Apr-2024 02:05               12264
langref.php                                        13-Apr-2024 02:05               21372
language.attributes.classes.php                    13-Apr-2024 02:05                6885
language.attributes.overview.php                   13-Apr-2024 02:05               10946
language.attributes.php                            13-Apr-2024 02:05                1802
language.attributes.reflection.php                 13-Apr-2024 02:05                8828
language.attributes.syntax.php                     13-Apr-2024 02:05                6390
language.basic-syntax.comments.php                 13-Apr-2024 02:05                4098
language.basic-syntax.instruction-separation.php   13-Apr-2024 02:05                4385
language.basic-syntax.php                          13-Apr-2024 02:05                1625
language.basic-syntax.phpmode.php                  13-Apr-2024 02:05                4819
language.basic-syntax.phptags.php                  13-Apr-2024 02:05                5316
language.constants.magic.php                       13-Apr-2024 02:05                5914
language.constants.php                             13-Apr-2024 02:05                6457
language.constants.predefined.php                  13-Apr-2024 02:05                1609
language.constants.syntax.php                      13-Apr-2024 02:05               11210
language.control-structures.php                    13-Apr-2024 02:05                2701
language.enumerations.backed.php                   13-Apr-2024 02:05               11317
language.enumerations.basics.php                   13-Apr-2024 02:05                8891
language.enumerations.constants.php                13-Apr-2024 02:05                2480
language.enumerations.examples.php                 13-Apr-2024 02:05                7591
language.enumerations.expressions.php              13-Apr-2024 02:05                6604
language.enumerations.listing.php                  13-Apr-2024 02:05                2341
language.enumerations.methods.php                  13-Apr-2024 02:05               14234
language.enumerations.object-differences.inheri..> 13-Apr-2024 02:05                6496
language.enumerations.object-differences.php       13-Apr-2024 02:05                5543
language.enumerations.overview.php                 13-Apr-2024 02:05                2584
language.enumerations.php                          13-Apr-2024 02:05                2457
language.enumerations.serialization.php            13-Apr-2024 02:05                5293
language.enumerations.static-methods.php           13-Apr-2024 02:05                3359
language.enumerations.traits.php                   13-Apr-2024 02:05                4582
language.errors.basics.php                         13-Apr-2024 02:05                5796
language.errors.php                                13-Apr-2024 02:05                1977
language.errors.php7.php                           13-Apr-2024 02:05                5947
language.exceptions.extending.php                  13-Apr-2024 02:05               19868
language.exceptions.php                            13-Apr-2024 02:05               29356
language.expressions.php                           13-Apr-2024 02:05               17028
language.fibers.php                                13-Apr-2024 02:05                6993
language.functions.php                             13-Apr-2024 02:05                1879
language.generators.comparison.php                 13-Apr-2024 02:05                9021
language.generators.overview.php                   13-Apr-2024 02:05                9732
language.generators.php                            13-Apr-2024 02:05                1832
language.generators.syntax.php                     13-Apr-2024 02:05               24843
language.namespaces.basics.php                     13-Apr-2024 02:05               11766
language.namespaces.definition.php                 13-Apr-2024 02:05                4513
language.namespaces.definitionmultiple.php         13-Apr-2024 02:05                9325
language.namespaces.dynamic.php                    13-Apr-2024 02:05                8407
language.namespaces.fallback.php                   13-Apr-2024 02:05                6134
language.namespaces.faq.php                        13-Apr-2024 02:05               32987
language.namespaces.global.php                     13-Apr-2024 02:05                2825
language.namespaces.importing.php                  13-Apr-2024 02:05               16209
language.namespaces.nested.php                     13-Apr-2024 02:05                2775
language.namespaces.nsconstants.php                13-Apr-2024 02:05                9126
language.namespaces.php                            13-Apr-2024 02:05                2290
language.namespaces.rationale.php                  13-Apr-2024 02:05                6746
language.namespaces.rules.php                      13-Apr-2024 02:05               13816
language.oop5.abstract.php                         13-Apr-2024 02:05               11123
language.oop5.anonymous.php                        13-Apr-2024 02:05               10801
language.oop5.autoload.php                         13-Apr-2024 02:05                7127
language.oop5.basic.php                            13-Apr-2024 02:05               51238
language.oop5.changelog.php                        13-Apr-2024 02:05               15789
language.oop5.cloning.php                          13-Apr-2024 02:05                9612
language.oop5.constants.php                        13-Apr-2024 02:05                9193
language.oop5.decon.php                            13-Apr-2024 02:05               31137
language.oop5.final.php                            13-Apr-2024 02:05                6127
language.oop5.inheritance.php                      13-Apr-2024 02:05               14495
language.oop5.interfaces.php                       13-Apr-2024 02:05               24522
language.oop5.iterations.php                       13-Apr-2024 02:05                5979
language.oop5.late-static-bindings.php             13-Apr-2024 02:05               15222
language.oop5.magic.php                            13-Apr-2024 02:05               45570
language.oop5.object-comparison.php                13-Apr-2024 02:05                9123
language.oop5.overloading.php                      13-Apr-2024 02:05               25573
language.oop5.paamayim-nekudotayim.php             13-Apr-2024 02:05                8958
language.oop5.php                                  13-Apr-2024 02:05                3511
language.oop5.properties.php                       13-Apr-2024 02:05               28571
language.oop5.references.php                       13-Apr-2024 02:05                6057
language.oop5.serialization.php                    13-Apr-2024 02:05                7647
language.oop5.static.php                           13-Apr-2024 02:05                9756
language.oop5.traits.php                           13-Apr-2024 02:05               36191
language.oop5.variance.php                         13-Apr-2024 02:05               16202
language.oop5.visibility.php                       13-Apr-2024 02:05               25252
language.operators.arithmetic.php                  13-Apr-2024 02:05                5723
language.operators.array.php                       13-Apr-2024 02:05                8957
language.operators.assignment.php                  13-Apr-2024 02:05               11369
language.operators.bitwise.php                     13-Apr-2024 02:05               43629
language.operators.comparison.php                  13-Apr-2024 02:05               42889
language.operators.errorcontrol.php                13-Apr-2024 02:05                6279
language.operators.execution.php                   13-Apr-2024 02:05                3426
language.operators.increment.php                   13-Apr-2024 02:05               14943
language.operators.logical.php                     13-Apr-2024 02:05                8074
language.operators.php                             13-Apr-2024 02:05                4011
language.operators.precedence.php                  13-Apr-2024 02:05               20853
language.operators.string.php                      13-Apr-2024 02:05                3005
language.operators.type.php                        13-Apr-2024 02:05               18623
language.references.arent.php                      13-Apr-2024 02:05                3490
language.references.pass.php                       13-Apr-2024 02:05                6962
language.references.php                            13-Apr-2024 02:05                2006
language.references.return.php                     13-Apr-2024 02:05                7466
language.references.spot.php                       13-Apr-2024 02:05                2742
language.references.unset.php                      13-Apr-2024 02:05                2367
language.references.whatare.php                    13-Apr-2024 02:05                2372
language.references.whatdo.php                     13-Apr-2024 02:05               19317
language.types.array.php                           13-Apr-2024 02:05              103661
language.types.boolean.php                         13-Apr-2024 02:05                9753
language.types.callable.php                        13-Apr-2024 02:05               12182
language.types.declarations.php                    13-Apr-2024 02:05               45544
language.types.enumerations.php                    13-Apr-2024 02:05                3732
language.types.float.php                           13-Apr-2024 02:05               10219
language.types.integer.php                         13-Apr-2024 02:05               20745
language.types.intro.php                           13-Apr-2024 02:05                8558
language.types.iterable.php                        13-Apr-2024 02:05                3026
language.types.mixed.php                           13-Apr-2024 02:05                1795
language.types.never.php                           13-Apr-2024 02:05                2109
language.types.null.php                            13-Apr-2024 02:05                3690
language.types.numeric-strings.php                 13-Apr-2024 02:05               11106
language.types.object.php                          13-Apr-2024 02:05                5557
language.types.php                                 13-Apr-2024 02:05                2782
language.types.relative-class-types.php            13-Apr-2024 02:05                2165
language.types.resource.php                        13-Apr-2024 02:05                3356
language.types.string.php                          13-Apr-2024 02:05               83240
language.types.type-juggling.php                   13-Apr-2024 02:05               27878
language.types.type-system.php                     13-Apr-2024 02:05                8825
language.types.value.php                           13-Apr-2024 02:05                2322
language.types.void.php                            13-Apr-2024 02:05                2030
language.variables.basics.php                      13-Apr-2024 02:05               14456
language.variables.external.php                    13-Apr-2024 02:05               18567
language.variables.php                             13-Apr-2024 02:05                1682
language.variables.predefined.php                  13-Apr-2024 02:05                3138
language.variables.scope.php                       13-Apr-2024 02:05               28984
language.variables.superglobals.php                13-Apr-2024 02:05                4521
language.variables.variable.php                    13-Apr-2024 02:05               10443
ldap.configuration.php                             13-Apr-2024 02:05                2380
ldap.constants.php                                 13-Apr-2024 02:05               34175
ldap.controls.php                                  13-Apr-2024 02:05               11048
ldap.examples-basic.php                            13-Apr-2024 02:05                8224
ldap.examples-controls.php                         13-Apr-2024 02:05               16249
ldap.examples.php                                  13-Apr-2024 02:05                1389
ldap.installation.php                              13-Apr-2024 02:05                3280
ldap.requirements.php                              13-Apr-2024 02:05                1596
ldap.resources.php                                 13-Apr-2024 02:05                1495
ldap.setup.php                                     13-Apr-2024 02:05                1527
ldap.using.php                                     13-Apr-2024 02:05                2435
libxml.configuration.php                           13-Apr-2024 02:05                1212
libxml.constants.php                               13-Apr-2024 02:05               13789
libxml.installation.php                            13-Apr-2024 02:05                2079
libxml.installation_old.php                        13-Apr-2024 02:05                2726
libxml.requirements.php                            13-Apr-2024 02:05                1390
libxml.resources.php                               13-Apr-2024 02:05                1158
libxml.setup.php                                   13-Apr-2024 02:05                1671
limititerator.construct.php                        13-Apr-2024 02:05                7474
limititerator.current.php                          13-Apr-2024 02:05                3560
limititerator.getposition.php                      13-Apr-2024 02:05                5734
limititerator.key.php                              13-Apr-2024 02:05                3578
limititerator.next.php                             13-Apr-2024 02:05                3343
limititerator.rewind.php                           13-Apr-2024 02:05                3523
limititerator.seek.php                             13-Apr-2024 02:05                4200
limititerator.valid.php                            13-Apr-2024 02:05                3593
locale.acceptfromhttp.php                          13-Apr-2024 02:05                6195
locale.canonicalize.php                            13-Apr-2024 02:05                3223
locale.composelocale.php                           13-Apr-2024 02:05               13692
locale.filtermatches.php                           13-Apr-2024 02:05                9407
locale.getallvariants.php                          13-Apr-2024 02:05                6653
locale.getdefault.php                              13-Apr-2024 02:05                5949
locale.getdisplaylanguage.php                      13-Apr-2024 02:05                9940
locale.getdisplayname.php                          13-Apr-2024 02:05               11713
locale.getdisplayregion.php                        13-Apr-2024 02:05                9896
locale.getdisplayscript.php                        13-Apr-2024 02:05                9903
locale.getdisplayvariant.php                       13-Apr-2024 02:05                9946
locale.getkeywords.php                             13-Apr-2024 02:05                7243
locale.getprimarylanguage.php                      13-Apr-2024 02:05                6118
locale.getregion.php                               13-Apr-2024 02:05                6116
locale.getscript.php                               13-Apr-2024 02:05                5740
locale.lookup.php                                  13-Apr-2024 02:05               10214
locale.parselocale.php                             13-Apr-2024 02:05                7482
locale.setdefault.php                              13-Apr-2024 02:05                5432
lua.assign.php                                     13-Apr-2024 02:05                4646
lua.call.php                                       13-Apr-2024 02:05                7561
lua.configuration.php                              13-Apr-2024 02:05                1162
lua.construct.php                                  13-Apr-2024 02:05                2410
lua.eval.php                                       13-Apr-2024 02:05                3844
lua.getversion.php                                 13-Apr-2024 02:05                2298
lua.include.php                                    13-Apr-2024 02:05                2806
lua.installation.php                               13-Apr-2024 02:05                2113
lua.registercallback.php                           13-Apr-2024 02:05                4611
lua.requirements.php                               13-Apr-2024 02:05                1322
lua.resources.php                                  13-Apr-2024 02:05                1144
lua.setup.php                                      13-Apr-2024 02:05                1483
luaclosure.invoke.php                              13-Apr-2024 02:05                4120
luasandbox.callfunction.php                        13-Apr-2024 02:05                5017
luasandbox.configuration.php                       13-Apr-2024 02:05                1211
luasandbox.disableprofiler.php                     13-Apr-2024 02:05                2838
luasandbox.enableprofiler.php                      13-Apr-2024 02:05                3458
luasandbox.examples-basic.php                      13-Apr-2024 02:05                6574
luasandbox.examples.php                            13-Apr-2024 02:05                1409
luasandbox.getcpuusage.php                         13-Apr-2024 02:05                3590
luasandbox.getmemoryusage.php                      13-Apr-2024 02:05                3168
luasandbox.getpeakmemoryusage.php                  13-Apr-2024 02:05                3218
luasandbox.getprofilerfunctionreport.php           13-Apr-2024 02:05                5950
luasandbox.getversioninfo.php                      13-Apr-2024 02:05                3085
luasandbox.installation.php                        13-Apr-2024 02:05                2207
luasandbox.loadbinary.php                          13-Apr-2024 02:05                3587
luasandbox.loadstring.php                          13-Apr-2024 02:05                5578
luasandbox.pauseusagetimer.php                     13-Apr-2024 02:05                9391
luasandbox.registerlibrary.php                     13-Apr-2024 02:05                6575
luasandbox.requirements.php                        13-Apr-2024 02:05                1731
luasandbox.resources.php                           13-Apr-2024 02:05                1209
luasandbox.setcpulimit.php                         13-Apr-2024 02:05                6104
luasandbox.setmemorylimit.php                      13-Apr-2024 02:05                5507
luasandbox.setup.php                               13-Apr-2024 02:05                1574
luasandbox.unpauseusagetimer.php                   13-Apr-2024 02:05                3134
luasandbox.wrapphpfunction.php                     13-Apr-2024 02:05                4325
luasandboxfunction.call.php                        13-Apr-2024 02:05                8005
luasandboxfunction.construct.php                   13-Apr-2024 02:05                2670
luasandboxfunction.dump.php                        13-Apr-2024 02:05                2426
lzf.configuration.php                              13-Apr-2024 02:05                1162
lzf.constants.php                                  13-Apr-2024 02:05                1082
lzf.installation.php                               13-Apr-2024 02:05                2686
lzf.requirements.php                               13-Apr-2024 02:05                1136
lzf.resources.php                                  13-Apr-2024 02:05                1137
lzf.setup.php                                      13-Apr-2024 02:05                1505
mail.configuration.php                             13-Apr-2024 02:05                8529
mail.constants.php                                 13-Apr-2024 02:05                1101
mail.installation.php                              13-Apr-2024 02:05                1203
mail.requirements.php                              13-Apr-2024 02:05                2078
mail.resources.php                                 13-Apr-2024 02:05                1144
mail.setup.php                                     13-Apr-2024 02:05                1525
mailparse.configuration.php                        13-Apr-2024 02:05                2513
mailparse.constants.php                            13-Apr-2024 02:05                2367
mailparse.installation.php                         13-Apr-2024 02:05                2766
mailparse.requirements.php                         13-Apr-2024 02:05                1178
mailparse.resources.php                            13-Apr-2024 02:05                1558
mailparse.setup.php                                13-Apr-2024 02:05                1584
manual.php                                         13-Apr-2024 02:05                1248
math.configuration.php                             13-Apr-2024 02:05                1169
math.constants.php                                 13-Apr-2024 02:05                7178
math.installation.php                              13-Apr-2024 02:05                1203
math.requirements.php                              13-Apr-2024 02:05                1143
math.resources.php                                 13-Apr-2024 02:05                1144
math.setup.php                                     13-Apr-2024 02:05                1512
mbstring.configuration.php                         13-Apr-2024 02:05               17734
mbstring.constants.php                             13-Apr-2024 02:05                7590
mbstring.encodings.php                             13-Apr-2024 02:05               16869
mbstring.http.php                                  13-Apr-2024 02:05                5641
mbstring.installation.php                          13-Apr-2024 02:05                3909
mbstring.ja-basic.php                              13-Apr-2024 02:05                4355
mbstring.overload.php                              13-Apr-2024 02:05                7553
mbstring.php4.req.php                              13-Apr-2024 02:05                4490
mbstring.requirements.php                          13-Apr-2024 02:05                1171
mbstring.resources.php                             13-Apr-2024 02:05                1172
mbstring.setup.php                                 13-Apr-2024 02:05                1598
mbstring.supported-encodings.php                   13-Apr-2024 02:05                8613
mcrypt.ciphers.php                                 13-Apr-2024 02:05                6666
mcrypt.configuration.php                           13-Apr-2024 02:05                3755
mcrypt.constants.php                               13-Apr-2024 02:05                6850
mcrypt.installation.php                            13-Apr-2024 02:05                1914
mcrypt.requirements.php                            13-Apr-2024 02:05                2334
mcrypt.resources.php                               13-Apr-2024 02:05                1267
mcrypt.setup.php                                   13-Apr-2024 02:05                1553
memcache.add.php                                   13-Apr-2024 02:05                7443
memcache.addserver.php                             13-Apr-2024 02:05               15631
memcache.close.php                                 13-Apr-2024 02:05                5383
memcache.connect.php                               13-Apr-2024 02:05                7998
memcache.constants.php                             13-Apr-2024 02:05                4797
memcache.decrement.php                             13-Apr-2024 02:05                7477
memcache.delete.php                                13-Apr-2024 02:05                6755
memcache.examples-overview.php                     13-Apr-2024 02:05                6613
memcache.examples.php                              13-Apr-2024 02:05                1356
memcache.flush.php                                 13-Apr-2024 02:05                4792
memcache.get.php                                   13-Apr-2024 02:05                9145
memcache.getextendedstats.php                      13-Apr-2024 02:05                8521
memcache.getserverstatus.php                       13-Apr-2024 02:05                6403
memcache.getstats.php                              13-Apr-2024 02:05                5088
memcache.getversion.php                            13-Apr-2024 02:05                5166
memcache.increment.php                             13-Apr-2024 02:05                7268
memcache.ini.php                                   13-Apr-2024 02:05               11433
memcache.installation.php                          13-Apr-2024 02:05                2351
memcache.pconnect.php                              13-Apr-2024 02:05                6697
memcache.replace.php                               13-Apr-2024 02:05                7532
memcache.requirements.php                          13-Apr-2024 02:05                1429
memcache.resources.php                             13-Apr-2024 02:05                1267
memcache.set.php                                   13-Apr-2024 02:05               10300
memcache.setcompressthreshold.php                  13-Apr-2024 02:05                6121
memcache.setserverparams.php                       13-Apr-2024 02:05               11971
memcache.setup.php                                 13-Apr-2024 02:05                1566
memcached.add.php                                  13-Apr-2024 02:05                4762
memcached.addbykey.php                             13-Apr-2024 02:05                5844
memcached.addserver.php                            13-Apr-2024 02:05                8327
memcached.addservers.php                           13-Apr-2024 02:05                5660
memcached.append.php                               13-Apr-2024 02:05                7696
memcached.appendbykey.php                          13-Apr-2024 02:05                5390
memcached.callbacks.php                            13-Apr-2024 02:05                1512
memcached.callbacks.read-through.php               13-Apr-2024 02:05                4698
memcached.callbacks.result.php                     13-Apr-2024 02:05                5031
memcached.cas.php                                  13-Apr-2024 02:05                9920
memcached.casbykey.php                             13-Apr-2024 02:05                6173
memcached.configuration.php                        13-Apr-2024 02:05               32754
memcached.constants.php                            13-Apr-2024 02:05               32823
memcached.construct.php                            13-Apr-2024 02:05                5893
memcached.decrement.php                            13-Apr-2024 02:05                9212
memcached.decrementbykey.php                       13-Apr-2024 02:05                6115
memcached.delete.php                               13-Apr-2024 02:05                5780
memcached.deletebykey.php                          13-Apr-2024 02:05                5864
memcached.deletemulti.php                          13-Apr-2024 02:05                5076
memcached.deletemultibykey.php                     13-Apr-2024 02:05                6139
memcached.expiration.php                           13-Apr-2024 02:05                2047
memcached.fetch.php                                13-Apr-2024 02:05                6821
memcached.fetchall.php                             13-Apr-2024 02:05                6608
memcached.flush.php                                13-Apr-2024 02:05                4905
memcached.get.php                                  13-Apr-2024 02:05               10800
memcached.getallkeys.php                           13-Apr-2024 02:05                3299
memcached.getbykey.php                             13-Apr-2024 02:05                6895
memcached.getdelayed.php                           13-Apr-2024 02:05                9095
memcached.getdelayedbykey.php                      13-Apr-2024 02:05                6021
memcached.getmulti.php                             13-Apr-2024 02:05               21287
memcached.getmultibykey.php                        13-Apr-2024 02:05                5950
memcached.getoption.php                            13-Apr-2024 02:05                5266
memcached.getresultcode.php                        13-Apr-2024 02:05                4283
memcached.getresultmessage.php                     13-Apr-2024 02:05                4776
memcached.getserverbykey.php                       13-Apr-2024 02:05                7574
memcached.getserverlist.php                        13-Apr-2024 02:05                4658
memcached.getstats.php                             13-Apr-2024 02:05                5855
memcached.getversion.php                           13-Apr-2024 02:05                4134
memcached.increment.php                            13-Apr-2024 02:05                8527
memcached.incrementbykey.php                       13-Apr-2024 02:05                6033
memcached.installation.php                         13-Apr-2024 02:05                3130
memcached.ispersistent.php                         13-Apr-2024 02:05                3088
memcached.ispristine.php                           13-Apr-2024 02:05                3051
memcached.prepend.php                              13-Apr-2024 02:05                7765
memcached.prependbykey.php                         13-Apr-2024 02:05                5457
memcached.quit.php                                 13-Apr-2024 02:05                2474
memcached.replace.php                              13-Apr-2024 02:05                4815
memcached.replacebykey.php                         13-Apr-2024 02:05                5921
memcached.requirements.php                         13-Apr-2024 02:05                1635
memcached.resetserverlist.php                      13-Apr-2024 02:05                3272
memcached.resources.php                            13-Apr-2024 02:05                1179
memcached.sessions.php                             13-Apr-2024 02:05                2799
memcached.set.php                                  13-Apr-2024 02:05                9450
memcached.setbykey.php                             13-Apr-2024 02:05                7251
memcached.setmulti.php                             13-Apr-2024 02:05                6409
memcached.setmultibykey.php                        13-Apr-2024 02:05                5197
memcached.setoption.php                            13-Apr-2024 02:05                7590
memcached.setoptions.php                           13-Apr-2024 02:05                7088
memcached.setsaslauthdata.php                      13-Apr-2024 02:05                3602
memcached.setup.php                                13-Apr-2024 02:05                1583
memcached.touch.php                                13-Apr-2024 02:05                3867
memcached.touchbykey.php                           13-Apr-2024 02:05                4874
messageformatter.create.php                        13-Apr-2024 02:05               11193
messageformatter.format.php                        13-Apr-2024 02:05                9937
messageformatter.formatmessage.php                 13-Apr-2024 02:05               14560
messageformatter.geterrorcode.php                  13-Apr-2024 02:05                3791
messageformatter.geterrormessage.php               13-Apr-2024 02:05                7696
messageformatter.getlocale.php                     13-Apr-2024 02:05                5528
messageformatter.getpattern.php                    13-Apr-2024 02:05               10116
messageformatter.parse.php                         13-Apr-2024 02:05                9624
messageformatter.parsemessage.php                  13-Apr-2024 02:05               10087
messageformatter.setpattern.php                    13-Apr-2024 02:05               10703
mhash.configuration.php                            13-Apr-2024 02:05                1176
mhash.constants.php                                13-Apr-2024 02:05                5001
mhash.examples.php                                 13-Apr-2024 02:05                3261
mhash.installation.php                             13-Apr-2024 02:05                1807
mhash.requirements.php                             13-Apr-2024 02:05                1379
mhash.resources.php                                13-Apr-2024 02:05                1151
mhash.setup.php                                    13-Apr-2024 02:05                1531
migration56.changed-functions.php                  13-Apr-2024 02:05                7447
migration56.constants.php                          13-Apr-2024 02:05                6155
migration56.deprecated.php                         13-Apr-2024 02:05                6622
migration56.extensions.php                         13-Apr-2024 02:05                4704
migration56.incompatible.php                       13-Apr-2024 02:05                9634
migration56.new-features.php                       13-Apr-2024 02:05               30221
migration56.new-functions.php                      13-Apr-2024 02:05                7525
migration56.openssl.php                            13-Apr-2024 02:05               27973
migration56.php                                    13-Apr-2024 02:05                2594
migration70.changed-functions.php                  13-Apr-2024 02:05                5739
migration70.classes.php                            13-Apr-2024 02:05                3951
migration70.constants.php                          13-Apr-2024 02:05                9522
migration70.deprecated.php                         13-Apr-2024 02:05                6064
migration70.incompatible.php                       13-Apr-2024 02:05               67294
migration70.new-features.php                       13-Apr-2024 02:05               43762
migration70.new-functions.php                      13-Apr-2024 02:05                7404
migration70.other-changes.php                      13-Apr-2024 02:05                3837
migration70.php                                    13-Apr-2024 02:05                3094
migration70.removed-exts-sapis.php                 13-Apr-2024 02:05                3211
migration70.sapi-changes.php                       13-Apr-2024 02:05                2280
migration71.changed-functions.php                  13-Apr-2024 02:05                8228
migration71.constants.php                          13-Apr-2024 02:05                8798
migration71.deprecated.php                         13-Apr-2024 02:05                2385
migration71.incompatible.php                       13-Apr-2024 02:05               36354
migration71.new-features.php                       13-Apr-2024 02:05               28676
migration71.new-functions.php                      13-Apr-2024 02:05                5045
migration71.other-changes.php                      13-Apr-2024 02:05                9733
migration71.php                                    13-Apr-2024 02:05                2613
migration71.windows-support.php                    13-Apr-2024 02:05                9284
migration72.constants.php                          13-Apr-2024 02:05               31997
migration72.deprecated.php                         13-Apr-2024 02:05               11361
migration72.incompatible.php                       13-Apr-2024 02:05               22026
migration72.new-features.php                       13-Apr-2024 02:05               20467
migration72.new-functions.php                      13-Apr-2024 02:05               24400
migration72.other-changes.php                      13-Apr-2024 02:05                6407
migration72.php                                    13-Apr-2024 02:05                2507
migration73.constants.php                          13-Apr-2024 02:05               25841
migration73.deprecated.php                         13-Apr-2024 02:05                9395
migration73.incompatible.php                       13-Apr-2024 02:05               20741
migration73.new-features.php                       13-Apr-2024 02:05               19011
migration73.new-functions.php                      13-Apr-2024 02:05                7413
migration73.other-changes.php                      13-Apr-2024 02:05               18621
migration73.php                                    13-Apr-2024 02:05                2635
migration73.windows-support.php                    13-Apr-2024 02:05                2184
migration74.constants.php                          13-Apr-2024 02:05                7813
migration74.deprecated.php                         13-Apr-2024 02:05               16977
migration74.incompatible.php                       13-Apr-2024 02:05               21085
migration74.new-classes.php                        13-Apr-2024 02:05                1535
migration74.new-features.php                       13-Apr-2024 02:05               24003
migration74.new-functions.php                      13-Apr-2024 02:05                3778
migration74.other-changes.php                      13-Apr-2024 02:05               23893
migration74.php                                    13-Apr-2024 02:05                2904
migration74.removed-extensions.php                 13-Apr-2024 02:05                2017
migration74.windows-support.php                    13-Apr-2024 02:05                4385
migration80.deprecated.php                         13-Apr-2024 02:05               20280
migration80.incompatible.php                       13-Apr-2024 02:05              112407
migration80.new-features.php                       13-Apr-2024 02:05               36428
migration80.other-changes.php                      13-Apr-2024 02:05               16917
migration80.php                                    13-Apr-2024 02:05                2480
migration81.constants.php                          13-Apr-2024 02:05                8362
migration81.deprecated.php                         13-Apr-2024 02:05               21529
migration81.incompatible.php                       13-Apr-2024 02:05               27093
migration81.new-classes.php                        13-Apr-2024 02:05                2182
migration81.new-features.php                       13-Apr-2024 02:05               26744
migration81.new-functions.php                      13-Apr-2024 02:05                8563
migration81.other-changes.php                      13-Apr-2024 02:05               11925
migration81.php                                    13-Apr-2024 02:05                2782
migration82.constants.php                          13-Apr-2024 02:05               22221
migration82.deprecated.php                         13-Apr-2024 02:05                6877
migration82.incompatible.php                       13-Apr-2024 02:05               10975
migration82.new-features.php                       13-Apr-2024 02:05                8384
migration82.new-functions.php                      13-Apr-2024 02:05                4325
migration82.other-changes.php                      13-Apr-2024 02:05               27763
migration82.php                                    13-Apr-2024 02:05                2818
migration82.windows-support.php                    13-Apr-2024 02:05                2552
migration83.constants.php                          13-Apr-2024 02:05               15644
migration83.deprecated.php                         13-Apr-2024 02:05                8539
migration83.incompatible.php                       13-Apr-2024 02:05               16767
migration83.new-classes.php                        13-Apr-2024 02:05                3423
migration83.new-features.php                       13-Apr-2024 02:05                8436
migration83.new-functions.php                      13-Apr-2024 02:05                7382
migration83.other-changes.php                      13-Apr-2024 02:05               37551
migration83.php                                    13-Apr-2024 02:05                2950
migration83.windows-support.php                    13-Apr-2024 02:05                1437
misc.configuration.php                             13-Apr-2024 02:05                6115
misc.constants.php                                 13-Apr-2024 02:05                2601
misc.installation.php                              13-Apr-2024 02:05                1203
misc.requirements.php                              13-Apr-2024 02:05                1143
misc.resources.php                                 13-Apr-2024 02:05                1144
misc.setup.php                                     13-Apr-2024 02:05                1508
mongodb-bson-binary.construct.php                  13-Apr-2024 02:05                7916
mongodb-bson-binary.getdata.php                    13-Apr-2024 02:05                4399
mongodb-bson-binary.gettype.php                    13-Apr-2024 02:05                4381
mongodb-bson-binary.jsonserialize.php              13-Apr-2024 02:05                5375
mongodb-bson-binary.serialize.php                  13-Apr-2024 02:05                3461
mongodb-bson-binary.tostring.php                   13-Apr-2024 02:05                4219
mongodb-bson-binary.unserialize.php                13-Apr-2024 02:05                4273
mongodb-bson-binaryinterface.getdata.php           13-Apr-2024 02:05                2821
mongodb-bson-binaryinterface.gettype.php           13-Apr-2024 02:05                2831
mongodb-bson-binaryinterface.tostring.php          13-Apr-2024 02:05                3322
mongodb-bson-dbpointer.construct.php               13-Apr-2024 02:05                2652
mongodb-bson-dbpointer.jsonserialize.php           13-Apr-2024 02:05                5444
mongodb-bson-dbpointer.serialize.php               13-Apr-2024 02:05                3536
mongodb-bson-dbpointer.tostring.php                13-Apr-2024 02:05                2663
mongodb-bson-dbpointer.unserialize.php             13-Apr-2024 02:05                3772
mongodb-bson-decimal128.construct.php              13-Apr-2024 02:05                5763
mongodb-bson-decimal128.jsonserialize.php          13-Apr-2024 02:05                5465
mongodb-bson-decimal128.serialize.php              13-Apr-2024 02:05                3561
mongodb-bson-decimal128.tostring.php               13-Apr-2024 02:05                4540
mongodb-bson-decimal128.unserialize.php            13-Apr-2024 02:05                4365
mongodb-bson-decimal128interface.tostring.php      13-Apr-2024 02:05                2984
mongodb-bson-document.construct.php                13-Apr-2024 02:05                3266
mongodb-bson-document.frombson.php                 13-Apr-2024 02:05                4020
mongodb-bson-document.fromjson.php                 13-Apr-2024 02:05                4533
mongodb-bson-document.fromphp.php                  13-Apr-2024 02:05                4255
mongodb-bson-document.get.php                      13-Apr-2024 02:05                4221
mongodb-bson-document.getiterator.php              13-Apr-2024 02:05                3503
mongodb-bson-document.has.php                      13-Apr-2024 02:05                3745
mongodb-bson-document.serialize.php                13-Apr-2024 02:05                3525
mongodb-bson-document.tocanonicalextendedjson.php  13-Apr-2024 02:05               12713
mongodb-bson-document.tophp.php                    13-Apr-2024 02:05                5399
mongodb-bson-document.torelaxedextendedjson.php    13-Apr-2024 02:05               12430
mongodb-bson-document.tostring.php                 13-Apr-2024 02:05                2737
mongodb-bson-document.unserialize.php              13-Apr-2024 02:05                4321
mongodb-bson-int64.construct.php                   13-Apr-2024 02:05                4736
mongodb-bson-int64.jsonserialize.php               13-Apr-2024 02:05                5119
mongodb-bson-int64.serialize.php                   13-Apr-2024 02:05                3438
mongodb-bson-int64.tostring.php                    13-Apr-2024 02:05                3858
mongodb-bson-int64.unserialize.php                 13-Apr-2024 02:05                4244
mongodb-bson-iterator.construct.php                13-Apr-2024 02:05                3354
mongodb-bson-iterator.current.php                  13-Apr-2024 02:05                3596
mongodb-bson-iterator.key.php                      13-Apr-2024 02:05                3589
mongodb-bson-iterator.next.php                     13-Apr-2024 02:05                2378
mongodb-bson-iterator.rewind.php                   13-Apr-2024 02:05                2433
mongodb-bson-iterator.valid.php                    13-Apr-2024 02:05                2810
mongodb-bson-javascript.construct.php              13-Apr-2024 02:05                7227
mongodb-bson-javascript.getcode.php                13-Apr-2024 02:05                4371
mongodb-bson-javascript.getscope.php               13-Apr-2024 02:05                5347
mongodb-bson-javascript.jsonserialize.php          13-Apr-2024 02:05                5461
mongodb-bson-javascript.serialize.php              13-Apr-2024 02:05                3561
mongodb-bson-javascript.tostring.php               13-Apr-2024 02:05                4213
mongodb-bson-javascript.unserialize.php            13-Apr-2024 02:05                4357
mongodb-bson-javascriptinterface.getcode.php       13-Apr-2024 02:05                2915
mongodb-bson-javascriptinterface.getscope.php      13-Apr-2024 02:05                3080
mongodb-bson-javascriptinterface.tostring.php      13-Apr-2024 02:05                3420
mongodb-bson-maxkey.construct.php                  13-Apr-2024 02:05                3632
mongodb-bson-maxkey.jsonserialize.php              13-Apr-2024 02:05                5381
mongodb-bson-maxkey.serialize.php                  13-Apr-2024 02:05                3465
mongodb-bson-maxkey.unserialize.php                13-Apr-2024 02:05                3705
mongodb-bson-minkey.construct.php                  13-Apr-2024 02:05                3632
mongodb-bson-minkey.jsonserialize.php              13-Apr-2024 02:05                5381
mongodb-bson-minkey.serialize.php                  13-Apr-2024 02:05                3465
mongodb-bson-minkey.unserialize.php                13-Apr-2024 02:05                3709
mongodb-bson-objectid.construct.php                13-Apr-2024 02:05                5251
mongodb-bson-objectid.gettimestamp.php             13-Apr-2024 02:05                5484
mongodb-bson-objectid.jsonserialize.php            13-Apr-2024 02:05                5427
mongodb-bson-objectid.serialize.php                13-Apr-2024 02:05                3513
mongodb-bson-objectid.tostring.php                 13-Apr-2024 02:05                4186
mongodb-bson-objectid.unserialize.php              13-Apr-2024 02:05                4311
mongodb-bson-objectidinterface.gettimestamp.php    13-Apr-2024 02:05                2984
mongodb-bson-objectidinterface.tostring.php        13-Apr-2024 02:05                2968
mongodb-bson-packedarray.construct.php             13-Apr-2024 02:05                2886
mongodb-bson-packedarray.fromphp.php               13-Apr-2024 02:05                3936
mongodb-bson-packedarray.get.php                   13-Apr-2024 02:05                4272
mongodb-bson-packedarray.getiterator.php           13-Apr-2024 02:05                3557
mongodb-bson-packedarray.has.php                   13-Apr-2024 02:05                3799
mongodb-bson-packedarray.serialize.php             13-Apr-2024 02:05                3557
mongodb-bson-packedarray.tophp.php                 13-Apr-2024 02:05                4618
mongodb-bson-packedarray.tostring.php              13-Apr-2024 02:05                2753
mongodb-bson-packedarray.unserialize.php           13-Apr-2024 02:05                4377
mongodb-bson-persistable.bsonserialize.php         13-Apr-2024 02:05                6126
mongodb-bson-regex.construct.php                   13-Apr-2024 02:05                6990
mongodb-bson-regex.getflags.php                    13-Apr-2024 02:05                4497
mongodb-bson-regex.getpattern.php                  13-Apr-2024 02:05                4359
mongodb-bson-regex.jsonserialize.php               13-Apr-2024 02:05                5360
mongodb-bson-regex.serialize.php                   13-Apr-2024 02:05                3436
mongodb-bson-regex.tostring.php                    13-Apr-2024 02:05                3878
mongodb-bson-regex.unserialize.php                 13-Apr-2024 02:05                4248
mongodb-bson-regexinterface.getflags.php           13-Apr-2024 02:05                2820
mongodb-bson-regexinterface.getpattern.php         13-Apr-2024 02:05                2863
mongodb-bson-regexinterface.tostring.php           13-Apr-2024 02:05                2894
mongodb-bson-serializable.bsonserialize.php        13-Apr-2024 02:05               16601
mongodb-bson-symbol.construct.php                  13-Apr-2024 02:05                2592
mongodb-bson-symbol.jsonserialize.php              13-Apr-2024 02:05                5381
mongodb-bson-symbol.serialize.php                  13-Apr-2024 02:05                3461
mongodb-bson-symbol.tostring.php                   13-Apr-2024 02:05                2641
mongodb-bson-symbol.unserialize.php                13-Apr-2024 02:05                3711
mongodb-bson-timestamp.construct.php               13-Apr-2024 02:05                4794
mongodb-bson-timestamp.getincrement.php            13-Apr-2024 02:05                4287
mongodb-bson-timestamp.gettimestamp.php            13-Apr-2024 02:05                4272
mongodb-bson-timestamp.jsonserialize.php           13-Apr-2024 02:05                5448
mongodb-bson-timestamp.serialize.php               13-Apr-2024 02:05                3536
mongodb-bson-timestamp.tostring.php                13-Apr-2024 02:05                4028
mongodb-bson-timestamp.unserialize.php             13-Apr-2024 02:05                4344
mongodb-bson-timestampinterface.getincrement.php   13-Apr-2024 02:05                3347
mongodb-bson-timestampinterface.gettimestamp.php   13-Apr-2024 02:05                3362
mongodb-bson-timestampinterface.tostring.php       13-Apr-2024 02:05                2986
mongodb-bson-undefined.construct.php               13-Apr-2024 02:05                2652
mongodb-bson-undefined.jsonserialize.php           13-Apr-2024 02:05                5444
mongodb-bson-undefined.serialize.php               13-Apr-2024 02:05                3536
mongodb-bson-undefined.tostring.php                13-Apr-2024 02:05                2663
mongodb-bson-undefined.unserialize.php             13-Apr-2024 02:05                3773
mongodb-bson-unserializable.bsonunserialize.php    13-Apr-2024 02:05                7037
mongodb-bson-utcdatetime.construct.php             13-Apr-2024 02:05                8146
mongodb-bson-utcdatetime.jsonserialize.php         13-Apr-2024 02:05                5486
mongodb-bson-utcdatetime.serialize.php             13-Apr-2024 02:05                3588
mongodb-bson-utcdatetime.todatetime.php            13-Apr-2024 02:05                5828
mongodb-bson-utcdatetime.tostring.php              13-Apr-2024 02:05                3976
mongodb-bson-utcdatetime.unserialize.php           13-Apr-2024 02:05                4376
mongodb-bson-utcdatetimeinterface.todatetime.php   13-Apr-2024 02:05                3263
mongodb-bson-utcdatetimeinterface.tostring.php     13-Apr-2024 02:05                3002
mongodb-driver-bulkwrite.construct.php             13-Apr-2024 02:05               18630
mongodb-driver-bulkwrite.count.php                 13-Apr-2024 02:05                6927
mongodb-driver-bulkwrite.delete.php                13-Apr-2024 02:05               11994
mongodb-driver-bulkwrite.insert.php                13-Apr-2024 02:05                9587
mongodb-driver-bulkwrite.update.php                13-Apr-2024 02:05               15604
mongodb-driver-clientencryption.addkeyaltname.php  13-Apr-2024 02:05                5523
mongodb-driver-clientencryption.construct.php      13-Apr-2024 02:05               11250
mongodb-driver-clientencryption.createdatakey.php  13-Apr-2024 02:05               10963
mongodb-driver-clientencryption.decrypt.php        13-Apr-2024 02:05                4164
mongodb-driver-clientencryption.deletekey.php      13-Apr-2024 02:05                4271
mongodb-driver-clientencryption.encrypt.php        13-Apr-2024 02:05               12784
mongodb-driver-clientencryption.encryptexpressi..> 13-Apr-2024 02:05               14491
mongodb-driver-clientencryption.getkey.php         13-Apr-2024 02:05                4404
mongodb-driver-clientencryption.getkeybyaltname..> 13-Apr-2024 02:05                4993
mongodb-driver-clientencryption.getkeys.php        13-Apr-2024 02:05                3842
mongodb-driver-clientencryption.removekeyaltnam..> 13-Apr-2024 02:05                5588
mongodb-driver-clientencryption.rewrapmanydatak..> 13-Apr-2024 02:05               12139
mongodb-driver-command.construct.php               13-Apr-2024 02:05               14234
mongodb-driver-commandexception.getresultdocume..> 13-Apr-2024 02:05                3236
mongodb-driver-cursor.construct.php                13-Apr-2024 02:05                3326
mongodb-driver-cursor.current.php                  13-Apr-2024 02:05                3080
mongodb-driver-cursor.getid.php                    13-Apr-2024 02:05                7599
mongodb-driver-cursor.getserver.php                13-Apr-2024 02:05                7492
mongodb-driver-cursor.isdead.php                   13-Apr-2024 02:05               10608
mongodb-driver-cursor.key.php                      13-Apr-2024 02:05                2633
mongodb-driver-cursor.next.php                     13-Apr-2024 02:05                3480
mongodb-driver-cursor.rewind.php                   13-Apr-2024 02:05                3951
mongodb-driver-cursor.settypemap.php               13-Apr-2024 02:05                7944
mongodb-driver-cursor.toarray.php                  13-Apr-2024 02:05                7685
mongodb-driver-cursor.valid.php                    13-Apr-2024 02:05                2835
mongodb-driver-cursorid.construct.php              13-Apr-2024 02:05                2814
mongodb-driver-cursorid.serialize.php              13-Apr-2024 02:05                3559
mongodb-driver-cursorid.tostring.php               13-Apr-2024 02:05                6982
mongodb-driver-cursorid.unserialize.php            13-Apr-2024 02:05                4383
mongodb-driver-cursorinterface.getid.php           13-Apr-2024 02:05                3997
mongodb-driver-cursorinterface.getserver.php       13-Apr-2024 02:05                4098
mongodb-driver-cursorinterface.isdead.php          13-Apr-2024 02:05                4061
mongodb-driver-cursorinterface.settypemap.php      13-Apr-2024 02:05                4076
mongodb-driver-cursorinterface.toarray.php         13-Apr-2024 02:05                3960
mongodb-driver-manager.addsubscriber.php           13-Apr-2024 02:05                5505
mongodb-driver-manager.construct.php               13-Apr-2024 02:05               80057
mongodb-driver-manager.createclientencryption.php  13-Apr-2024 02:05               12576
mongodb-driver-manager.executebulkwrite.php        13-Apr-2024 02:05               22810
mongodb-driver-manager.executecommand.php          13-Apr-2024 02:05               24837
mongodb-driver-manager.executequery.php            13-Apr-2024 02:05               16218
mongodb-driver-manager.executereadcommand.php      13-Apr-2024 02:05               10208
mongodb-driver-manager.executereadwritecommand.php 13-Apr-2024 02:05               11183
mongodb-driver-manager.executewritecommand.php     13-Apr-2024 02:05               11260
mongodb-driver-manager.getencryptedfieldsmap.php   13-Apr-2024 02:05                3895
mongodb-driver-manager.getreadconcern.php          13-Apr-2024 02:05                5896
mongodb-driver-manager.getreadpreference.php       13-Apr-2024 02:05                6491
mongodb-driver-manager.getservers.php              13-Apr-2024 02:05                7934
mongodb-driver-manager.getwriteconcern.php         13-Apr-2024 02:05                5949
mongodb-driver-manager.removesubscriber.php        13-Apr-2024 02:05                4897
mongodb-driver-manager.selectserver.php            13-Apr-2024 02:05                7172
mongodb-driver-manager.startsession.php            13-Apr-2024 02:05               12569
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:05                3699
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:05                3792
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:05                3623
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:05                4823
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:05                4014
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:05                4250
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:05                4176
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:05                4023
mongodb-driver-monitoring-commandfailedevent.ge..> 13-Apr-2024 02:05                3807
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:05                4021
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:05                3731
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:05                3633
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:05                5132
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:05                4711
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:05                4467
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:05                4043
mongodb-driver-monitoring-commandstartedevent.g..> 13-Apr-2024 02:05                3827
mongodb-driver-monitoring-commandsubscriber.com..> 13-Apr-2024 02:05                4877
mongodb-driver-monitoring-commandsubscriber.com..> 13-Apr-2024 02:05                4927
mongodb-driver-monitoring-commandsubscriber.com..> 13-Apr-2024 02:05                4940
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:05                3756
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:05                3861
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:05                4910
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:05                4071
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:05                4313
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:05                4681
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:05                4083
mongodb-driver-monitoring-commandsucceededevent..> 13-Apr-2024 02:05                3853
mongodb-driver-monitoring-logsubscriber.log.php    13-Apr-2024 02:05                4607
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:05                4760
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:05                4730
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:05                5297
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:05                5342
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:05                5373
mongodb-driver-monitoring-sdamsubscriber.server..> 13-Apr-2024 02:05                4760
mongodb-driver-monitoring-sdamsubscriber.topolo..> 13-Apr-2024 02:05                4835
mongodb-driver-monitoring-sdamsubscriber.topolo..> 13-Apr-2024 02:05                4772
mongodb-driver-monitoring-sdamsubscriber.topolo..> 13-Apr-2024 02:05                4755
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:05                3172
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:05                3488
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:05                3240
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:05                3565
mongodb-driver-monitoring-serverchangedevent.ge..> 13-Apr-2024 02:05                3288
mongodb-driver-monitoring-serverclosedevent.get..> 13-Apr-2024 02:05                3134
mongodb-driver-monitoring-serverclosedevent.get..> 13-Apr-2024 02:05                3184
mongodb-driver-monitoring-serverclosedevent.get..> 13-Apr-2024 02:05                3244
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:05                3620
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:05                3472
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:05                3309
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:05                3338
mongodb-driver-monitoring-serverheartbeatfailed..> 13-Apr-2024 02:05                3694
mongodb-driver-monitoring-serverheartbeatstarte..> 13-Apr-2024 02:05                3314
mongodb-driver-monitoring-serverheartbeatstarte..> 13-Apr-2024 02:05                3356
mongodb-driver-monitoring-serverheartbeatstarte..> 13-Apr-2024 02:05                3714
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:05                3672
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:05                3381
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:05                3390
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:05                4208
mongodb-driver-monitoring-serverheartbeatsuccee..> 13-Apr-2024 02:05                3730
mongodb-driver-monitoring-serveropeningevent.ge..> 13-Apr-2024 02:05                3152
mongodb-driver-monitoring-serveropeningevent.ge..> 13-Apr-2024 02:05                3202
mongodb-driver-monitoring-serveropeningevent.ge..> 13-Apr-2024 02:05                3276
mongodb-driver-monitoring-topologychangedevent...> 13-Apr-2024 02:05                3557
mongodb-driver-monitoring-topologychangedevent...> 13-Apr-2024 02:05                3635
mongodb-driver-monitoring-topologychangedevent...> 13-Apr-2024 02:05                3296
mongodb-driver-monitoring-topologyclosedevent.g..> 13-Apr-2024 02:05                3241
mongodb-driver-monitoring-topologyopeningevent...> 13-Apr-2024 02:05                3251
mongodb-driver-query.construct.php                 13-Apr-2024 02:05               32802
mongodb-driver-readconcern.bsonserialize.php       13-Apr-2024 02:05                6787
mongodb-driver-readconcern.construct.php           13-Apr-2024 02:05                5681
mongodb-driver-readconcern.getlevel.php            13-Apr-2024 02:05                5776
mongodb-driver-readconcern.isdefault.php           13-Apr-2024 02:05                8050
mongodb-driver-readconcern.serialize.php           13-Apr-2024 02:05                3636
mongodb-driver-readconcern.unserialize.php         13-Apr-2024 02:05                4434
mongodb-driver-readpreference.bsonserialize.php    13-Apr-2024 02:05               10439
mongodb-driver-readpreference.construct.php        13-Apr-2024 02:05               18413
mongodb-driver-readpreference.gethedge.php         13-Apr-2024 02:05                3407
mongodb-driver-readpreference.getmaxstalenessse..> 13-Apr-2024 02:05                8148
mongodb-driver-readpreference.getmode.php          13-Apr-2024 02:05                7472
mongodb-driver-readpreference.getmodestring.php    13-Apr-2024 02:05                7678
mongodb-driver-readpreference.gettagsets.php       13-Apr-2024 02:05                8033
mongodb-driver-readpreference.serialize.php        13-Apr-2024 02:05                3713
mongodb-driver-readpreference.unserialize.php      13-Apr-2024 02:05                4513
mongodb-driver-runtimeexception.haserrorlabel.php  13-Apr-2024 02:05                4240
mongodb-driver-server.construct.php                13-Apr-2024 02:05                3358
mongodb-driver-server.executebulkwrite.php         13-Apr-2024 02:05               11090
mongodb-driver-server.executecommand.php           13-Apr-2024 02:05               13129
mongodb-driver-server.executequery.php             13-Apr-2024 02:05                8446
mongodb-driver-server.executereadcommand.php       13-Apr-2024 02:05               10532
mongodb-driver-server.executereadwritecommand.php  13-Apr-2024 02:05               11697
mongodb-driver-server.executewritecommand.php      13-Apr-2024 02:05               11740
mongodb-driver-server.gethost.php                  13-Apr-2024 02:05                5439
mongodb-driver-server.getinfo.php                  13-Apr-2024 02:05               10604
mongodb-driver-server.getlatency.php               13-Apr-2024 02:05                7117
mongodb-driver-server.getport.php                  13-Apr-2024 02:05                5481
mongodb-driver-server.getserverdescription.php     13-Apr-2024 02:05                3412
mongodb-driver-server.gettags.php                  13-Apr-2024 02:05                3768
mongodb-driver-server.gettype.php                  13-Apr-2024 02:05                3804
mongodb-driver-server.isarbiter.php                13-Apr-2024 02:05                3621
mongodb-driver-server.ishidden.php                 13-Apr-2024 02:05                3615
mongodb-driver-server.ispassive.php                13-Apr-2024 02:05                3683
mongodb-driver-server.isprimary.php                13-Apr-2024 02:05                3628
mongodb-driver-server.issecondary.php              13-Apr-2024 02:05                3663
mongodb-driver-serverapi.bsonserialize.php         13-Apr-2024 02:05                3290
mongodb-driver-serverapi.construct.php             13-Apr-2024 02:05                5188
mongodb-driver-serverapi.serialize.php             13-Apr-2024 02:05                3589
mongodb-driver-serverapi.unserialize.php           13-Apr-2024 02:05                4401
mongodb-driver-serverdescription.gethellorespon..> 13-Apr-2024 02:05                5181
mongodb-driver-serverdescription.gethost.php       13-Apr-2024 02:05                3430
mongodb-driver-serverdescription.getlastupdatet..> 13-Apr-2024 02:05                3589
mongodb-driver-serverdescription.getport.php       13-Apr-2024 02:05                3485
mongodb-driver-serverdescription.getroundtripti..> 13-Apr-2024 02:05                3884
mongodb-driver-serverdescription.gettype.php       13-Apr-2024 02:05                3820
mongodb-driver-session.aborttransaction.php        13-Apr-2024 02:05                4185
mongodb-driver-session.advanceclustertime.php      13-Apr-2024 02:05                4844
mongodb-driver-session.advanceoperationtime.php    13-Apr-2024 02:05                4784
mongodb-driver-session.committransaction.php       13-Apr-2024 02:05                5541
mongodb-driver-session.construct.php               13-Apr-2024 02:05                2881
mongodb-driver-session.endsession.php              13-Apr-2024 02:05                4319
mongodb-driver-session.getclustertime.php          13-Apr-2024 02:05                3958
mongodb-driver-session.getlogicalsessionid.php     13-Apr-2024 02:05                3122
mongodb-driver-session.getoperationtime.php        13-Apr-2024 02:05                4038
mongodb-driver-session.getserver.php               13-Apr-2024 02:05                3937
mongodb-driver-session.gettransactionoptions.php   13-Apr-2024 02:05                3813
mongodb-driver-session.gettransactionstate.php     13-Apr-2024 02:05                3717
mongodb-driver-session.isdirty.php                 13-Apr-2024 02:05                3007
mongodb-driver-session.isintransaction.php         13-Apr-2024 02:05                3779
mongodb-driver-session.starttransaction.php        13-Apr-2024 02:05                9049
mongodb-driver-topologydescription.getservers.php  13-Apr-2024 02:05                3449
mongodb-driver-topologydescription.gettype.php     13-Apr-2024 02:05                3497
mongodb-driver-topologydescription.hasreadables..> 13-Apr-2024 02:05                3936
mongodb-driver-topologydescription.haswritables..> 13-Apr-2024 02:05                3217
mongodb-driver-writeconcern.bsonserialize.php      13-Apr-2024 02:05                7232
mongodb-driver-writeconcern.construct.php          13-Apr-2024 02:05               10483
mongodb-driver-writeconcern.getjournal.php         13-Apr-2024 02:05                5962
mongodb-driver-writeconcern.getw.php               13-Apr-2024 02:05                5252
mongodb-driver-writeconcern.getwtimeout.php        13-Apr-2024 02:05                5879
mongodb-driver-writeconcern.isdefault.php          13-Apr-2024 02:05                7837
mongodb-driver-writeconcern.serialize.php          13-Apr-2024 02:05                3661
mongodb-driver-writeconcern.unserialize.php        13-Apr-2024 02:05                4473
mongodb-driver-writeconcernerror.getcode.php       13-Apr-2024 02:05                6306
mongodb-driver-writeconcernerror.getinfo.php       13-Apr-2024 02:05                6632
mongodb-driver-writeconcernerror.getmessage.php    13-Apr-2024 02:05                6397
mongodb-driver-writeerror.getcode.php              13-Apr-2024 02:05                5655
mongodb-driver-writeerror.getindex.php             13-Apr-2024 02:05                6177
mongodb-driver-writeerror.getinfo.php              13-Apr-2024 02:05                3119
mongodb-driver-writeerror.getmessage.php           13-Apr-2024 02:05                5791
mongodb-driver-writeexception.getwriteresult.php   13-Apr-2024 02:05                7907
mongodb-driver-writeresult.getdeletedcount.php     13-Apr-2024 02:05                8131
mongodb-driver-writeresult.getinsertedcount.php    13-Apr-2024 02:05                8213
mongodb-driver-writeresult.getmatchedcount.php     13-Apr-2024 02:05                8776
mongodb-driver-writeresult.getmodifiedcount.php    13-Apr-2024 02:05                9074
mongodb-driver-writeresult.getserver.php           13-Apr-2024 02:05                6506
mongodb-driver-writeresult.getupsertedcount.php    13-Apr-2024 02:05                8302
mongodb-driver-writeresult.getupsertedids.php      13-Apr-2024 02:05                8794
mongodb-driver-writeresult.getwriteconcernerror..> 13-Apr-2024 02:05                7184
mongodb-driver-writeresult.getwriteerrors.php      13-Apr-2024 02:05               13015
mongodb-driver-writeresult.isacknowledged.php      13-Apr-2024 02:05                8159
mongodb.architecture.php                           13-Apr-2024 02:05                1922
mongodb.configuration.php                          13-Apr-2024 02:05                3931
mongodb.connection-handling.php                    13-Apr-2024 02:05                8666
mongodb.constants.php                              13-Apr-2024 02:05                2125
mongodb.exceptions.php                             13-Apr-2024 02:05                5149
mongodb.exceptions.tree.php                        13-Apr-2024 02:05                5559
mongodb.installation.homebrew.php                  13-Apr-2024 02:05                1987
mongodb.installation.manual.php                    13-Apr-2024 02:05                6110
mongodb.installation.pecl.php                      13-Apr-2024 02:05                5031
mongodb.installation.php                           13-Apr-2024 02:05                1778
mongodb.installation.windows.php                   13-Apr-2024 02:05                4562
mongodb.monitoring.php                             13-Apr-2024 02:05               18958
mongodb.overview.php                               13-Apr-2024 02:05                4599
mongodb.persistence.deserialization.php            13-Apr-2024 02:05               21780
mongodb.persistence.php                            13-Apr-2024 02:05                1797
mongodb.persistence.serialization.php              13-Apr-2024 02:05               20074
mongodb.requirements.php                           13-Apr-2024 02:05                3114
mongodb.security.php                               13-Apr-2024 02:05                1484
mongodb.security.request_injection.php             13-Apr-2024 02:05                2970
mongodb.security.script_injection.php              13-Apr-2024 02:05                9159
mongodb.setup.php                                  13-Apr-2024 02:05                2006
mongodb.tutorial.apm.php                           13-Apr-2024 02:05               18727
mongodb.tutorial.library.php                       13-Apr-2024 02:05               10666
mongodb.tutorial.php                               13-Apr-2024 02:05                1692
mqseries.configure.php                             13-Apr-2024 02:05                3213
mqseries.constants.php                             13-Apr-2024 02:05                2226
mqseries.ini.php                                   13-Apr-2024 02