Index of /php/manual/it/


../
feeds/                                             14-Apr-2024 10:04                   -
images/                                            14-Apr-2024 10:04                   -
styles/                                            14-Apr-2024 10:04                   -
toc/                                               14-Apr-2024 10:04                   -
about.formats.php                                  14-Apr-2024 10:04                4308
about.generate.php                                 14-Apr-2024 10:04                2794
about.howtohelp.php                                14-Apr-2024 10:04                3403
about.more.php                                     14-Apr-2024 10:04                1864
about.notes.php                                    14-Apr-2024 10:04                2452
about.php                                          14-Apr-2024 10:04                1882
about.phpversions.php                              14-Apr-2024 10:04                3504
about.prototypes.php                               14-Apr-2024 10:04                7763
about.translations.php                             14-Apr-2024 10:04                3206
aliases.php                                        14-Apr-2024 10:04               29210
allowdynamicproperties.construct.php               14-Apr-2024 10:04                2215
apache.configuration.php                           14-Apr-2024 10:04                5322
apache.constants.php                               14-Apr-2024 10:04                1124
apache.installation.php                            14-Apr-2024 10:04                1250
apache.requirements.php                            14-Apr-2024 10:04                1176
apache.resources.php                               14-Apr-2024 10:04                1179
apache.setup.php                                   14-Apr-2024 10:04                1568
apcu.configuration.php                             14-Apr-2024 10:04               15860
apcu.constants.php                                 14-Apr-2024 10:04                7353
apcu.installation.php                              14-Apr-2024 10:04                3237
apcu.requirements.php                              14-Apr-2024 10:04                1162
apcu.resources.php                                 14-Apr-2024 10:04                1165
apcu.setup.php                                     14-Apr-2024 10:04                1526
apcuiterator.construct.php                         14-Apr-2024 10:04                7082
apcuiterator.current.php                           14-Apr-2024 10:04                2964
apcuiterator.gettotalcount.php                     14-Apr-2024 10:04                3155
apcuiterator.gettotalhits.php                      14-Apr-2024 10:04                3291
apcuiterator.gettotalsize.php                      14-Apr-2024 10:04                3032
apcuiterator.key.php                               14-Apr-2024 10:04                2763
apcuiterator.next.php                              14-Apr-2024 10:04                3035
apcuiterator.rewind.php                            14-Apr-2024 10:04                2688
apcuiterator.valid.php                             14-Apr-2024 10:04                2901
appendices.php                                     14-Apr-2024 10:04               12189
appenditerator.append.php                          14-Apr-2024 10:04                5409
appenditerator.construct.php                       14-Apr-2024 10:04               10080
appenditerator.current.php                         14-Apr-2024 10:04                3425
appenditerator.getarrayiterator.php                14-Apr-2024 10:04                3051
appenditerator.getiteratorindex.php                14-Apr-2024 10:04                6581
appenditerator.key.php                             14-Apr-2024 10:04                7835
appenditerator.next.php                            14-Apr-2024 10:04                3327
appenditerator.rewind.php                          14-Apr-2024 10:04                3323
appenditerator.valid.php                           14-Apr-2024 10:04                3312
array.configuration.php                            14-Apr-2024 10:04                1233
array.constants.php                                14-Apr-2024 10:04               10386
array.installation.php                             14-Apr-2024 10:04                1212
array.requirements.php                             14-Apr-2024 10:04                1169
array.resources.php                                14-Apr-2024 10:04                1172
array.setup.php                                    14-Apr-2024 10:04                1535
array.sorting.php                                  14-Apr-2024 10:04                6702
arrayaccess.offsetexists.php                       14-Apr-2024 10:04                9051
arrayaccess.offsetget.php                          14-Apr-2024 10:04                4821
arrayaccess.offsetset.php                          14-Apr-2024 10:04                5102
arrayaccess.offsetunset.php                        14-Apr-2024 10:04                2781
arrayiterator.append.php                           14-Apr-2024 10:04                3504
arrayiterator.asort.php                            14-Apr-2024 10:04                7061
arrayiterator.construct.php                        14-Apr-2024 10:04                3755
arrayiterator.count.php                            14-Apr-2024 10:04                3220
arrayiterator.current.php                          14-Apr-2024 10:04                5160
arrayiterator.getarraycopy.php                     14-Apr-2024 10:04                3067
arrayiterator.getflags.php                         14-Apr-2024 10:04                3047
arrayiterator.key.php                              14-Apr-2024 10:04                3969
arrayiterator.ksort.php                            14-Apr-2024 10:04                7039
arrayiterator.natcasesort.php                      14-Apr-2024 10:04                4688
arrayiterator.natsort.php                          14-Apr-2024 10:04                4590
arrayiterator.next.php                             14-Apr-2024 10:04                4600
arrayiterator.offsetexists.php                     14-Apr-2024 10:04                3306
arrayiterator.offsetget.php                        14-Apr-2024 10:04                3334
arrayiterator.offsetset.php                        14-Apr-2024 10:04                3607
arrayiterator.offsetunset.php                      14-Apr-2024 10:04                3734
arrayiterator.rewind.php                           14-Apr-2024 10:04                4587
arrayiterator.seek.php                             14-Apr-2024 10:04                2599
arrayiterator.serialize.php                        14-Apr-2024 10:04                2862
arrayiterator.setflags.php                         14-Apr-2024 10:04                4099
arrayiterator.uasort.php                           14-Apr-2024 10:04                6294
arrayiterator.uksort.php                           14-Apr-2024 10:04                6211
arrayiterator.unserialize.php                      14-Apr-2024 10:04                3110
arrayiterator.valid.php                            14-Apr-2024 10:04                4649
arrayobject.append.php                             14-Apr-2024 10:04                5445
arrayobject.asort.php                              14-Apr-2024 10:04                9950
arrayobject.construct.php                          14-Apr-2024 10:04                6221
arrayobject.count.php                              14-Apr-2024 10:04                5356
arrayobject.exchangearray.php                      14-Apr-2024 10:04                6455
arrayobject.getarraycopy.php                       14-Apr-2024 10:04                5250
arrayobject.getflags.php                           14-Apr-2024 10:04                6078
arrayobject.getiterator.php                        14-Apr-2024 10:04                5244
arrayobject.getiteratorclass.php                   14-Apr-2024 10:04                6539
arrayobject.ksort.php                              14-Apr-2024 10:04                9634
arrayobject.natcasesort.php                        14-Apr-2024 10:04                8178
arrayobject.natsort.php                            14-Apr-2024 10:04                7883
arrayobject.offsetexists.php                       14-Apr-2024 10:04                4921
arrayobject.offsetget.php                          14-Apr-2024 10:04                5123
arrayobject.offsetset.php                          14-Apr-2024 10:04                6735
arrayobject.offsetunset.php                        14-Apr-2024 10:04                4232
arrayobject.serialize.php                          14-Apr-2024 10:04                5066
arrayobject.setflags.php                           14-Apr-2024 10:04                6673
arrayobject.setiteratorclass.php                   14-Apr-2024 10:04                5818
arrayobject.uasort.php                             14-Apr-2024 10:04               10796
arrayobject.uksort.php                             14-Apr-2024 10:04               10226
arrayobject.unserialize.php                        14-Apr-2024 10:04                3540
attribute.construct.php                            14-Apr-2024 10:04                2306
backedenum.from.php                                14-Apr-2024 10:04                6096
backedenum.tryfrom.php                             14-Apr-2024 10:04                6505
bc.configuration.php                               14-Apr-2024 10:04                2478
bc.constants.php                                   14-Apr-2024 10:04                1098
bc.installation.php                                14-Apr-2024 10:04                1417
bc.requirements.php                                14-Apr-2024 10:04                1148
bc.resources.php                                   14-Apr-2024 10:04                1151
bc.setup.php                                       14-Apr-2024 10:04                1527
book.apache.php                                    14-Apr-2024 10:04                3258
book.apcu.php                                      14-Apr-2024 10:04                4338
book.array.php                                     14-Apr-2024 10:04               11996
book.bc.php                                        14-Apr-2024 10:04                2910
book.bson.php                                      14-Apr-2024 10:04               24506
book.bzip2.php                                     14-Apr-2024 10:04                2938
book.calendar.php                                  14-Apr-2024 10:04                4088
book.classobj.php                                  14-Apr-2024 10:04                4392
book.cmark.php                                     14-Apr-2024 10:04                8731
book.com.php                                       14-Apr-2024 10:04                7979
book.componere.php                                 14-Apr-2024 10:04                6124
book.ctype.php                                     14-Apr-2024 10:04                3076
book.cubrid.php                                    14-Apr-2024 10:04               13816
book.curl.php                                      14-Apr-2024 10:04                6950
book.datetime.php                                  14-Apr-2024 10:04               16956
book.dba.php                                       14-Apr-2024 10:04                3365
book.dbase.php                                     14-Apr-2024 10:04                3286
book.dio.php                                       14-Apr-2024 10:04                3006
book.dir.php                                       14-Apr-2024 10:04                3063
book.dom.php                                       14-Apr-2024 10:04               20924
book.ds.php                                        14-Apr-2024 10:04               25083
book.eio.php                                       14-Apr-2024 10:04                7895
book.enchant.php                                   14-Apr-2024 10:04                5299
book.errorfunc.php                                 14-Apr-2024 10:04                3468
book.ev.php                                        14-Apr-2024 10:04               13325
book.event.php                                     14-Apr-2024 10:04               23079
book.exec.php                                      14-Apr-2024 10:04                3187
book.exif.php                                      14-Apr-2024 10:04                2445
book.expect.php                                    14-Apr-2024 10:04                2437
book.fann.php                                      14-Apr-2024 10:04               23050
book.fdf.php                                       14-Apr-2024 10:04                5555
book.ffi.php                                       14-Apr-2024 10:04                5595
book.fileinfo.php                                  14-Apr-2024 10:04                2995
book.filesystem.php                                14-Apr-2024 10:04                9921
book.filter.php                                    14-Apr-2024 10:04                3362
book.fpm.php                                       14-Apr-2024 10:04                1924
book.ftp.php                                       14-Apr-2024 10:04                5942
book.funchand.php                                  14-Apr-2024 10:04                3583
book.gearman.php                                   14-Apr-2024 10:04               14749
book.gender.php                                    14-Apr-2024 10:04                2537
book.geoip.php                                     14-Apr-2024 10:04                4319
book.gettext.php                                   14-Apr-2024 10:04                2883
book.gmagick.php                                   14-Apr-2024 10:04               22534
book.gmp.php                                       14-Apr-2024 10:04                6330
book.gnupg.php                                     14-Apr-2024 10:04                4811
book.hash.php                                      14-Apr-2024 10:04                4122
book.hrtime.php                                    14-Apr-2024 10:04                3478
book.ibase.php                                     14-Apr-2024 10:04               11993
book.ibm-db2.php                                   14-Apr-2024 10:04                8597
book.iconv.php                                     14-Apr-2024 10:04                3245
book.igbinary.php                                  14-Apr-2024 10:04                2093
book.image.php                                     14-Apr-2024 10:04               15247
book.imagick.php                                   14-Apr-2024 10:04               63712
book.imap.php                                      14-Apr-2024 10:04               10187
book.info.php                                      14-Apr-2024 10:04                8354
book.inotify.php                                   14-Apr-2024 10:04                2505
book.intl.php                                      14-Apr-2024 10:04               44979
book.json.php                                      14-Apr-2024 10:04                2854
book.ldap.php                                      14-Apr-2024 10:04                9079
book.libxml.php                                    14-Apr-2024 10:04                3068
book.lua.php                                       14-Apr-2024 10:04                2605
book.luasandbox.php                                14-Apr-2024 10:04                5520
book.lzf.php                                       14-Apr-2024 10:04                2130
book.mail.php                                      14-Apr-2024 10:04                2036
book.mailparse.php                                 14-Apr-2024 10:04                3866
book.math.php                                      14-Apr-2024 10:04                5510
book.mbstring.php                                  14-Apr-2024 10:04                9697
book.mcrypt.php                                    14-Apr-2024 10:04                6340
book.memcache.php                                  14-Apr-2024 10:04                4164
book.memcached.php                                 14-Apr-2024 10:04                8021
book.mhash.php                                     14-Apr-2024 10:04                2420
book.misc.php                                      14-Apr-2024 10:04                5252
book.mongodb.php                                   14-Apr-2024 10:04               26800
book.mqseries.php                                  14-Apr-2024 10:04                3124
book.mysql-xdevapi.php                             14-Apr-2024 10:04               28966
book.mysql.php                                     14-Apr-2024 10:04                7557
book.mysqli.php                                    14-Apr-2024 10:04               18009
book.mysqlnd.php                                   14-Apr-2024 10:04                2415
book.network.php                                   14-Apr-2024 10:04                6080
book.oauth.php                                     14-Apr-2024 10:04                7124
book.oci8.php                                      14-Apr-2024 10:04               16742
book.opcache.php                                   14-Apr-2024 10:04                2642
book.openal.php                                    14-Apr-2024 10:04                4386
book.openssl.php                                   14-Apr-2024 10:04               10827
book.outcontrol.php                                14-Apr-2024 10:04                5119
book.parallel.php                                  14-Apr-2024 10:04                5679
book.parle.php                                     14-Apr-2024 10:04                9211
book.password.php                                  14-Apr-2024 10:04                2514
book.pcntl.php                                     14-Apr-2024 10:04                5002
book.pcre.php                                      14-Apr-2024 10:04                3925
book.pdo.php                                       14-Apr-2024 10:04                7905
book.pgsql.php                                     14-Apr-2024 10:04               12999
book.phar.php                                      14-Apr-2024 10:04               15644
book.phpdbg.php                                    14-Apr-2024 10:04                2863
book.posix.php                                     14-Apr-2024 10:04                6977
book.ps.php                                        14-Apr-2024 10:04                9127
book.pspell.php                                    14-Apr-2024 10:04                4387
book.pthreads.php                                  14-Apr-2024 10:04                5407
book.quickhash.php                                 14-Apr-2024 10:04                8851
book.radius.php                                    14-Apr-2024 10:04                5479
book.random.php                                    14-Apr-2024 10:04                9032
book.rar.php                                       14-Apr-2024 10:04                5189
book.readline.php                                  14-Apr-2024 10:04                3626
book.recode.php                                    14-Apr-2024 10:04                2233
book.reflection.php                                14-Apr-2024 10:04               37046
book.rnp.php                                       14-Apr-2024 10:04                5994
book.rpminfo.php                                   14-Apr-2024 10:04                2444
book.rrd.php                                       14-Apr-2024 10:04                5043
book.runkit7.php                                   14-Apr-2024 10:04                4174
book.scoutapm.php                                  14-Apr-2024 10:04                2138
book.seaslog.php                                   14-Apr-2024 10:04                5139
book.sem.php                                       14-Apr-2024 10:04                4236
book.session.php                                   14-Apr-2024 10:04                7853
book.shmop.php                                     14-Apr-2024 10:04                2846
book.simdjson.php                                  14-Apr-2024 10:04                2606
book.simplexml.php                                 14-Apr-2024 10:04                5397
book.snmp.php                                      14-Apr-2024 10:04                5763
book.soap.php                                      14-Apr-2024 10:04                6031
book.sockets.php                                   14-Apr-2024 10:04                7127
book.sodium.php                                    14-Apr-2024 10:04               17255
book.solr.php                                      14-Apr-2024 10:04               53085
book.spl.php                                       14-Apr-2024 10:04                9950
book.sqlite3.php                                   14-Apr-2024 10:04                7069
book.sqlsrv.php                                    14-Apr-2024 10:04                5288
book.ssdeep.php                                    14-Apr-2024 10:04                2267
book.ssh2.php                                      14-Apr-2024 10:04                5395
book.stats.php                                     14-Apr-2024 10:04               11754
book.stomp.php                                     14-Apr-2024 10:04                4081
book.stream.php                                    14-Apr-2024 10:04               11656
book.strings.php                                   14-Apr-2024 10:04               13734
book.svm.php                                       14-Apr-2024 10:04                3617
book.svn.php                                       14-Apr-2024 10:04                7540
book.swoole.php                                    14-Apr-2024 10:04               37270
book.sync.php                                      14-Apr-2024 10:04                4719
book.taint.php                                     14-Apr-2024 10:04                2493
book.tcpwrap.php                                   14-Apr-2024 10:04                1987
book.tidy.php                                      14-Apr-2024 10:04                6526
book.tokenizer.php                                 14-Apr-2024 10:04                3048
book.trader.php                                    14-Apr-2024 10:04               17451
book.ui.php                                        14-Apr-2024 10:04               27861
book.uodbc.php                                     14-Apr-2024 10:04                7744
book.uopz.php                                      14-Apr-2024 10:04                5042
book.url.php                                       14-Apr-2024 10:04                2877
book.v8js.php                                      14-Apr-2024 10:04                3042
book.var.php                                       14-Apr-2024 10:04                5918
book.var_representation.php                        14-Apr-2024 10:04                2085
book.varnish.php                                   14-Apr-2024 10:04                5304
book.wddx.php                                      14-Apr-2024 10:04                2738
book.win32service.php                              14-Apr-2024 10:04                5096
book.wincache.php                                  14-Apr-2024 10:04                5546
book.wkhtmltox.php                                 14-Apr-2024 10:04                3248
book.xattr.php                                     14-Apr-2024 10:04                2383
book.xdiff.php                                     14-Apr-2024 10:04                4034
book.xhprof.php                                    14-Apr-2024 10:04                2389
book.xlswriter.php                                 14-Apr-2024 10:04                4357
book.xml.php                                       14-Apr-2024 10:04                5571
book.xmldiff.php                                   14-Apr-2024 10:04                3065
book.xmlreader.php                                 14-Apr-2024 10:04                4761
book.xmlrpc.php                                    14-Apr-2024 10:04                3773
book.xmlwriter.php                                 14-Apr-2024 10:04                6461
book.xsl.php                                       14-Apr-2024 10:04                3690
book.yac.php                                       14-Apr-2024 10:04                2535
book.yaconf.php                                    14-Apr-2024 10:04                2086
book.yaf.php                                       14-Apr-2024 10:04               34595
book.yaml.php                                      14-Apr-2024 10:04                2717
book.yar.php                                       14-Apr-2024 10:04                3619
book.yaz.php                                       14-Apr-2024 10:04                4287
book.zip.php                                       14-Apr-2024 10:04               10073
book.zlib.php                                      14-Apr-2024 10:04                4822
book.zmq.php                                       14-Apr-2024 10:04                5438
book.zookeeper.php                                 14-Apr-2024 10:04                6589
bzip2.configuration.php                            14-Apr-2024 10:04                1233
bzip2.constants.php                                14-Apr-2024 10:04                1112
bzip2.examples.php                                 14-Apr-2024 10:04                3980
bzip2.installation.php                             14-Apr-2024 10:04                1358
bzip2.requirements.php                             14-Apr-2024 10:04                1326
bzip2.resources.php                                14-Apr-2024 10:04                1221
bzip2.setup.php                                    14-Apr-2024 10:04                1556
cachingiterator.construct.php                      14-Apr-2024 10:04                2797
cachingiterator.count.php                          14-Apr-2024 10:04                2486
cachingiterator.current.php                        14-Apr-2024 10:04                2795
cachingiterator.getcache.php                       14-Apr-2024 10:04                5832
cachingiterator.getflags.php                       14-Apr-2024 10:04                2480
cachingiterator.hasnext.php                        14-Apr-2024 10:04                2609
cachingiterator.key.php                            14-Apr-2024 10:04                2183
cachingiterator.next.php                           14-Apr-2024 10:04                2410
cachingiterator.offsetexists.php                   14-Apr-2024 10:04                2942
cachingiterator.offsetget.php                      14-Apr-2024 10:04                2690
cachingiterator.offsetset.php                      14-Apr-2024 10:04                3066
cachingiterator.offsetunset.php                    14-Apr-2024 10:04                2739
cachingiterator.rewind.php                         14-Apr-2024 10:04                2426
cachingiterator.setflags.php                       14-Apr-2024 10:04                2771
cachingiterator.tostring.php                       14-Apr-2024 10:04                2618
cachingiterator.valid.php                          14-Apr-2024 10:04                2656
calendar.configuration.php                         14-Apr-2024 10:04                1254
calendar.constants.php                             14-Apr-2024 10:04               12917
calendar.installation.php                          14-Apr-2024 10:04                1477
calendar.requirements.php                          14-Apr-2024 10:04                1190
calendar.resources.php                             14-Apr-2024 10:04                1193
calendar.setup.php                                 14-Apr-2024 10:04                1593
callbackfilteriterator.accept.php                  14-Apr-2024 10:04                3557
callbackfilteriterator.construct.php               14-Apr-2024 10:04                3908
cc.license.php                                     14-Apr-2024 10:04               20685
changelog.misc.php                                 14-Apr-2024 10:04                1280
changelog.mysql.php                                14-Apr-2024 10:04                2492
changelog.mysql_xdevapi.php                        14-Apr-2024 10:04                2301
changelog.mysqli.php                               14-Apr-2024 10:04                1322
changelog.strings.php                              14-Apr-2024 10:04                1341
class.addressinfo.php                              14-Apr-2024 10:04                1716
class.allowdynamicproperties.php                   14-Apr-2024 10:04                4974
class.apcuiterator.php                             14-Apr-2024 10:04                7303
class.appenditerator.php                           14-Apr-2024 10:04                7843
class.argumentcounterror.php                       14-Apr-2024 10:04                8573
class.arithmeticerror.php                          14-Apr-2024 10:04                8740
class.arrayaccess.php                              14-Apr-2024 10:04               11641
class.arrayiterator.php                            14-Apr-2024 10:04               16796
class.arrayobject.php                              14-Apr-2024 10:04               16639
class.assertionerror.php                           14-Apr-2024 10:04                8450
class.attribute.php                                14-Apr-2024 10:04                8532
class.backedenum.php                               14-Apr-2024 10:04                4255
class.badfunctioncallexception.php                 14-Apr-2024 10:04                8539
class.badmethodcallexception.php                   14-Apr-2024 10:04                8557
class.cachingiterator.php                          14-Apr-2024 10:04               17203
class.callbackfilteriterator.php                   14-Apr-2024 10:04               11435
class.closedgeneratorexception.php                 14-Apr-2024 10:04                8686
class.closure.php                                  14-Apr-2024 10:04                7001
class.collator.php                                 14-Apr-2024 10:04               35403
class.collectable.php                              14-Apr-2024 10:04                2522
class.com-exception.php                            14-Apr-2024 10:04                8368
class.com-safearray-proxy.php                      14-Apr-2024 10:04                1873
class.com.php                                      14-Apr-2024 10:04               12485
class.commonmark-cql.php                           14-Apr-2024 10:04                7310
class.commonmark-interfaces-ivisitable.php         14-Apr-2024 10:04                2959
class.commonmark-interfaces-ivisitor.php           14-Apr-2024 10:04                4550
class.commonmark-node-blockquote.php               14-Apr-2024 10:04                8405
class.commonmark-node-bulletlist.php               14-Apr-2024 10:04               10584
class.commonmark-node-code.php                     14-Apr-2024 10:04                9399
class.commonmark-node-codeblock.php                14-Apr-2024 10:04               10788
class.commonmark-node-customblock.php              14-Apr-2024 10:04                9154
class.commonmark-node-custominline.php             14-Apr-2024 10:04                9134
class.commonmark-node-document.php                 14-Apr-2024 10:04                8362
class.commonmark-node-heading.php                  14-Apr-2024 10:04                9765
class.commonmark-node-htmlblock.php                14-Apr-2024 10:04                9457
class.commonmark-node-htmlinline.php               14-Apr-2024 10:04                9433
class.commonmark-node-image.php                    14-Apr-2024 10:04               10673
class.commonmark-node-item.php                     14-Apr-2024 10:04                8372
class.commonmark-node-linebreak.php                14-Apr-2024 10:04                8386
class.commonmark-node-link.php                     14-Apr-2024 10:04               10666
class.commonmark-node-orderedlist.php              14-Apr-2024 10:04               11550
class.commonmark-node-paragraph.php                14-Apr-2024 10:04                8411
class.commonmark-node-softbreak.php                14-Apr-2024 10:04                8404
class.commonmark-node-text-emphasis.php            14-Apr-2024 10:04                8433
class.commonmark-node-text-strong.php              14-Apr-2024 10:04                8422
class.commonmark-node-text.php                     14-Apr-2024 10:04                9803
class.commonmark-node-thematicbreak.php            14-Apr-2024 10:04                8433
class.commonmark-node.php                          14-Apr-2024 10:04                9328
class.commonmark-parser.php                        14-Apr-2024 10:04                3810
class.compersisthelper.php                         14-Apr-2024 10:04                7442
class.compileerror.php                             14-Apr-2024 10:04                8369
class.componere-abstract-definition.php            14-Apr-2024 10:04                4711
class.componere-definition.php                     14-Apr-2024 10:04               10219
class.componere-method.php                         14-Apr-2024 10:04                4302
class.componere-patch.php                          14-Apr-2024 10:04                8314
class.componere-value.php                          14-Apr-2024 10:04                5405
class.countable.php                                14-Apr-2024 10:04                2540
class.curlfile.php                                 14-Apr-2024 10:04                8206
class.curlhandle.php                               14-Apr-2024 10:04                1727
class.curlmultihandle.php                          14-Apr-2024 10:04                1766
class.curlsharehandle.php                          14-Apr-2024 10:04                1762
class.curlstringfile.php                           14-Apr-2024 10:04                5581
class.dateerror.php                                14-Apr-2024 10:04                8995
class.dateexception.php                            14-Apr-2024 10:04                9641
class.dateinterval.php                             14-Apr-2024 10:04               13890
class.dateinvalidoperationexception.php            14-Apr-2024 10:04                9104
class.dateinvalidtimezoneexception.php             14-Apr-2024 10:04                8682
class.datemalformedintervalstringexception.php     14-Apr-2024 10:04                8781
class.datemalformedperiodstringexception.php       14-Apr-2024 10:04                8763
class.datemalformedstringexception.php             14-Apr-2024 10:04                9062
class.dateobjecterror.php                          14-Apr-2024 10:04                8822
class.dateperiod.php                               14-Apr-2024 10:04               22183
class.daterangeerror.php                           14-Apr-2024 10:04                9010
class.datetime.php                                 14-Apr-2024 10:04               23271
class.datetimeimmutable.php                        14-Apr-2024 10:04               23361
class.datetimeinterface.php                        14-Apr-2024 10:04               20044
class.datetimezone.php                             14-Apr-2024 10:04               15533
class.directory.php                                14-Apr-2024 10:04                5490
class.directoryiterator.php                        14-Apr-2024 10:04               19976
class.divisionbyzeroerror.php                      14-Apr-2024 10:04                8427
class.domainexception.php                          14-Apr-2024 10:04                8472
class.domattr.php                                  14-Apr-2024 10:04               28128
class.domcdatasection.php                          14-Apr-2024 10:04               31974
class.domcharacterdata.php                         14-Apr-2024 10:04               33248
class.domchildnode.php                             14-Apr-2024 10:04                4199
class.domcomment.php                               14-Apr-2024 10:04               30648
class.domdocument.php                              14-Apr-2024 10:04               67344
class.domdocumentfragment.php                      14-Apr-2024 10:04               28999
class.domdocumenttype.php                          14-Apr-2024 10:04               27108
class.domelement.php                               14-Apr-2024 10:04               52954
class.domentity.php                                14-Apr-2024 10:04               27748
class.domentityreference.php                       14-Apr-2024 10:04               23244
class.domexception.php                             14-Apr-2024 10:04                9290
class.domimplementation.php                        14-Apr-2024 10:04                5999
class.domnamednodemap.php                          14-Apr-2024 10:04                7351
class.domnamespacenode.php                         14-Apr-2024 10:04                9379
class.domnode.php                                  14-Apr-2024 10:04               32350
class.domnodelist.php                              14-Apr-2024 10:04                5974
class.domnotation.php                              14-Apr-2024 10:04               23513
class.domparentnode.php                            14-Apr-2024 10:04                3869
class.domprocessinginstruction.php                 14-Apr-2024 10:04               24773
class.domtext.php                                  14-Apr-2024 10:04               33585
class.domxpath.php                                 14-Apr-2024 10:04                8675
class.dotnet.php                                   14-Apr-2024 10:04                6888
class.ds-collection.php                            14-Apr-2024 10:04                5981
class.ds-deque.php                                 14-Apr-2024 10:04               22080
class.ds-hashable.php                              14-Apr-2024 10:04                4087
class.ds-map.php                                   14-Apr-2024 10:04               23020
class.ds-pair.php                                  14-Apr-2024 10:04                4554
class.ds-priorityqueue.php                         14-Apr-2024 10:04                8325
class.ds-queue.php                                 14-Apr-2024 10:04                7823
class.ds-sequence.php                              14-Apr-2024 10:04               23592
class.ds-set.php                                   14-Apr-2024 10:04               18551
class.ds-stack.php                                 14-Apr-2024 10:04                7157
class.ds-vector.php                                14-Apr-2024 10:04               21616
class.emptyiterator.php                            14-Apr-2024 10:04                4037
class.enchantbroker.php                            14-Apr-2024 10:04                1793
class.enchantdictionary.php                        14-Apr-2024 10:04                1783
class.error.php                                    14-Apr-2024 10:04               10752
class.errorexception.php                           14-Apr-2024 10:04               14453
class.ev.php                                       14-Apr-2024 10:04               42298
class.evcheck.php                                  14-Apr-2024 10:04               10805
class.evchild.php                                  14-Apr-2024 10:04               12477
class.evembed.php                                  14-Apr-2024 10:04                9974
class.event.php                                    14-Apr-2024 10:04               18392
class.eventbase.php                                14-Apr-2024 10:04               14864
class.eventbuffer.php                              14-Apr-2024 10:04               23351
class.eventbufferevent.php                         14-Apr-2024 10:04               37848
class.eventconfig.php                              14-Apr-2024 10:04                7799
class.eventdnsbase.php                             14-Apr-2024 10:04               14234
class.eventexception.php                           14-Apr-2024 10:04                8495
class.eventhttp.php                                14-Apr-2024 10:04                9668
class.eventhttpconnection.php                      14-Apr-2024 10:04               10484
class.eventhttprequest.php                         14-Apr-2024 10:04               22820
class.eventlistener.php                            14-Apr-2024 10:04               12752
class.eventsslcontext.php                          14-Apr-2024 10:04               19117
class.eventutil.php                                14-Apr-2024 10:04               25519
class.evfork.php                                   14-Apr-2024 10:04                8971
class.evidle.php                                   14-Apr-2024 10:04                9798
class.evio.php                                     14-Apr-2024 10:04               12584
class.evloop.php                                   14-Apr-2024 10:04               31489
class.evperiodic.php                               14-Apr-2024 10:04               14899
class.evprepare.php                                14-Apr-2024 10:04               10944
class.evsignal.php                                 14-Apr-2024 10:04               11888
class.evstat.php                                   14-Apr-2024 10:04               14364
class.evtimer.php                                  14-Apr-2024 10:04               14277
class.evwatcher.php                                14-Apr-2024 10:04                9950
class.exception.php                                14-Apr-2024 10:04               10972
class.fannconnection.php                           14-Apr-2024 10:04                6521
class.ffi-cdata.php                                14-Apr-2024 10:04                6129
class.ffi-ctype.php                                14-Apr-2024 10:04               31217
class.ffi-exception.php                            14-Apr-2024 10:04                8181
class.ffi-parserexception.php                      14-Apr-2024 10:04                8236
class.ffi.php                                      14-Apr-2024 10:04               18349
class.fiber.php                                    14-Apr-2024 10:04                7660
class.fibererror.php                               14-Apr-2024 10:04                8105
class.filesystemiterator.php                       14-Apr-2024 10:04               31733
class.filteriterator.php                           14-Apr-2024 10:04                7281
class.finfo.php                                    14-Apr-2024 10:04                6206
class.ftp-connection.php                           14-Apr-2024 10:04                1755
class.gdfont.php                                   14-Apr-2024 10:04                1680
class.gdimage.php                                  14-Apr-2024 10:04                1676
class.gearmanclient.php                            14-Apr-2024 10:04               37744
class.gearmanexception.php                         14-Apr-2024 10:04                7179
class.gearmanjob.php                               14-Apr-2024 10:04                9206
class.gearmantask.php                              14-Apr-2024 10:04                8849
class.gearmanworker.php                            14-Apr-2024 10:04               13420
class.gender.php                                   14-Apr-2024 10:04               42190
class.generator.php                                14-Apr-2024 10:04                6466
class.globiterator.php                             14-Apr-2024 10:04               26464
class.gmagick.php                                  14-Apr-2024 10:04               87022
class.gmagickdraw.php                              14-Apr-2024 10:04               24424
class.gmagickpixel.php                             14-Apr-2024 10:04                5901
class.gmp.php                                      14-Apr-2024 10:04                2375
class.hashcontext.php                              14-Apr-2024 10:04                3313
class.hrtime-performancecounter.php                14-Apr-2024 10:04                3804
class.hrtime-stopwatch.php                         14-Apr-2024 10:04                7018
class.hrtime-unit.php                              14-Apr-2024 10:04                4384
class.imagick.php                                  14-Apr-2024 10:04              286369
class.imagickdraw.php                              14-Apr-2024 10:04               82862
class.imagickkernel.php                            14-Apr-2024 10:04                6516
class.imagickpixel.php                             14-Apr-2024 10:04               13827
class.imagickpixeliterator.php                     14-Apr-2024 10:04                9602
class.imap-connection.php                          14-Apr-2024 10:04                1758
class.infiniteiterator.php                         14-Apr-2024 10:04                5266
class.internaliterator.php                         14-Apr-2024 10:04                4719
class.intlbreakiterator.php                        14-Apr-2024 10:04               30481
class.intlcalendar.php                             14-Apr-2024 10:04               72082
class.intlchar.php                                 14-Apr-2024 10:04              473301
class.intlcodepointbreakiterator.php               14-Apr-2024 10:04               21498
class.intldateformatter.php                        14-Apr-2024 10:04               32297
class.intldatepatterngenerator.php                 14-Apr-2024 10:04                4720
class.intlexception.php                            14-Apr-2024 10:04                8592
class.intlgregoriancalendar.php                    14-Apr-2024 10:04               52925
class.intliterator.php                             14-Apr-2024 10:04                5025
class.intlpartsiterator.php                        14-Apr-2024 10:04                7104
class.intlrulebasedbreakiterator.php               14-Apr-2024 10:04               24413
class.intltimezone.php                             14-Apr-2024 10:04               28308
class.invalidargumentexception.php                 14-Apr-2024 10:04                8495
class.iterator.php                                 14-Apr-2024 10:04               11313
class.iteratoraggregate.php                        14-Apr-2024 10:04                6142
class.iteratoriterator.php                         14-Apr-2024 10:04                6263
class.jsonexception.php                            14-Apr-2024 10:04                8872
class.jsonserializable.php                         14-Apr-2024 10:04                2760
class.ldap-connection.php                          14-Apr-2024 10:04                1778
class.ldap-result-entry.php                        14-Apr-2024 10:04                1793
class.ldap-result.php                              14-Apr-2024 10:04                1770
class.lengthexception.php                          14-Apr-2024 10:04                8421
class.libxmlerror.php                              14-Apr-2024 10:04                5678
class.limititerator.php                            14-Apr-2024 10:04               11215
class.locale.php                                   14-Apr-2024 10:04               28463
class.logicexception.php                           14-Apr-2024 10:04                8481
class.lua.php                                      14-Apr-2024 10:04                7729
class.luaclosure.php                               14-Apr-2024 10:04                2654
class.luasandbox.php                               14-Apr-2024 10:04               14126
class.luasandboxerror.php                          14-Apr-2024 10:04               10055
class.luasandboxerrorerror.php                     14-Apr-2024 10:04                7594
class.luasandboxfatalerror.php                     14-Apr-2024 10:04                7716
class.luasandboxfunction.php                       14-Apr-2024 10:04                3913
class.luasandboxmemoryerror.php                    14-Apr-2024 10:04                7908
class.luasandboxruntimeerror.php                   14-Apr-2024 10:04                7736
class.luasandboxsyntaxerror.php                    14-Apr-2024 10:04                7598
class.luasandboxtimeouterror.php                   14-Apr-2024 10:04                7892
class.memcache.php                                 14-Apr-2024 10:04               19141
class.memcached.php                                14-Apr-2024 10:04               47472
class.memcachedexception.php                       14-Apr-2024 10:04                7477
class.messageformatter.php                         14-Apr-2024 10:04               12113
class.mongodb-bson-binary.php                      14-Apr-2024 10:04               16880
class.mongodb-bson-binaryinterface.php             14-Apr-2024 10:04                4709
class.mongodb-bson-dbpointer.php                   14-Apr-2024 10:04                6030
class.mongodb-bson-decimal128.php                  14-Apr-2024 10:04                7809
class.mongodb-bson-decimal128interface.php         14-Apr-2024 10:04                3836
class.mongodb-bson-document.php                    14-Apr-2024 10:04               11305
class.mongodb-bson-int64.php                       14-Apr-2024 10:04                7500
class.mongodb-bson-iterator.php                    14-Apr-2024 10:04                4978
class.mongodb-bson-javascript.php                  14-Apr-2024 10:04                8757
class.mongodb-bson-javascriptinterface.php         14-Apr-2024 10:04                4939
class.mongodb-bson-maxkey.php                      14-Apr-2024 10:04                5856
class.mongodb-bson-maxkeyinterface.php             14-Apr-2024 10:04                2190
class.mongodb-bson-minkey.php                      14-Apr-2024 10:04                5847
class.mongodb-bson-minkeyinterface.php             14-Apr-2024 10:04                2171
class.mongodb-bson-objectid.php                    14-Apr-2024 10:04                9221
class.mongodb-bson-objectidinterface.php           14-Apr-2024 10:04                4326
class.mongodb-bson-packedarray.php                 14-Apr-2024 10:04                9091
class.mongodb-bson-persistable.php                 14-Apr-2024 10:04                6137
class.mongodb-bson-regex.php                       14-Apr-2024 10:04                8188
class.mongodb-bson-regexinterface.php              14-Apr-2024 10:04                4728
class.mongodb-bson-serializable.php                14-Apr-2024 10:04                4232
class.mongodb-bson-symbol.php                      14-Apr-2024 10:04                5918
class.mongodb-bson-timestamp.php                   14-Apr-2024 10:04                8435
class.mongodb-bson-timestampinterface.php          14-Apr-2024 10:04                4886
class.mongodb-bson-type.php                        14-Apr-2024 10:04                2025
class.mongodb-bson-undefined.php                   14-Apr-2024 10:04                6006
class.mongodb-bson-unserializable.php              14-Apr-2024 10:04                3975
class.mongodb-bson-utcdatetime.php                 14-Apr-2024 10:04                8040
class.mongodb-bson-utcdatetimeinterface.php        14-Apr-2024 10:04                4399
class.mongodb-driver-bulkwrite.php                 14-Apr-2024 10:04               24116
class.mongodb-driver-clientencryption.php          14-Apr-2024 10:04               23452
class.mongodb-driver-command.php                   14-Apr-2024 10:04               14221
class.mongodb-driver-cursor.php                    14-Apr-2024 10:04               25804
class.mongodb-driver-cursorid.php                  14-Apr-2024 10:04                5549
class.mongodb-driver-cursorinterface.php           14-Apr-2024 10:04                6187
class.mongodb-driver-exception-authenticationex..> 14-Apr-2024 10:04                9148
class.mongodb-driver-exception-bulkwriteexcepti..> 14-Apr-2024 10:04               10002
class.mongodb-driver-exception-commandexception..> 14-Apr-2024 10:04               10906
class.mongodb-driver-exception-connectionexcept..> 14-Apr-2024 10:04                9217
class.mongodb-driver-exception-connectiontimeou..> 14-Apr-2024 10:04                9605
class.mongodb-driver-exception-encryptionexcept..> 14-Apr-2024 10:04                9151
class.mongodb-driver-exception-exception.php       14-Apr-2024 10:04                2185
class.mongodb-driver-exception-executiontimeout..> 14-Apr-2024 10:04               10266
class.mongodb-driver-exception-invalidargumente..> 14-Apr-2024 10:04                8177
class.mongodb-driver-exception-logicexception.php  14-Apr-2024 10:04                8061
class.mongodb-driver-exception-runtimeexception..> 14-Apr-2024 10:04               11665
class.mongodb-driver-exception-serverexception.php 14-Apr-2024 10:04                9228
class.mongodb-driver-exception-sslconnectionexc..> 14-Apr-2024 10:04                9494
class.mongodb-driver-exception-unexpectedvaluee..> 14-Apr-2024 10:04                8194
class.mongodb-driver-exception-writeexception.php  14-Apr-2024 10:04               12183
class.mongodb-driver-manager.php                   14-Apr-2024 10:04               21806
class.mongodb-driver-monitoring-commandfailedev..> 14-Apr-2024 10:04                8051
class.mongodb-driver-monitoring-commandstartede..> 14-Apr-2024 10:04                7555
class.mongodb-driver-monitoring-commandsubscrib..> 14-Apr-2024 10:04                6281
class.mongodb-driver-monitoring-commandsucceede..> 14-Apr-2024 10:04                7633
class.mongodb-driver-monitoring-logsubscriber.php  14-Apr-2024 10:04               10118
class.mongodb-driver-monitoring-sdamsubscriber.php 14-Apr-2024 10:04               11631
class.mongodb-driver-monitoring-serverchangedev..> 14-Apr-2024 10:04                5745
class.mongodb-driver-monitoring-serverclosedeve..> 14-Apr-2024 10:04                4392
class.mongodb-driver-monitoring-serverheartbeat..> 14-Apr-2024 10:04                5743
class.mongodb-driver-monitoring-serverheartbeat..> 14-Apr-2024 10:04                4570
class.mongodb-driver-monitoring-serverheartbeat..> 14-Apr-2024 10:04                5815
class.mongodb-driver-monitoring-serveropeningev..> 14-Apr-2024 10:04                4412
class.mongodb-driver-monitoring-subscriber.php     14-Apr-2024 10:04                2640
class.mongodb-driver-monitoring-topologychanged..> 14-Apr-2024 10:04                4740
class.mongodb-driver-monitoring-topologyclosede..> 14-Apr-2024 10:04                3351
class.mongodb-driver-monitoring-topologyopening..> 14-Apr-2024 10:04                3365
class.mongodb-driver-query.php                     14-Apr-2024 10:04                3424
class.mongodb-driver-readconcern.php               14-Apr-2024 10:04               17711
class.mongodb-driver-readpreference.php            14-Apr-2024 10:04               21911
class.mongodb-driver-server.php                    14-Apr-2024 10:04               27181
class.mongodb-driver-serverapi.php                 14-Apr-2024 10:04               14084
class.mongodb-driver-serverdescription.php         14-Apr-2024 10:04               16875
class.mongodb-driver-session.php                   14-Apr-2024 10:04               15534
class.mongodb-driver-topologydescription.php       14-Apr-2024 10:04               11639
class.mongodb-driver-writeconcern.php              14-Apr-2024 10:04               10296
class.mongodb-driver-writeconcernerror.php         14-Apr-2024 10:04                4383
class.mongodb-driver-writeerror.php                14-Apr-2024 10:04                4707
class.mongodb-driver-writeresult.php               14-Apr-2024 10:04                8685
class.multipleiterator.php                         14-Apr-2024 10:04               11518
class.mysql-xdevapi-baseresult.php                 14-Apr-2024 10:04                3048
class.mysql-xdevapi-client.php                     14-Apr-2024 10:04                3130
class.mysql-xdevapi-collection.php                 14-Apr-2024 10:04               10807
class.mysql-xdevapi-collectionadd.php              14-Apr-2024 10:04                2949
class.mysql-xdevapi-collectionfind.php             14-Apr-2024 10:04                8829
class.mysql-xdevapi-collectionmodify.php           14-Apr-2024 10:04               10286
class.mysql-xdevapi-collectionremove.php           14-Apr-2024 10:04                5223
class.mysql-xdevapi-columnresult.php               14-Apr-2024 10:04                6773
class.mysql-xdevapi-crudoperationbindable.php      14-Apr-2024 10:04                2985
class.mysql-xdevapi-crudoperationlimitable.php     14-Apr-2024 10:04                2991
class.mysql-xdevapi-crudoperationskippable.php     14-Apr-2024 10:04                3002
class.mysql-xdevapi-crudoperationsortable.php      14-Apr-2024 10:04                2978
class.mysql-xdevapi-databaseobject.php             14-Apr-2024 10:04                3549
class.mysql-xdevapi-docresult.php                  14-Apr-2024 10:04                4051
class.mysql-xdevapi-exception.php                  14-Apr-2024 10:04                2201
class.mysql-xdevapi-executable.php                 14-Apr-2024 10:04                2627
class.mysql-xdevapi-executionstatus.php            14-Apr-2024 10:04                4868
class.mysql-xdevapi-expression.php                 14-Apr-2024 10:04                3261
class.mysql-xdevapi-result.php                     14-Apr-2024 10:04                4435
class.mysql-xdevapi-rowresult.php                  14-Apr-2024 10:04                5148
class.mysql-xdevapi-schema.php                     14-Apr-2024 10:04                7861
class.mysql-xdevapi-schemaobject.php               14-Apr-2024 10:04                2812
class.mysql-xdevapi-session.php                    14-Apr-2024 10:04                9712
class.mysql-xdevapi-sqlstatement.php               14-Apr-2024 10:04                6668
class.mysql-xdevapi-sqlstatementresult.php         14-Apr-2024 10:04                7330
class.mysql-xdevapi-statement.php                  14-Apr-2024 10:04                5029
class.mysql-xdevapi-table.php                      14-Apr-2024 10:04                7430
class.mysql-xdevapi-tabledelete.php                14-Apr-2024 10:04                5188
class.mysql-xdevapi-tableinsert.php                14-Apr-2024 10:04                3509
class.mysql-xdevapi-tableselect.php                14-Apr-2024 10:04                8333
class.mysql-xdevapi-tableupdate.php                14-Apr-2024 10:04                6123
class.mysql-xdevapi-warning.php                    14-Apr-2024 10:04                3758
class.mysqli-driver.php                            14-Apr-2024 10:04                8016
class.mysqli-result.php                            14-Apr-2024 10:04               16068
class.mysqli-sql-exception.php                     14-Apr-2024 10:04               10031
class.mysqli-stmt.php                              14-Apr-2024 10:04               18754
class.mysqli-warning.php                           14-Apr-2024 10:04                4388
class.mysqli.php                                   14-Apr-2024 10:04               44895
class.norewinditerator.php                         14-Apr-2024 10:04                6703
class.normalizer.php                               14-Apr-2024 10:04               13604
class.numberformatter.php                          14-Apr-2024 10:04               74126
class.oauth.php                                    14-Apr-2024 10:04               20001
class.oauthexception.php                           14-Apr-2024 10:04                8523
class.oauthprovider.php                            14-Apr-2024 10:04               12926
class.ocicollection.php                            14-Apr-2024 10:04                7104
class.ocilob.php                                   14-Apr-2024 10:04               15327
class.opensslasymmetrickey.php                     14-Apr-2024 10:04                1856
class.opensslcertificate.php                       14-Apr-2024 10:04                1860
class.opensslcertificatesigningrequest.php         14-Apr-2024 10:04                1947
class.outeriterator.php                            14-Apr-2024 10:04                4323
class.outofboundsexception.php                     14-Apr-2024 10:04                8530
class.outofrangeexception.php                      14-Apr-2024 10:04                8532
class.overflowexception.php                        14-Apr-2024 10:04                8451
class.override.php                                 14-Apr-2024 10:04                4025
class.parallel-channel.php                         14-Apr-2024 10:04                8205
class.parallel-events-event-type.php               14-Apr-2024 10:04                3361
class.parallel-events-event.php                    14-Apr-2024 10:04                3514
class.parallel-events-input.php                    14-Apr-2024 10:04                4751
class.parallel-events.php                          14-Apr-2024 10:04                7125
class.parallel-future.php                          14-Apr-2024 10:04                7798
class.parallel-runtime.php                         14-Apr-2024 10:04                6400
class.parallel-sync.php                            14-Apr-2024 10:04                5226
class.parentiterator.php                           14-Apr-2024 10:04                9591
class.parle-errorinfo.php                          14-Apr-2024 10:04                3846
class.parle-lexer.php                              14-Apr-2024 10:04               13181
class.parle-lexerexception.php                     14-Apr-2024 10:04                7729
class.parle-parser.php                             14-Apr-2024 10:04               18109
class.parle-parserexception.php                    14-Apr-2024 10:04                7711
class.parle-rlexer.php                             14-Apr-2024 10:04               15416
class.parle-rparser.php                            14-Apr-2024 10:04               18282
class.parle-stack.php                              14-Apr-2024 10:04                4817
class.parle-token.php                              14-Apr-2024 10:04                4908
class.parseerror.php                               14-Apr-2024 10:04                8885
class.pdo.php                                      14-Apr-2024 10:04               42635
class.pdoexception.php                             14-Apr-2024 10:04               10347
class.pdorow.php                                   14-Apr-2024 10:04                4037
class.pdostatement.php                             14-Apr-2024 10:04               23014
class.pgsql-connection.php                         14-Apr-2024 10:04                1801
class.pgsql-lob.php                                14-Apr-2024 10:04                1743
class.pgsql-result.php                             14-Apr-2024 10:04                1775
class.phar.php                                     14-Apr-2024 10:04               74180
class.phardata.php                                 14-Apr-2024 10:04               49586
class.pharexception.php                            14-Apr-2024 10:04                8421
class.pharfileinfo.php                             14-Apr-2024 10:04               21647
class.php-user-filter.php                          14-Apr-2024 10:04                6427
class.phptoken.php                                 14-Apr-2024 10:04                8736
class.pool.php                                     14-Apr-2024 10:04                7703
class.pspell-config.php                            14-Apr-2024 10:04                1777
class.pspell-dictionary.php                        14-Apr-2024 10:04                1814
class.quickhashinthash.php                         14-Apr-2024 10:04               15091
class.quickhashintset.php                          14-Apr-2024 10:04               12867
class.quickhashintstringhash.php                   14-Apr-2024 10:04               15987
class.quickhashstringinthash.php                   14-Apr-2024 10:04               13656
class.random-brokenrandomengineerror.php           14-Apr-2024 10:04                8519
class.random-cryptosafeengine.php                  14-Apr-2024 10:04                2465
class.random-engine-mt19937.php                    14-Apr-2024 10:04                5359
class.random-engine-pcgoneseq128xslrr64.php        14-Apr-2024 10:04                6173
class.random-engine-secure.php                     14-Apr-2024 10:04                3400
class.random-engine-xoshiro256starstar.php         14-Apr-2024 10:04                6358
class.random-engine.php                            14-Apr-2024 10:04                3762
class.random-randomerror.php                       14-Apr-2024 10:04                8443
class.random-randomexception.php                   14-Apr-2024 10:04                8557
class.random-randomizer.php                        14-Apr-2024 10:04               10562
class.rangeexception.php                           14-Apr-2024 10:04                8660
class.rararchive.php                               14-Apr-2024 10:04                7720
class.rarentry.php                                 14-Apr-2024 10:04               49778
class.rarexception.php                             14-Apr-2024 10:04                8281
class.recursivearrayiterator.php                   14-Apr-2024 10:04               15894
class.recursivecachingiterator.php                 14-Apr-2024 10:04               14103
class.recursivecallbackfilteriterator.php          14-Apr-2024 10:04               13177
class.recursivedirectoryiterator.php               14-Apr-2024 10:04               29797
class.recursivefilteriterator.php                  14-Apr-2024 10:04                8222
class.recursiveiterator.php                        14-Apr-2024 10:04                4861
class.recursiveiteratoriterator.php                14-Apr-2024 10:04               14620
class.recursiveregexiterator.php                   14-Apr-2024 10:04               14737
class.recursivetreeiterator.php                    14-Apr-2024 10:04               25630
class.reflection.php                               14-Apr-2024 10:04                3425
class.reflectionattribute.php                      14-Apr-2024 10:04                6373
class.reflectionclass.php                          14-Apr-2024 10:04               37481
class.reflectionclassconstant.php                  14-Apr-2024 10:04               16237
class.reflectionenum.php                           14-Apr-2024 10:04               31485
class.reflectionenumbackedcase.php                 14-Apr-2024 10:04               12929
class.reflectionenumunitcase.php                   14-Apr-2024 10:04               12550
class.reflectionexception.php                      14-Apr-2024 10:04                8393
class.reflectionextension.php                      14-Apr-2024 10:04               10572
class.reflectionfiber.php                          14-Apr-2024 10:04                4951
class.reflectionfunction.php                       14-Apr-2024 10:04               21223
class.reflectionfunctionabstract.php               14-Apr-2024 10:04               19842
class.reflectiongenerator.php                      14-Apr-2024 10:04                6335
class.reflectionintersectiontype.php               14-Apr-2024 10:04                3429
class.reflectionmethod.php                         14-Apr-2024 10:04               32810
class.reflectionnamedtype.php                      14-Apr-2024 10:04                3741
class.reflectionobject.php                         14-Apr-2024 10:04               29270
class.reflectionparameter.php                      14-Apr-2024 10:04               16497
class.reflectionproperty.php                       14-Apr-2024 10:04               22155
class.reflectionreference.php                      14-Apr-2024 10:04                4125
class.reflectiontype.php                           14-Apr-2024 10:04                4476
class.reflectionuniontype.php                      14-Apr-2024 10:04                3313
class.reflectionzendextension.php                  14-Apr-2024 10:04                7861
class.reflector.php                                14-Apr-2024 10:04                3895
class.regexiterator.php                            14-Apr-2024 10:04               17587
class.resourcebundle.php                           14-Apr-2024 10:04               10424
class.returntypewillchange.php                     14-Apr-2024 10:04                3129
class.rnpffi.php                                   14-Apr-2024 10:04                1634
class.rrdcreator.php                               14-Apr-2024 10:04                4481
class.rrdgraph.php                                 14-Apr-2024 10:04                3903
class.rrdupdater.php                               14-Apr-2024 10:04                3289
class.runtimeexception.php                         14-Apr-2024 10:04                8438
class.seaslog.php                                  14-Apr-2024 10:04               21939
class.seekableiterator.php                         14-Apr-2024 10:04               11284
class.sensitiveparameter.php                       14-Apr-2024 10:04                6320
class.sensitiveparametervalue.php                  14-Apr-2024 10:04                4922
class.serializable.php                             14-Apr-2024 10:04                8043
class.sessionhandler.php                           14-Apr-2024 10:04               25167
class.sessionhandlerinterface.php                  14-Apr-2024 10:04               15441
class.sessionidinterface.php                       14-Apr-2024 10:04                3155
class.sessionupdatetimestamphandlerinterface.php   14-Apr-2024 10:04                4394
class.shmop.php                                    14-Apr-2024 10:04                1675
class.simdjsonexception.php                        14-Apr-2024 10:04                5009
class.simdjsonvalueerror.php                       14-Apr-2024 10:04                8320
class.simplexmlelement.php                         14-Apr-2024 10:04               18598
class.simplexmliterator.php                        14-Apr-2024 10:04               16610
class.snmp.php                                     14-Apr-2024 10:04               28272
class.snmpexception.php                            14-Apr-2024 10:04                9024
class.soapclient.php                               14-Apr-2024 10:04               34242
class.soapfault.php                                14-Apr-2024 10:04               14294
class.soapheader.php                               14-Apr-2024 10:04                6023
class.soapparam.php                                14-Apr-2024 10:04                3701
class.soapserver.php                               14-Apr-2024 10:04                9897
class.soapvar.php                                  14-Apr-2024 10:04                7835
class.socket.php                                   14-Apr-2024 10:04                1739
class.sodiumexception.php                          14-Apr-2024 10:04                8370
class.solrclient.php                               14-Apr-2024 10:04               24701
class.solrclientexception.php                      14-Apr-2024 10:04                9678
class.solrcollapsefunction.php                     14-Apr-2024 10:04               11761
class.solrdismaxquery.php                          14-Apr-2024 10:04              111861
class.solrdocument.php                             14-Apr-2024 10:04               23416
class.solrdocumentfield.php                        14-Apr-2024 10:04                4628
class.solrexception.php                            14-Apr-2024 10:04               10065
class.solrgenericresponse.php                      14-Apr-2024 10:04               12625
class.solrillegalargumentexception.php             14-Apr-2024 10:04                9802
class.solrillegaloperationexception.php            14-Apr-2024 10:04                9840
class.solrinputdocument.php                        14-Apr-2024 10:04               19455
class.solrmissingmandatoryparameterexception.php   14-Apr-2024 10:04                8965
class.solrmodifiableparams.php                     14-Apr-2024 10:04                8948
class.solrobject.php                               14-Apr-2024 10:04                5819
class.solrparams.php                               14-Apr-2024 10:04                9104
class.solrpingresponse.php                         14-Apr-2024 10:04               11097
class.solrquery.php                                14-Apr-2024 10:04              118963
class.solrqueryresponse.php                        14-Apr-2024 10:04               12544
class.solrresponse.php                             14-Apr-2024 10:04               14294
class.solrserverexception.php                      14-Apr-2024 10:04                9684
class.solrupdateresponse.php                       14-Apr-2024 10:04               12592
class.solrutils.php                                14-Apr-2024 10:04                4917
class.spldoublylinkedlist.php                      14-Apr-2024 10:04               17424
class.splfileinfo.php                              14-Apr-2024 10:04               18008
class.splfileobject.php                            14-Apr-2024 10:04               37213
class.splfixedarray.php                            14-Apr-2024 10:04               19846
class.splheap.php                                  14-Apr-2024 10:04                7731
class.splmaxheap.php                               14-Apr-2024 10:04                7167
class.splminheap.php                               14-Apr-2024 10:04                7177
class.splobjectstorage.php                         14-Apr-2024 10:04               21064
class.splobserver.php                              14-Apr-2024 10:04                2809
class.splpriorityqueue.php                         14-Apr-2024 10:04               11762
class.splqueue.php                                 14-Apr-2024 10:04               17129
class.splstack.php                                 14-Apr-2024 10:04               14343
class.splsubject.php                               14-Apr-2024 10:04                3678
class.spltempfileobject.php                        14-Apr-2024 10:04               31777
class.spoofchecker.php                             14-Apr-2024 10:04               17572
class.sqlite3.php                                  14-Apr-2024 10:04               39682
class.sqlite3exception.php                         14-Apr-2024 10:04                8362
class.sqlite3result.php                            14-Apr-2024 10:04                5785
class.sqlite3stmt.php                              14-Apr-2024 10:04                8265
class.stdclass.php                                 14-Apr-2024 10:04                6584
class.stomp.php                                    14-Apr-2024 10:04               21645
class.stompexception.php                           14-Apr-2024 10:04                5837
class.stompframe.php                               14-Apr-2024 10:04                4327
class.streamwrapper.php                            14-Apr-2024 10:04               20212
class.stringable.php                               14-Apr-2024 10:04                8140
class.svm.php                                      14-Apr-2024 10:04               18428
class.svmmodel.php                                 14-Apr-2024 10:04                6901
class.swoole-async.php                             14-Apr-2024 10:04                7993
class.swoole-atomic.php                            14-Apr-2024 10:04                5022
class.swoole-buffer.php                            14-Apr-2024 10:04                7477
class.swoole-channel.php                           14-Apr-2024 10:04                3920
class.swoole-client.php                            14-Apr-2024 10:04               16484
class.swoole-connection-iterator.php               14-Apr-2024 10:04                7473
class.swoole-coroutine.php                         14-Apr-2024 10:04               18609
class.swoole-event.php                             14-Apr-2024 10:04                7416
class.swoole-exception.php                         14-Apr-2024 10:04                4524
class.swoole-http-client.php                       14-Apr-2024 10:04               14735
class.swoole-http-request.php                      14-Apr-2024 10:04                2985
class.swoole-http-response.php                     14-Apr-2024 10:04               10861
class.swoole-http-server.php                       14-Apr-2024 10:04               26387
class.swoole-lock.php                              14-Apr-2024 10:04                4630
class.swoole-mmap.php                              14-Apr-2024 10:04                3031
class.swoole-mysql-exception.php                   14-Apr-2024 10:04                4565
class.swoole-mysql.php                             14-Apr-2024 10:04                5369
class.swoole-process.php                           14-Apr-2024 10:04               13617
class.swoole-redis-server.php                      14-Apr-2024 10:04               32018
class.swoole-serialize.php                         14-Apr-2024 10:04                3563
class.swoole-server.php                            14-Apr-2024 10:04               29528
class.swoole-table.php                             14-Apr-2024 10:04               12675
class.swoole-timer.php                             14-Apr-2024 10:04                4951
class.swoole-websocket-frame.php                   14-Apr-2024 10:04                1897
class.swoole-websocket-server.php                  14-Apr-2024 10:04                7780
class.syncevent.php                                14-Apr-2024 10:04                4849
class.syncmutex.php                                14-Apr-2024 10:04                4170
class.syncreaderwriter.php                         14-Apr-2024 10:04                5158
class.syncsemaphore.php                            14-Apr-2024 10:04                4606
class.syncsharedmemory.php                         14-Apr-2024 10:04                5456
class.sysvmessagequeue.php                         14-Apr-2024 10:04                1785
class.sysvsemaphore.php                            14-Apr-2024 10:04                1770
class.sysvsharedmemory.php                         14-Apr-2024 10:04                1773
class.thread.php                                   14-Apr-2024 10:04               11371
class.threaded.php                                 14-Apr-2024 10:04                8792
class.throwable.php                                14-Apr-2024 10:04                7132
class.tidy.php                                     14-Apr-2024 10:04               18823
class.tidynode.php                                 14-Apr-2024 10:04               11549
class.transliterator.php                           14-Apr-2024 10:04               10136
class.traversable.php                              14-Apr-2024 10:04                4270
class.typeerror.php                                14-Apr-2024 10:04                9396
class.uconverter.php                               14-Apr-2024 10:04               40976
class.ui-area.php                                  14-Apr-2024 10:04               12199
class.ui-control.php                               14-Apr-2024 10:04                5428
class.ui-controls-box.php                          14-Apr-2024 10:04               10065
class.ui-controls-button.php                       14-Apr-2024 10:04                6628
class.ui-controls-check.php                        14-Apr-2024 10:04                7472
class.ui-controls-colorbutton.php                  14-Apr-2024 10:04                6507
class.ui-controls-combo.php                        14-Apr-2024 10:04                6596
class.ui-controls-editablecombo.php                14-Apr-2024 10:04                6708
class.ui-controls-entry.php                        14-Apr-2024 10:04                9589
class.ui-controls-form.php                         14-Apr-2024 10:04                7995
class.ui-controls-grid.php                         14-Apr-2024 10:04               13096
class.ui-controls-group.php                        14-Apr-2024 10:04                8303
class.ui-controls-label.php                        14-Apr-2024 10:04                6379
class.ui-controls-multilineentry.php               14-Apr-2024 10:04                9832
class.ui-controls-picker.php                       14-Apr-2024 10:04                7521
class.ui-controls-progress.php                     14-Apr-2024 10:04                5880
class.ui-controls-radio.php                        14-Apr-2024 10:04                6575
class.ui-controls-separator.php                    14-Apr-2024 10:04                7025
class.ui-controls-slider.php                       14-Apr-2024 10:04                6963
class.ui-controls-spin.php                         14-Apr-2024 10:04                6833
class.ui-controls-tab.php                          14-Apr-2024 10:04                9101
class.ui-draw-brush-gradient.php                   14-Apr-2024 10:04                7288
class.ui-draw-brush-lineargradient.php             14-Apr-2024 10:04                6542
class.ui-draw-brush-radialgradient.php             14-Apr-2024 10:04                6728
class.ui-draw-brush.php                            14-Apr-2024 10:04                4388
class.ui-draw-color.php                            14-Apr-2024 10:04                8534
class.ui-draw-line-cap.php                         14-Apr-2024 10:04                3688
class.ui-draw-line-join.php                        14-Apr-2024 10:04                3672
class.ui-draw-matrix.php                           14-Apr-2024 10:04                5578
class.ui-draw-path.php                             14-Apr-2024 10:04               10713
class.ui-draw-pen.php                              14-Apr-2024 10:04                8085
class.ui-draw-stroke.php                           14-Apr-2024 10:04                6836
class.ui-draw-text-font-descriptor.php             14-Apr-2024 10:04                5998
class.ui-draw-text-font-italic.php                 14-Apr-2024 10:04                4047
class.ui-draw-text-font-stretch.php                14-Apr-2024 10:04                8243
class.ui-draw-text-font-weight.php                 14-Apr-2024 10:04                8845
class.ui-draw-text-font.php                        14-Apr-2024 10:04                4827
class.ui-draw-text-layout.php                      14-Apr-2024 10:04                5237
class.ui-exception-invalidargumentexception.php    14-Apr-2024 10:04                7747
class.ui-exception-runtimeexception.php            14-Apr-2024 10:04                7670
class.ui-executor.php                              14-Apr-2024 10:04                5388
class.ui-key.php                                   14-Apr-2024 10:04               21287
class.ui-menu.php                                  14-Apr-2024 10:04                6246
class.ui-menuitem.php                              14-Apr-2024 10:04                3716
class.ui-point.php                                 14-Apr-2024 10:04                6261
class.ui-size.php                                  14-Apr-2024 10:04                6356
class.ui-window.php                                14-Apr-2024 10:04               13045
class.underflowexception.php                       14-Apr-2024 10:04                8522
class.unexpectedvalueexception.php                 14-Apr-2024 10:04                8681
class.unhandledmatcherror.php                      14-Apr-2024 10:04                8545
class.unitenum.php                                 14-Apr-2024 10:04                2741
class.v8js.php                                     14-Apr-2024 10:04                9001
class.v8jsexception.php                            14-Apr-2024 10:04               11307
class.valueerror.php                               14-Apr-2024 10:04                8482
class.variant.php                                  14-Apr-2024 10:04                5626
class.varnishadmin.php                             14-Apr-2024 10:04               11488
class.varnishlog.php                               14-Apr-2024 10:04               34747
class.varnishstat.php                              14-Apr-2024 10:04                2965
class.volatile.php                                 14-Apr-2024 10:04               11690
class.vtiful-kernel-excel.php                      14-Apr-2024 10:04               11993
class.vtiful-kernel-format.php                     14-Apr-2024 10:04               16030
class.weakmap.php                                  14-Apr-2024 10:04                9298
class.weakreference.php                            14-Apr-2024 10:04                5571
class.win32serviceexception.php                    14-Apr-2024 10:04                7793
class.wkhtmltox-image-converter.php                14-Apr-2024 10:04                4115
class.wkhtmltox-pdf-converter.php                  14-Apr-2024 10:04                4443
class.wkhtmltox-pdf-object.php                     14-Apr-2024 10:04                2955
class.worker.php                                   14-Apr-2024 10:04                8502
class.xmldiff-base.php                             14-Apr-2024 10:04                4078
class.xmldiff-dom.php                              14-Apr-2024 10:04                5031
class.xmldiff-file.php                             14-Apr-2024 10:04                5007
class.xmldiff-memory.php                           14-Apr-2024 10:04                5039
class.xmlparser.php                                14-Apr-2024 10:04                1756
class.xmlreader.php                                14-Apr-2024 10:04               38945
class.xmlwriter.php                                14-Apr-2024 10:04               32333
class.xsltprocessor.php                            14-Apr-2024 10:04               11485
class.yac.php                                      14-Apr-2024 10:04                9512
class.yaconf.php                                   14-Apr-2024 10:04                3442
class.yaf-action-abstract.php                      14-Apr-2024 10:04               12687
class.yaf-application.php                          14-Apr-2024 10:04               12756
class.yaf-bootstrap-abstract.php                   14-Apr-2024 10:04                5508
class.yaf-config-abstract.php                      14-Apr-2024 10:04                5181
class.yaf-config-ini.php                           14-Apr-2024 10:04               17758
class.yaf-config-simple.php                        14-Apr-2024 10:04               13189
class.yaf-controller-abstract.php                  14-Apr-2024 10:04               19158
class.yaf-dispatcher.php                           14-Apr-2024 10:04               20217
class.yaf-exception-dispatchfailed.php             14-Apr-2024 10:04                2606
class.yaf-exception-loadfailed-action.php          14-Apr-2024 10:04                2677
class.yaf-exception-loadfailed-controller.php      14-Apr-2024 10:04                2702
class.yaf-exception-loadfailed-module.php          14-Apr-2024 10:04                2666
class.yaf-exception-loadfailed-view.php            14-Apr-2024 10:04                2606
class.yaf-exception-loadfailed.php                 14-Apr-2024 10:04                2580
class.yaf-exception-routerfailed.php               14-Apr-2024 10:04                2591
class.yaf-exception-startuperror.php               14-Apr-2024 10:04                2589
class.yaf-exception-typeerror.php                  14-Apr-2024 10:04                2560
class.yaf-exception.php                            14-Apr-2024 10:04                8451
class.yaf-loader.php                               14-Apr-2024 10:04               18716
class.yaf-plugin-abstract.php                      14-Apr-2024 10:04               16009
class.yaf-registry.php                             14-Apr-2024 10:04                5993
class.yaf-request-abstract.php                     14-Apr-2024 10:04               23704
class.yaf-request-http.php                         14-Apr-2024 10:04               23174
class.yaf-request-simple.php                       14-Apr-2024 10:04               22654
class.yaf-response-abstract.php                    14-Apr-2024 10:04               11775
class.yaf-route-interface.php                      14-Apr-2024 10:04                3699
class.yaf-route-map.php                            14-Apr-2024 10:04                6469
class.yaf-route-regex.php                          14-Apr-2024 10:04                8361
class.yaf-route-rewrite.php                        14-Apr-2024 10:04                7465
class.yaf-route-simple.php                         14-Apr-2024 10:04                6542
class.yaf-route-static.php                         14-Apr-2024 10:04                5019
class.yaf-route-supervar.php                       14-Apr-2024 10:04                4707
class.yaf-router.php                               14-Apr-2024 10:04               11952
class.yaf-session.php                              14-Apr-2024 10:04               12608
class.yaf-view-interface.php                       14-Apr-2024 10:04                6028
class.yaf-view-simple.php                          14-Apr-2024 10:04               11243
class.yar-client-exception.php                     14-Apr-2024 10:04                6591
class.yar-client.php                               14-Apr-2024 10:04                5796
class.yar-concurrent-client.php                    14-Apr-2024 10:04                6596
class.yar-server-exception.php                     14-Apr-2024 10:04                7048
class.yar-server.php                               14-Apr-2024 10:04                3444
class.ziparchive.php                               14-Apr-2024 10:04               89694
class.zmq.php                                      14-Apr-2024 10:04               41055
class.zmqcontext.php                               14-Apr-2024 10:04                5575
class.zmqdevice.php                                14-Apr-2024 10:04                7024
class.zmqpoll.php                                  14-Apr-2024 10:04                5160
class.zmqsocket.php                                14-Apr-2024 10:04               11437
class.zookeeper.php                                14-Apr-2024 10:04               56068
class.zookeeperauthenticationexception.php         14-Apr-2024 10:04                7677
class.zookeeperconfig.php                          14-Apr-2024 10:04                6408
class.zookeeperconnectionexception.php             14-Apr-2024 10:04                7672
class.zookeeperexception.php                       14-Apr-2024 10:04                7538
class.zookeepermarshallingexception.php            14-Apr-2024 10:04                7693
class.zookeepernonodeexception.php                 14-Apr-2024 10:04                7660
class.zookeeperoperationtimeoutexception.php       14-Apr-2024 10:04                7703
class.zookeepersessionexception.php                14-Apr-2024 10:04                7630
classobj.configuration.php                         14-Apr-2024 10:04                1254
classobj.constants.php                             14-Apr-2024 10:04                1142
classobj.examples.php                              14-Apr-2024 10:04               13293
classobj.installation.php                          14-Apr-2024 10:04                1233
classobj.requirements.php                          14-Apr-2024 10:04                1190
classobj.resources.php                             14-Apr-2024 10:04                1193
classobj.setup.php                                 14-Apr-2024 10:04                1579
closure.bind.php                                   14-Apr-2024 10:04                7929
closure.bindto.php                                 14-Apr-2024 10:04                9563
closure.call.php                                   14-Apr-2024 10:04                6304
closure.construct.php                              14-Apr-2024 10:04                2448
closure.fromcallable.php                           14-Apr-2024 10:04                3750
cmark.constants.php                                14-Apr-2024 10:04                4193
cmark.installation.php                             14-Apr-2024 10:04                1924
cmark.requirements.php                             14-Apr-2024 10:04                1270
cmark.setup.php                                    14-Apr-2024 10:04                1403
collator.asort.php                                 14-Apr-2024 10:04                9488
collator.compare.php                               14-Apr-2024 10:04               10556
collator.construct.php                             14-Apr-2024 10:04                5608
collator.create.php                                14-Apr-2024 10:04                5548
collator.getattribute.php                          14-Apr-2024 10:04                6046
collator.geterrorcode.php                          14-Apr-2024 10:04                5240
collator.geterrormessage.php                       14-Apr-2024 10:04                5311
collator.getlocale.php                             14-Apr-2024 10:04                6828
collator.getsortkey.php                            14-Apr-2024 10:04                6955
collator.getstrength.php                           14-Apr-2024 10:04                4852
collator.setattribute.php                          14-Apr-2024 10:04                6657
collator.setstrength.php                           14-Apr-2024 10:04               13233
collator.sort.php                                  14-Apr-2024 10:04                8298
collator.sortwithsortkeys.php                      14-Apr-2024 10:04                6513
collectable.isgarbage.php                          14-Apr-2024 10:04                3411
com.configuration.php                              14-Apr-2024 10:04                8286
com.constants.php                                  14-Apr-2024 10:04               26209
com.construct.php                                  14-Apr-2024 10:04                9460
com.error-handling.php                             14-Apr-2024 10:04                1550
com.examples.arrays.php                            14-Apr-2024 10:04                2051
com.examples.foreach.php                           14-Apr-2024 10:04                2832
com.examples.php                                   14-Apr-2024 10:04                1399
com.installation.php                               14-Apr-2024 10:04                1478
com.requirements.php                               14-Apr-2024 10:04                1230
com.resources.php                                  14-Apr-2024 10:04                1158
com.setup.php                                      14-Apr-2024 10:04                1531
commonmark-cql.construct.php                       14-Apr-2024 10:04                2186
commonmark-cql.invoke.php                          14-Apr-2024 10:04                3864
commonmark-interfaces-ivisitable.accept.php        14-Apr-2024 10:04                3105
commonmark-interfaces-ivisitor.enter.php           14-Apr-2024 10:04                4138
commonmark-interfaces-ivisitor.leave.php           14-Apr-2024 10:04                4140
commonmark-node-bulletlist.construct.php           14-Apr-2024 10:04                3179
commonmark-node-codeblock.construct.php            14-Apr-2024 10:04                2827
commonmark-node-heading.construct.php              14-Apr-2024 10:04                2620
commonmark-node-image.construct.php                14-Apr-2024 10:04                3270
commonmark-node-link.construct.php                 14-Apr-2024 10:04                3267
commonmark-node-orderedlist.construct.php          14-Apr-2024 10:04                4155
commonmark-node-text.construct.php                 14-Apr-2024 10:04                2655
commonmark-node.accept.php                         14-Apr-2024 10:04                2845
commonmark-node.appendchild.php                    14-Apr-2024 10:04                2699
commonmark-node.insertafter.php                    14-Apr-2024 10:04                2724
commonmark-node.insertbefore.php                   14-Apr-2024 10:04                2722
commonmark-node.prependchild.php                   14-Apr-2024 10:04                2726
commonmark-node.replace.php                        14-Apr-2024 10:04                2670
commonmark-node.unlink.php                         14-Apr-2024 10:04                2374
commonmark-parser.construct.php                    14-Apr-2024 10:04                3800
commonmark-parser.finish.php                       14-Apr-2024 10:04                2404
commonmark-parser.parse.php                        14-Apr-2024 10:04                2629
compersisthelper.construct.php                     14-Apr-2024 10:04                3593
compersisthelper.getcurfilename.php                14-Apr-2024 10:04                3117
compersisthelper.getmaxstreamsize.php              14-Apr-2024 10:04                3123
compersisthelper.initnew.php                       14-Apr-2024 10:04                3081
compersisthelper.loadfromfile.php                  14-Apr-2024 10:04                4291
compersisthelper.loadfromstream.php                14-Apr-2024 10:04                3508
compersisthelper.savetofile.php                    14-Apr-2024 10:04                6291
compersisthelper.savetostream.php                  14-Apr-2024 10:04                3535
componere-abstract-definition.addinterface.php     14-Apr-2024 10:04                3238
componere-abstract-definition.addmethod.php        14-Apr-2024 10:04                3964
componere-abstract-definition.addtrait.php         14-Apr-2024 10:04                3190
componere-abstract-definition.getreflector.php     14-Apr-2024 10:04                2362
componere-definition.addconstant.php               14-Apr-2024 10:04                4287
componere-definition.addproperty.php               14-Apr-2024 10:04                3696
componere-definition.construct.php                 14-Apr-2024 10:04                5925
componere-definition.getclosure.php                14-Apr-2024 10:04                3402
componere-definition.getclosures.php               14-Apr-2024 10:04                2644
componere-definition.isregistered.php              14-Apr-2024 10:04                2244
componere-definition.register.php                  14-Apr-2024 10:04                2389
componere-method.construct.php                     14-Apr-2024 10:04                2182
componere-method.getreflector.php                  14-Apr-2024 10:04                2165
componere-method.setprivate.php                    14-Apr-2024 10:04                2393
componere-method.setprotected.php                  14-Apr-2024 10:04                2408
componere-method.setstatic.php                     14-Apr-2024 10:04                1990
componere-patch.apply.php                          14-Apr-2024 10:04                1847
componere-patch.construct.php                      14-Apr-2024 10:04                3594
componere-patch.derive.php                         14-Apr-2024 10:04                3095
componere-patch.getclosure.php                     14-Apr-2024 10:04                3032
componere-patch.getclosures.php                    14-Apr-2024 10:04                2165
componere-patch.isapplied.php                      14-Apr-2024 10:04                1801
componere-patch.revert.php                         14-Apr-2024 10:04                1844
componere-value.construct.php                      14-Apr-2024 10:04                2615
componere-value.hasdefault.php                     14-Apr-2024 10:04                1847
componere-value.isprivate.php                      14-Apr-2024 10:04                1866
componere-value.isprotected.php                    14-Apr-2024 10:04                1876
componere-value.isstatic.php                       14-Apr-2024 10:04                1860
componere-value.setprivate.php                     14-Apr-2024 10:04                2416
componere-value.setprotected.php                   14-Apr-2024 10:04                2430
componere-value.setstatic.php                      14-Apr-2024 10:04                2007
componere.cast.php                                 14-Apr-2024 10:04                4862
componere.cast_by_ref.php                          14-Apr-2024 10:04                5035
componere.installation.php                         14-Apr-2024 10:04                1313
componere.requirements.php                         14-Apr-2024 10:04                1160
componere.setup.php                                14-Apr-2024 10:04                1442
configuration.changes.modes.php                    14-Apr-2024 10:04                3978
configuration.changes.php                          14-Apr-2024 10:04                8417
configuration.file.per-user.php                    14-Apr-2024 10:04                2926
configuration.file.php                             14-Apr-2024 10:04                9712
configuration.php                                  14-Apr-2024 10:04                1636
configure.about.php                                14-Apr-2024 10:04               12098
configure.php                                      14-Apr-2024 10:04                1357
context.ftp.php                                    14-Apr-2024 10:04                4131
context.http.php                                   14-Apr-2024 10:04               15603
context.params.php                                 14-Apr-2024 10:04                2523
context.phar.php                                   14-Apr-2024 10:04                2711
context.php                                        14-Apr-2024 10:04                2792
context.socket.php                                 14-Apr-2024 10:04                9307
context.ssl.php                                    14-Apr-2024 10:04               12324
context.zip.php                                    14-Apr-2024 10:04                4137
context.zlib.php                                   14-Apr-2024 10:04                2400
control-structures.alternative-syntax.php          14-Apr-2024 10:04                6979
control-structures.break.php                       14-Apr-2024 10:04                4619
control-structures.continue.php                    14-Apr-2024 10:04                6988
control-structures.declare.php                     14-Apr-2024 10:04                9929
control-structures.do.while.php                    14-Apr-2024 10:04                4980
control-structures.else.php                        14-Apr-2024 10:04                4734
control-structures.elseif.php                      14-Apr-2024 10:04                7553
control-structures.for.php                         14-Apr-2024 10:04               11555
control-structures.foreach.php                     14-Apr-2024 10:04               20607
control-structures.goto.php                        14-Apr-2024 10:04                7148
control-structures.if.php                          14-Apr-2024 10:04                4763
control-structures.intro.php                       14-Apr-2024 10:04                2518
control-structures.match.php                       14-Apr-2024 10:04               16419
control-structures.switch.php                      14-Apr-2024 10:04               18423
control-structures.while.php                       14-Apr-2024 10:04                4581
copyright.php                                      14-Apr-2024 10:04                1993
countable.count.php                                14-Apr-2024 10:04                5369
ctype.configuration.php                            14-Apr-2024 10:04                1233
ctype.constants.php                                14-Apr-2024 10:04                1115
ctype.installation.php                             14-Apr-2024 10:04                1498
ctype.requirements.php                             14-Apr-2024 10:04                1195
ctype.resources.php                                14-Apr-2024 10:04                1172
ctype.setup.php                                    14-Apr-2024 10:04                1539
cubrid.configuration.php                           14-Apr-2024 10:04                1181
cubrid.constants.php                               14-Apr-2024 10:04               13751
cubrid.examples.php                                14-Apr-2024 10:04               13778
cubrid.installation.php                            14-Apr-2024 10:04                2090
cubrid.requirements.php                            14-Apr-2024 10:04                1236
cubrid.resources.php                               14-Apr-2024 10:04                3064
cubrid.setup.php                                   14-Apr-2024 10:04                1553
cubridmysql.cubrid.php                             14-Apr-2024 10:04                4909
curl.configuration.php                             14-Apr-2024 10:04                2514
curl.constants.php                                 14-Apr-2024 10:04              184497
curl.examples-basic.php                            14-Apr-2024 10:04                4524
curl.examples.php                                  14-Apr-2024 10:04                1327
curl.installation.php                              14-Apr-2024 10:04                2365
curl.requirements.php                              14-Apr-2024 10:04                1535
curl.resources.php                                 14-Apr-2024 10:04                1210
curl.setup.php                                     14-Apr-2024 10:04                1548
curlfile.construct.php                             14-Apr-2024 10:04               21171
curlfile.getfilename.php                           14-Apr-2024 10:04                2118
curlfile.getmimetype.php                           14-Apr-2024 10:04                2124
curlfile.getpostfilename.php                       14-Apr-2024 10:04                2174
curlfile.setmimetype.php                           14-Apr-2024 10:04                2413
curlfile.setpostfilename.php                       14-Apr-2024 10:04                2454
curlstringfile.construct.php                       14-Apr-2024 10:04                6945
dateinterval.construct.php                         14-Apr-2024 10:04               13384
dateinterval.createfromdatestring.php              14-Apr-2024 10:04               15496
dateinterval.format.php                            14-Apr-2024 10:04               14538
dateperiod.construct.php                           14-Apr-2024 10:04               19715
dateperiod.createfromiso8601string.php             14-Apr-2024 10:04                7829
dateperiod.getdateinterval.php                     14-Apr-2024 10:04                4740
dateperiod.getenddate.php                          14-Apr-2024 10:04                7685
dateperiod.getrecurrences.php                      14-Apr-2024 10:04                8837
dateperiod.getstartdate.php                        14-Apr-2024 10:04                5207
datetime.add.php                                   14-Apr-2024 10:04                4840
datetime.configuration.php                         14-Apr-2024 10:04                5891
datetime.constants.php                             14-Apr-2024 10:04                2845
datetime.construct.php                             14-Apr-2024 10:04                6169
datetime.createfromformat.php                      14-Apr-2024 10:04                7286
datetime.createfromimmutable.php                   14-Apr-2024 10:04                4820
datetime.createfrominterface.php                   14-Apr-2024 10:04                4799
datetime.diff.php                                  14-Apr-2024 10:04               17141
datetime.error.tree.php                            14-Apr-2024 10:04                3251
datetime.examples-arithmetic.php                   14-Apr-2024 10:04               15077
datetime.examples.php                              14-Apr-2024 10:04                1383
datetime.format.php                                14-Apr-2024 10:04               26712
datetime.formats.php                               14-Apr-2024 10:04               55180
datetime.getlasterrors.php                         14-Apr-2024 10:04                1829
datetime.getoffset.php                             14-Apr-2024 10:04                7842
datetime.gettimestamp.php                          14-Apr-2024 10:04               10187
datetime.gettimezone.php                           14-Apr-2024 10:04                7757
datetime.installation.php                          14-Apr-2024 10:04                1590
datetime.modify.php                                14-Apr-2024 10:04               14201
datetime.requirements.php                          14-Apr-2024 10:04                1190
datetime.resources.php                             14-Apr-2024 10:04                1193
datetime.set-state.php                             14-Apr-2024 10:04                2825
datetime.setdate.php                               14-Apr-2024 10:04                5498
datetime.setisodate.php                            14-Apr-2024 10:04                5667
datetime.settime.php                               14-Apr-2024 10:04                7003
datetime.settimestamp.php                          14-Apr-2024 10:04                4962
datetime.settimezone.php                           14-Apr-2024 10:04                9265
datetime.setup.php                                 14-Apr-2024 10:04                1603
datetime.sub.php                                   14-Apr-2024 10:04                6203
datetime.wakeup.php                                14-Apr-2024 10:04                3002
datetimeimmutable.add.php                          14-Apr-2024 10:04               10463
datetimeimmutable.construct.php                    14-Apr-2024 10:04               18378
datetimeimmutable.createfromformat.php             14-Apr-2024 10:04               46948
datetimeimmutable.createfrominterface.php          14-Apr-2024 10:04                5063
datetimeimmutable.createfrommutable.php            14-Apr-2024 10:04                4977
datetimeimmutable.getlasterrors.php                14-Apr-2024 10:04                5576
datetimeimmutable.modify.php                       14-Apr-2024 10:04                9244
datetimeimmutable.set-state.php                    14-Apr-2024 10:04                2740
datetimeimmutable.setdate.php                      14-Apr-2024 10:04                9101
datetimeimmutable.setisodate.php                   14-Apr-2024 10:04               12691
datetimeimmutable.settime.php                      14-Apr-2024 10:04               11913
datetimeimmutable.settimestamp.php                 14-Apr-2024 10:04                5734
datetimeimmutable.settimezone.php                  14-Apr-2024 10:04                5921
datetimeimmutable.sub.php                          14-Apr-2024 10:04               11913
datetimezone.construct.php                         14-Apr-2024 10:04               10574
datetimezone.getlocation.php                       14-Apr-2024 10:04                5880
datetimezone.getname.php                           14-Apr-2024 10:04                3586
datetimezone.getoffset.php                         14-Apr-2024 10:04                6976
datetimezone.gettransitions.php                    14-Apr-2024 10:04               12093
datetimezone.listabbreviations.php                 14-Apr-2024 10:04                6000
datetimezone.listidentifiers.php                   14-Apr-2024 10:04               14543
dba.configuration.php                              14-Apr-2024 10:04                2274
dba.constants.php                                  14-Apr-2024 10:04                2105
dba.example.php                                    14-Apr-2024 10:04                6162
dba.examples.php                                   14-Apr-2024 10:04                1288
dba.installation.php                               14-Apr-2024 10:04                9378
dba.requirements.php                               14-Apr-2024 10:04                7236
dba.resources.php                                  14-Apr-2024 10:04                1428
dba.setup.php                                      14-Apr-2024 10:04                1534
dbase.configuration.php                            14-Apr-2024 10:04                1233
dbase.constants.php                                14-Apr-2024 10:04                3597
dbase.installation.php                             14-Apr-2024 10:04                1585
dbase.requirements.php                             14-Apr-2024 10:04                1169
dbase.resources.php                                14-Apr-2024 10:04                1440
dbase.setup.php                                    14-Apr-2024 10:04                1555
debugger-about.php                                 14-Apr-2024 10:04                1688
debugger.php                                       14-Apr-2024 10:04                1326
dio.configuration.php                              14-Apr-2024 10:04                1219
dio.constants.php                                  14-Apr-2024 10:04               10958
dio.installation.php                               14-Apr-2024 10:04                2018
dio.requirements.php                               14-Apr-2024 10:04                1155
dio.resources.php                                  14-Apr-2024 10:04                1286
dio.setup.php                                      14-Apr-2024 10:04                1536
dir.configuration.php                              14-Apr-2024 10:04                1219
dir.constants.php                                  14-Apr-2024 10:04                2737
dir.installation.php                               14-Apr-2024 10:04                1198
dir.requirements.php                               14-Apr-2024 10:04                1155
dir.resources.php                                  14-Apr-2024 10:04                1158
dir.setup.php                                      14-Apr-2024 10:04                1530
directory.close.php                                14-Apr-2024 10:04                2153
directory.read.php                                 14-Apr-2024 10:04                2287
directory.rewind.php                               14-Apr-2024 10:04                2164
directoryiterator.construct.php                    14-Apr-2024 10:04                5759
directoryiterator.current.php                      14-Apr-2024 10:04                6047
directoryiterator.getbasename.php                  14-Apr-2024 10:04                6345
directoryiterator.getextension.php                 14-Apr-2024 10:04                6086
directoryiterator.getfilename.php                  14-Apr-2024 10:04                5080
directoryiterator.isdot.php                        14-Apr-2024 10:04                5273
directoryiterator.key.php                          14-Apr-2024 10:04                6507
directoryiterator.next.php                         14-Apr-2024 10:04                5401
directoryiterator.rewind.php                       14-Apr-2024 10:04                5319
directoryiterator.seek.php                         14-Apr-2024 10:04                5262
directoryiterator.tostring.php                     14-Apr-2024 10:04                4592
directoryiterator.valid.php                        14-Apr-2024 10:04                5713
doc.changelog.php                                  14-Apr-2024 10:04                1278
dom.configuration.php                              14-Apr-2024 10:04                1219
dom.constants.php                                  14-Apr-2024 10:04               19670
dom.examples.php                                   14-Apr-2024 10:04                2902
dom.installation.php                               14-Apr-2024 10:04                1298
dom.requirements.php                               14-Apr-2024 10:04                1450
dom.resources.php                                  14-Apr-2024 10:04                1158
dom.setup.php                                      14-Apr-2024 10:04                1524
domattr.construct.php                              14-Apr-2024 10:04                5535
domattr.isid.php                                   14-Apr-2024 10:04                4988
domcdatasection.construct.php                      14-Apr-2024 10:04                5114
domcharacterdata.after.php                         14-Apr-2024 10:04                7707
domcharacterdata.appenddata.php                    14-Apr-2024 10:04                4352
domcharacterdata.before.php                        14-Apr-2024 10:04                7335
domcharacterdata.deletedata.php                    14-Apr-2024 10:04                5037
domcharacterdata.insertdata.php                    14-Apr-2024 10:04                4761
domcharacterdata.remove.php                        14-Apr-2024 10:04                5360
domcharacterdata.replacedata.php                   14-Apr-2024 10:04                5429
domcharacterdata.replacewith.php                   14-Apr-2024 10:04                7791
domcharacterdata.substringdata.php                 14-Apr-2024 10:04                4875
domchildnode.after.php                             14-Apr-2024 10:04                5631
domchildnode.before.php                            14-Apr-2024 10:04                5057
domchildnode.remove.php                            14-Apr-2024 10:04                3073
domchildnode.replacewith.php                       14-Apr-2024 10:04                5249
domcomment.construct.php                           14-Apr-2024 10:04                4945
domdocument.adoptnode.php                          14-Apr-2024 10:04                6658
domdocument.append.php                             14-Apr-2024 10:04                6758
domdocument.construct.php                          14-Apr-2024 10:04                4333
domdocument.createattribute.php                    14-Apr-2024 10:04                5820
domdocument.createattributens.php                  14-Apr-2024 10:04                8141
domdocument.createcdatasection.php                 14-Apr-2024 10:04                5432
domdocument.createcomment.php                      14-Apr-2024 10:04                5817
domdocument.createdocumentfragment.php             14-Apr-2024 10:04                5652
domdocument.createelement.php                      14-Apr-2024 10:04               11253
domdocument.createelementns.php                    14-Apr-2024 10:04               13976
domdocument.createentityreference.php              14-Apr-2024 10:04                6137
domdocument.createprocessinginstruction.php        14-Apr-2024 10:04                6457
domdocument.createtextnode.php                     14-Apr-2024 10:04                5805
domdocument.getelementbyid.php                     14-Apr-2024 10:04                7619
domdocument.getelementsbytagname.php               14-Apr-2024 10:04                5992
domdocument.getelementsbytagnamens.php             14-Apr-2024 10:04                7637
domdocument.importnode.php                         14-Apr-2024 10:04                8881
domdocument.load.php                               14-Apr-2024 10:04                6568
domdocument.loadhtml.php                           14-Apr-2024 10:04                7761
domdocument.loadhtmlfile.php                       14-Apr-2024 10:04                7880
domdocument.loadxml.php                            14-Apr-2024 10:04                6283
domdocument.normalizedocument.php                  14-Apr-2024 10:04                2934
domdocument.prepend.php                            14-Apr-2024 10:04                6850
domdocument.registernodeclass.php                  14-Apr-2024 10:04               15201
domdocument.relaxngvalidate.php                    14-Apr-2024 10:04                3995
domdocument.relaxngvalidatesource.php              14-Apr-2024 10:04                4050
domdocument.replacechildren.php                    14-Apr-2024 10:04                7147
domdocument.save.php                               14-Apr-2024 10:04                7549
domdocument.savehtml.php                           14-Apr-2024 10:04                7484
domdocument.savehtmlfile.php                       14-Apr-2024 10:04                7925
domdocument.savexml.php                            14-Apr-2024 10:04                9677
domdocument.schemavalidate.php                     14-Apr-2024 10:04                4381
domdocument.schemavalidatesource.php               14-Apr-2024 10:04                4443
domdocument.validate.php                           14-Apr-2024 10:04                6019
domdocument.xinclude.php                           14-Apr-2024 10:04                7112
domdocumentfragment.append.php                     14-Apr-2024 10:04                7448
domdocumentfragment.appendxml.php                  14-Apr-2024 10:04                5523
domdocumentfragment.construct.php                  14-Apr-2024 10:04                2104
domdocumentfragment.prepend.php                    14-Apr-2024 10:04                7506
domdocumentfragment.replacechildren.php            14-Apr-2024 10:04                7891
domelement.after.php                               14-Apr-2024 10:04                7385
domelement.append.php                              14-Apr-2024 10:04                7070
domelement.before.php                              14-Apr-2024 10:04                6970
domelement.construct.php                           14-Apr-2024 10:04                6621
domelement.getattribute.php                        14-Apr-2024 10:04                3500
domelement.getattributenames.php                   14-Apr-2024 10:04                3925
domelement.getattributenode.php                    14-Apr-2024 10:04                4049
domelement.getattributenodens.php                  14-Apr-2024 10:04                4539
domelement.getattributens.php                      14-Apr-2024 10:04                4042
domelement.getelementsbytagname.php                14-Apr-2024 10:04                3607
domelement.getelementsbytagnamens.php              14-Apr-2024 10:04                4700
domelement.hasattribute.php                        14-Apr-2024 10:04                3799
domelement.hasattributens.php                      14-Apr-2024 10:04                4271
domelement.insertadjacentelement.php               14-Apr-2024 10:04                6602
domelement.insertadjacenttext.php                  14-Apr-2024 10:04                6422
domelement.prepend.php                             14-Apr-2024 10:04                7120
domelement.remove.php                              14-Apr-2024 10:04                5003
domelement.removeattribute.php                     14-Apr-2024 10:04                4014
domelement.removeattributenode.php                 14-Apr-2024 10:04                4368
domelement.removeattributens.php                   14-Apr-2024 10:04                4295
domelement.replacechildren.php                     14-Apr-2024 10:04                7711
domelement.replacewith.php                         14-Apr-2024 10:04                7775
domelement.setattribute.php                        14-Apr-2024 10:04                6157
domelement.setattributenode.php                    14-Apr-2024 10:04                4712
domelement.setattributenodens.php                  14-Apr-2024 10:04                4779
domelement.setattributens.php                      14-Apr-2024 10:04                5224
domelement.setidattribute.php                      14-Apr-2024 10:04                4750
domelement.setidattributenode.php                  14-Apr-2024 10:04                4744
domelement.setidattributens.php                    14-Apr-2024 10:04                5202
domelement.toggleattribute.php                     14-Apr-2024 10:04                6379
domentityreference.construct.php                   14-Apr-2024 10:04                4787
domimplementation.construct.php                    14-Apr-2024 10:04                2114
domimplementation.createdocument.php               14-Apr-2024 10:04                7322
domimplementation.createdocumenttype.php           14-Apr-2024 10:04                9832
domimplementation.hasfeature.php                   14-Apr-2024 10:04                9244
domnamednodemap.count.php                          14-Apr-2024 10:04                2392
domnamednodemap.getiterator.php                    14-Apr-2024 10:04                3157
domnamednodemap.getnameditem.php                   14-Apr-2024 10:04                3428
domnamednodemap.getnameditemns.php                 14-Apr-2024 10:04                3880
domnamednodemap.item.php                           14-Apr-2024 10:04                3028
domnode.appendchild.php                            14-Apr-2024 10:04                8663
domnode.c14n.php                                   14-Apr-2024 10:04                4878
domnode.c14nfile.php                               14-Apr-2024 10:04                5212
domnode.clonenode.php                              14-Apr-2024 10:04                2801
domnode.contains.php                               14-Apr-2024 10:04                5314
domnode.getlineno.php                              14-Apr-2024 10:04                4831
domnode.getnodepath.php                            14-Apr-2024 10:04                5185
domnode.getrootnode.php                            14-Apr-2024 10:04                4248
domnode.hasattributes.php                          14-Apr-2024 10:04                2935
domnode.haschildnodes.php                          14-Apr-2024 10:04                2799
domnode.insertbefore.php                           14-Apr-2024 10:04                5369
domnode.isdefaultnamespace.php                     14-Apr-2024 10:04                2889
domnode.isequalnode.php                            14-Apr-2024 10:04                4653
domnode.issamenode.php                             14-Apr-2024 10:04                2755
domnode.issupported.php                            14-Apr-2024 10:04                3783
domnode.lookupnamespaceuri.php                     14-Apr-2024 10:04                3545
domnode.lookupprefix.php                           14-Apr-2024 10:04                3183
domnode.normalize.php                              14-Apr-2024 10:04                2780
domnode.removechild.php                            14-Apr-2024 10:04                6927
domnode.replacechild.php                           14-Apr-2024 10:04                5617
domnodelist.count.php                              14-Apr-2024 10:04                2321
domnodelist.getiterator.php                        14-Apr-2024 10:04                3060
domnodelist.item.php                               14-Apr-2024 10:04                6937
domparentnode.append.php                           14-Apr-2024 10:04                4733
domparentnode.prepend.php                          14-Apr-2024 10:04                4773
domparentnode.replacechildren.php                  14-Apr-2024 10:04                6578
domprocessinginstruction.construct.php             14-Apr-2024 10:04                6638
domtext.construct.php                              14-Apr-2024 10:04                4743
domtext.iselementcontentwhitespace.php             14-Apr-2024 10:04                2613
domtext.iswhitespaceinelementcontent.php           14-Apr-2024 10:04                2807
domtext.splittext.php                              14-Apr-2024 10:04                3197
domxpath.construct.php                             14-Apr-2024 10:04                3456
domxpath.evaluate.php                              14-Apr-2024 10:04                7857
domxpath.query.php                                 14-Apr-2024 10:04               12322
domxpath.registernamespace.php                     14-Apr-2024 10:04                3273
domxpath.registerphpfunctions.php                  14-Apr-2024 10:04               13734
dotnet.construct.php                               14-Apr-2024 10:04                3077
ds-collection.clear.php                            14-Apr-2024 10:04                3883
ds-collection.copy.php                             14-Apr-2024 10:04                4283
ds-collection.isempty.php                          14-Apr-2024 10:04                4211
ds-collection.toarray.php                          14-Apr-2024 10:04                4200
ds-deque.allocate.php                              14-Apr-2024 10:04                4631
ds-deque.apply.php                                 14-Apr-2024 10:04                4931
ds-deque.capacity.php                              14-Apr-2024 10:04                3910
ds-deque.clear.php                                 14-Apr-2024 10:04                3800
ds-deque.construct.php                             14-Apr-2024 10:04                4273
ds-deque.contains.php                              14-Apr-2024 10:04                7044
ds-deque.copy.php                                  14-Apr-2024 10:04                4149
ds-deque.count.php                                 14-Apr-2024 10:04                1533
ds-deque.filter.php                                14-Apr-2024 10:04                7573
ds-deque.find.php                                  14-Apr-2024 10:04                5381
ds-deque.first.php                                 14-Apr-2024 10:04                3718
ds-deque.get.php                                   14-Apr-2024 10:04                6547
ds-deque.insert.php                                14-Apr-2024 10:04                6627
ds-deque.isempty.php                               14-Apr-2024 10:04                4097
ds-deque.join.php                                  14-Apr-2024 10:04                5698
ds-deque.jsonserialize.php                         14-Apr-2024 10:04                1813
ds-deque.last.php                                  14-Apr-2024 10:04                3706
ds-deque.map.php                                   14-Apr-2024 10:04                5277
ds-deque.merge.php                                 14-Apr-2024 10:04                4827
ds-deque.pop.php                                   14-Apr-2024 10:04                4203
ds-deque.push.php                                  14-Apr-2024 10:04                4635
ds-deque.reduce.php                                14-Apr-2024 10:04                7944
ds-deque.remove.php                                14-Apr-2024 10:04                4824
ds-deque.reverse.php                               14-Apr-2024 10:04                3636
ds-deque.reversed.php                              14-Apr-2024 10:04                3974
ds-deque.rotate.php                                14-Apr-2024 10:04                5021
ds-deque.set.php                                   14-Apr-2024 10:04                6027
ds-deque.shift.php                                 14-Apr-2024 10:04                4304
ds-deque.slice.php                                 14-Apr-2024 10:04                7105
ds-deque.sort.php                                  14-Apr-2024 10:04                7347
ds-deque.sorted.php                                14-Apr-2024 10:04                7361
ds-deque.sum.php                                   14-Apr-2024 10:04                5223
ds-deque.toarray.php                               14-Apr-2024 10:04                4086
ds-deque.unshift.php                               14-Apr-2024 10:04                4714
ds-hashable.equals.php                             14-Apr-2024 10:04                3658
ds-hashable.hash.php                               14-Apr-2024 10:04                7428
ds-map.allocate.php                                14-Apr-2024 10:04                4497
ds-map.apply.php                                   14-Apr-2024 10:04                5627
ds-map.capacity.php                                14-Apr-2024 10:04                3200
ds-map.clear.php                                   14-Apr-2024 10:04                4276
ds-map.construct.php                               14-Apr-2024 10:04                4775
ds-map.copy.php                                    14-Apr-2024 10:04                4009
ds-map.count.php                                   14-Apr-2024 10:04                1494
ds-map.diff.php                                    14-Apr-2024 10:04                5408
ds-map.filter.php                                  14-Apr-2024 10:04                8357
ds-map.first.php                                   14-Apr-2024 10:04                4017
ds-map.get.php                                     14-Apr-2024 10:04                8371
ds-map.haskey.php                                  14-Apr-2024 10:04                4640
ds-map.hasvalue.php                                14-Apr-2024 10:04                4684
ds-map.intersect.php                               14-Apr-2024 10:04                5929
ds-map.isempty.php                                 14-Apr-2024 10:04                4319
ds-map.jsonserialize.php                           14-Apr-2024 10:04                1791
ds-map.keys.php                                    14-Apr-2024 10:04                3910
ds-map.ksort.php                                   14-Apr-2024 10:04                8034
ds-map.ksorted.php                                 14-Apr-2024 10:04                8110
ds-map.last.php                                    14-Apr-2024 10:04                4002
ds-map.map.php                                     14-Apr-2024 10:04                6258
ds-map.merge.php                                   14-Apr-2024 10:04                5807
ds-map.pairs.php                                   14-Apr-2024 10:04                4325
ds-map.put.php                                     14-Apr-2024 10:04               13905
ds-map.putall.php                                  14-Apr-2024 10:04                5500
ds-map.reduce.php                                  14-Apr-2024 10:04                8879
ds-map.remove.php                                  14-Apr-2024 10:04                6923
ds-map.reverse.php                                 14-Apr-2024 10:04                4088
ds-map.reversed.php                                14-Apr-2024 10:04                4184
ds-map.skip.php                                    14-Apr-2024 10:04                4574
ds-map.slice.php                                   14-Apr-2024 10:04                7957
ds-map.sort.php                                    14-Apr-2024 10:04                7957
ds-map.sorted.php                                  14-Apr-2024 10:04                8089
ds-map.sum.php                                     14-Apr-2024 10:04                5690
ds-map.toarray.php                                 14-Apr-2024 10:04                5089
ds-map.union.php                                   14-Apr-2024 10:04                5913
ds-map.values.php                                  14-Apr-2024 10:04                3909
ds-map.xor.php                                     14-Apr-2024 10:04                5474
ds-pair.clear.php                                  14-Apr-2024 10:04                3705
ds-pair.construct.php                              14-Apr-2024 10:04                2553
ds-pair.copy.php                                   14-Apr-2024 10:04                4063
ds-pair.isempty.php                                14-Apr-2024 10:04                4047
ds-pair.jsonserialize.php                          14-Apr-2024 10:04                1811
ds-pair.toarray.php                                14-Apr-2024 10:04                4020
ds-priorityqueue.allocate.php                      14-Apr-2024 10:04                4797
ds-priorityqueue.capacity.php                      14-Apr-2024 10:04                3409
ds-priorityqueue.clear.php                         14-Apr-2024 10:04                4457
ds-priorityqueue.construct.php                     14-Apr-2024 10:04                2871
ds-priorityqueue.copy.php                          14-Apr-2024 10:04                4452
ds-priorityqueue.count.php                         14-Apr-2024 10:04                1642
ds-priorityqueue.isempty.php                       14-Apr-2024 10:04                5007
ds-priorityqueue.jsonserialize.php                 14-Apr-2024 10:04                1931
ds-priorityqueue.peek.php                          14-Apr-2024 10:04                4696
ds-priorityqueue.pop.php                           14-Apr-2024 10:04                5466
ds-priorityqueue.push.php                          14-Apr-2024 10:04                5561
ds-priorityqueue.toarray.php                       14-Apr-2024 10:04                5185
ds-queue.allocate.php                              14-Apr-2024 10:04                4824
ds-queue.capacity.php                              14-Apr-2024 10:04                3916
ds-queue.clear.php                                 14-Apr-2024 10:04                3785
ds-queue.construct.php                             14-Apr-2024 10:04                4271
ds-queue.copy.php                                  14-Apr-2024 10:04                4251
ds-queue.count.php                                 14-Apr-2024 10:04                1530
ds-queue.isempty.php                               14-Apr-2024 10:04                4113
ds-queue.jsonserialize.php                         14-Apr-2024 10:04                1819
ds-queue.peek.php                                  14-Apr-2024 10:04                4300
ds-queue.pop.php                                   14-Apr-2024 10:04                4834
ds-queue.push.php                                  14-Apr-2024 10:04                4670
ds-queue.toarray.php                               14-Apr-2024 10:04                4250
ds-sequence.allocate.php                           14-Apr-2024 10:04                4535
ds-sequence.apply.php                              14-Apr-2024 10:04                5046
ds-sequence.capacity.php                           14-Apr-2024 10:04                4465
ds-sequence.contains.php                           14-Apr-2024 10:04                7171
ds-sequence.filter.php                             14-Apr-2024 10:04                7712
ds-sequence.find.php                               14-Apr-2024 10:04                5493
ds-sequence.first.php                              14-Apr-2024 10:04                3833
ds-sequence.get.php                                14-Apr-2024 10:04                6675
ds-sequence.insert.php                             14-Apr-2024 10:04                6746
ds-sequence.join.php                               14-Apr-2024 10:04                5794
ds-sequence.last.php                               14-Apr-2024 10:04                3800
ds-sequence.map.php                                14-Apr-2024 10:04                5406
ds-sequence.merge.php                              14-Apr-2024 10:04                4953
ds-sequence.pop.php                                14-Apr-2024 10:04                4315
ds-sequence.push.php                               14-Apr-2024 10:04                4757
ds-sequence.reduce.php                             14-Apr-2024 10:04                8063
ds-sequence.remove.php                             14-Apr-2024 10:04                4936
ds-sequence.reverse.php                            14-Apr-2024 10:04                3749
ds-sequence.reversed.php                           14-Apr-2024 10:04                4097
ds-sequence.rotate.php                             14-Apr-2024 10:04                5158
ds-sequence.set.php                                14-Apr-2024 10:04                6151
ds-sequence.shift.php                              14-Apr-2024 10:04                4416
ds-sequence.slice.php                              14-Apr-2024 10:04                7270
ds-sequence.sort.php                               14-Apr-2024 10:04                7474
ds-sequence.sorted.php                             14-Apr-2024 10:04                7488
ds-sequence.sum.php                                14-Apr-2024 10:04                5348
ds-sequence.unshift.php                            14-Apr-2024 10:04                4825
ds-set.add.php                                     14-Apr-2024 10:04               12138
ds-set.allocate.php                                14-Apr-2024 10:04                4506
ds-set.capacity.php                                14-Apr-2024 10:04                3868
ds-set.clear.php                                   14-Apr-2024 10:04                3731
ds-set.construct.php                               14-Apr-2024 10:04                4225
ds-set.contains.php                                14-Apr-2024 10:04                7240
ds-set.copy.php                                    14-Apr-2024 10:04                4190
ds-set.count.php                                   14-Apr-2024 10:04                1494
ds-set.diff.php                                    14-Apr-2024 10:04                4698
ds-set.filter.php                                  14-Apr-2024 10:04                7521
ds-set.first.php                                   14-Apr-2024 10:04                3671
ds-set.get.php                                     14-Apr-2024 10:04                6491
ds-set.intersect.php                               14-Apr-2024 10:04                4929
ds-set.isempty.php                                 14-Apr-2024 10:04                4055
ds-set.join.php                                    14-Apr-2024 10:04                5644
ds-set.jsonserialize.php                           14-Apr-2024 10:04                1785
ds-set.last.php                                    14-Apr-2024 10:04                3672
ds-set.merge.php                                   14-Apr-2024 10:04                4753
ds-set.reduce.php                                  14-Apr-2024 10:04                7890
ds-set.remove.php                                  14-Apr-2024 10:04                4941
ds-set.reverse.php                                 14-Apr-2024 10:04                3584
ds-set.reversed.php                                14-Apr-2024 10:04                3912
ds-set.slice.php                                   14-Apr-2024 10:04                7019
ds-set.sort.php                                    14-Apr-2024 10:04                7283
ds-set.sorted.php                                  14-Apr-2024 10:04                7297
ds-set.sum.php                                     14-Apr-2024 10:04                5163
ds-set.toarray.php                                 14-Apr-2024 10:04                4032
ds-set.union.php                                   14-Apr-2024 10:04                4892
ds-set.xor.php                                     14-Apr-2024 10:04                4868
ds-stack.allocate.php                              14-Apr-2024 10:04                2818
ds-stack.capacity.php                              14-Apr-2024 10:04                2150
ds-stack.clear.php                                 14-Apr-2024 10:04                3781
ds-stack.construct.php                             14-Apr-2024 10:04                4237
ds-stack.copy.php                                  14-Apr-2024 10:04                4251
ds-stack.count.php                                 14-Apr-2024 10:04                1530
ds-stack.isempty.php                               14-Apr-2024 10:04                4113
ds-stack.jsonserialize.php                         14-Apr-2024 10:04                1819
ds-stack.peek.php                                  14-Apr-2024 10:04                4294
ds-stack.pop.php                                   14-Apr-2024 10:04                4828
ds-stack.push.php                                  14-Apr-2024 10:04                4670
ds-stack.toarray.php                               14-Apr-2024 10:04                4077
ds-vector.allocate.php                             14-Apr-2024 10:04                4452
ds-vector.apply.php                                14-Apr-2024 10:04                4957
ds-vector.capacity.php                             14-Apr-2024 10:04                4370
ds-vector.clear.php                                14-Apr-2024 10:04                3812
ds-vector.construct.php                            14-Apr-2024 10:04                4305
ds-vector.contains.php                             14-Apr-2024 10:04                7074
ds-vector.copy.php                                 14-Apr-2024 10:04                4275
ds-vector.count.php                                14-Apr-2024 10:04                1547
ds-vector.filter.php                               14-Apr-2024 10:04                7607
ds-vector.find.php                                 14-Apr-2024 10:04                5406
ds-vector.first.php                                14-Apr-2024 10:04                3744
ds-vector.get.php                                  14-Apr-2024 10:04                6578
ds-vector.insert.php                               14-Apr-2024 10:04                6657
ds-vector.isempty.php                              14-Apr-2024 10:04                4121
ds-vector.join.php                                 14-Apr-2024 10:04                5725
ds-vector.jsonserialize.php                        14-Apr-2024 10:04                1827
ds-vector.last.php                                 14-Apr-2024 10:04                3731
ds-vector.map.php                                  14-Apr-2024 10:04                5309
ds-vector.merge.php                                14-Apr-2024 10:04                4858
ds-vector.pop.php                                  14-Apr-2024 10:04                4228
ds-vector.push.php                                 14-Apr-2024 10:04                4664
ds-vector.reduce.php                               14-Apr-2024 10:04                7972
ds-vector.remove.php                               14-Apr-2024 10:04                4849
ds-vector.reverse.php                              14-Apr-2024 10:04                3662
ds-vector.reversed.php                             14-Apr-2024 10:04                4004
ds-vector.rotate.php                               14-Apr-2024 10:04                5055
ds-vector.set.php                                  14-Apr-2024 10:04                6058
ds-vector.shift.php                                14-Apr-2024 10:04                4329
ds-vector.slice.php                                14-Apr-2024 10:04                7151
ds-vector.sort.php                                 14-Apr-2024 10:04                7379
ds-vector.sorted.php                               14-Apr-2024 10:04                7393
ds-vector.sum.php                                  14-Apr-2024 10:04                5253
ds-vector.toarray.php                              14-Apr-2024 10:04                4111
ds-vector.unshift.php                              14-Apr-2024 10:04                4744
ds.constants.php                                   14-Apr-2024 10:04                1102
ds.examples.php                                    14-Apr-2024 10:04                4654
ds.installation.php                                14-Apr-2024 10:04                2466
ds.requirements.php                                14-Apr-2024 10:04                1161
ds.setup.php                                       14-Apr-2024 10:04                1379
eio.configuration.php                              14-Apr-2024 10:04                1217
eio.constants.php                                  14-Apr-2024 10:04               21769
eio.examples.php                                   14-Apr-2024 10:04               27007
eio.installation.php                               14-Apr-2024 10:04                1723
eio.requirements.php                               14-Apr-2024 10:04                1281
eio.resources.php                                  14-Apr-2024 10:04                1194
eio.setup.php                                      14-Apr-2024 10:04                1536
emptyiterator.current.php                          14-Apr-2024 10:04                2719
emptyiterator.key.php                              14-Apr-2024 10:04                2683
emptyiterator.next.php                             14-Apr-2024 10:04                2382
emptyiterator.rewind.php                           14-Apr-2024 10:04                2404
emptyiterator.valid.php                            14-Apr-2024 10:04                2703
enchant.configuration.php                          14-Apr-2024 10:04                1247
enchant.constants.php                              14-Apr-2024 10:04                2873
enchant.examples.php                               14-Apr-2024 10:04                5359
enchant.installation.php                           14-Apr-2024 10:04                3162
enchant.requirements.php                           14-Apr-2024 10:04                1764
enchant.resources.php                              14-Apr-2024 10:04                1301
enchant.setup.php                                  14-Apr-2024 10:04                1581
error.clone.php                                    14-Apr-2024 10:04                2786
error.construct.php                                14-Apr-2024 10:04                3385
error.getcode.php                                  14-Apr-2024 10:04                4002
error.getfile.php                                  14-Apr-2024 10:04                3735
error.getline.php                                  14-Apr-2024 10:04                3946
error.getmessage.php                               14-Apr-2024 10:04                3810
error.getprevious.php                              14-Apr-2024 10:04                6572
error.gettrace.php                                 14-Apr-2024 10:04                4280
error.gettraceasstring.php                         14-Apr-2024 10:04                4063
error.tostring.php                                 14-Apr-2024 10:04                3974
errorexception.construct.php                       14-Apr-2024 10:04                6151
errorexception.getseverity.php                     14-Apr-2024 10:04                4338
errorfunc.configuration.php                        14-Apr-2024 10:04               25965
errorfunc.constants.php                            14-Apr-2024 10:04               11380
errorfunc.examples.php                             14-Apr-2024 10:04               19214
errorfunc.installation.php                         14-Apr-2024 10:04                1240
errorfunc.requirements.php                         14-Apr-2024 10:04                1197
errorfunc.resources.php                            14-Apr-2024 10:04                1200
errorfunc.setup.php                                14-Apr-2024 10:04                1597
ev.backend.php                                     14-Apr-2024 10:04                3360
ev.configuration.php                               14-Apr-2024 10:04                1212
ev.depth.php                                       14-Apr-2024 10:04                3230
ev.embeddablebackends.php                          14-Apr-2024 10:04                6427
ev.examples.php                                    14-Apr-2024 10:04               41739
ev.feedsignal.php                                  14-Apr-2024 10:04                3356
ev.feedsignalevent.php                             14-Apr-2024 10:04                3143
ev.global.constants.php                            14-Apr-2024 10:04                1256
ev.installation.php                                14-Apr-2024 10:04                1719
ev.iteration.php                                   14-Apr-2024 10:04                2606
ev.now.php                                         14-Apr-2024 10:04                3077
ev.nowupdate.php                                   14-Apr-2024 10:04                3164
ev.periodic-modes.php                              14-Apr-2024 10:04                7612
ev.recommendedbackends.php                         14-Apr-2024 10:04                7119
ev.requirements.php                                14-Apr-2024 10:04                1216
ev.resources.php                                   14-Apr-2024 10:04                1158
ev.resume.php                                      14-Apr-2024 10:04                3686
ev.run.php                                         14-Apr-2024 10:04                5054
ev.setup.php                                       14-Apr-2024 10:04                1491
ev.sleep.php                                       14-Apr-2024 10:04                2414
ev.stop.php                                        14-Apr-2024 10:04                2855
ev.supportedbackends.php                           14-Apr-2024 10:04                6409
ev.suspend.php                                     14-Apr-2024 10:04                3453
ev.time.php                                        14-Apr-2024 10:04                2651
ev.verify.php                                      14-Apr-2024 10:04                2243
ev.watcher-callbacks.php                           14-Apr-2024 10:04                4485
ev.watchers.php                                    14-Apr-2024 10:04                3403
evcheck.construct.php                              14-Apr-2024 10:04                3623
evcheck.createstopped.php                          14-Apr-2024 10:04                3733
evchild.construct.php                              14-Apr-2024 10:04                6700
evchild.createstopped.php                          14-Apr-2024 10:04                5104
evchild.set.php                                    14-Apr-2024 10:04                3192
evembed.construct.php                              14-Apr-2024 10:04                7914
evembed.createstopped.php                          14-Apr-2024 10:04                4746
evembed.set.php                                    14-Apr-2024 10:04                2538
evembed.sweep.php                                  14-Apr-2024 10:04                3049
event.add.php                                      14-Apr-2024 10:04               10274
event.addsignal.php                                14-Apr-2024 10:04                1632
event.addtimer.php                                 14-Apr-2024 10:04                1641
event.callbacks.php                                14-Apr-2024 10:04                5640
event.configuration.php                            14-Apr-2024 10:04                1233
event.construct.php                                14-Apr-2024 10:04                4551
event.constructing.signal.events.php               14-Apr-2024 10:04                6001
event.del.php                                      14-Apr-2024 10:04                2620
event.delsignal.php                                14-Apr-2024 10:04                1632
event.deltimer.php                                 14-Apr-2024 10:04                1629
event.examples.php                                 14-Apr-2024 10:04              164998
event.flags.php                                    14-Apr-2024 10:04                2564
event.free.php                                     14-Apr-2024 10:04                3007
event.getsupportedmethods.php                      14-Apr-2024 10:04                2648
event.installation.php                             14-Apr-2024 10:04                1746
event.pending.php                                  14-Apr-2024 10:04                3094
event.persistence.php                              14-Apr-2024 10:04                2894
event.requirements.php                             14-Apr-2024 10:04                1434
event.resources.php                                14-Apr-2024 10:04                1157
event.set.php                                      14-Apr-2024 10:04                4679
event.setpriority.php                              14-Apr-2024 10:04                2595
event.settimer.php                                 14-Apr-2024 10:04                4109
event.setup.php                                    14-Apr-2024 10:04                1530
event.signal.php                                   14-Apr-2024 10:04                4286
event.timer.php                                    14-Apr-2024 10:04                3575
eventbase.construct.php                            14-Apr-2024 10:04                3024
eventbase.dispatch.php                             14-Apr-2024 10:04                3313
eventbase.exit.php                                 14-Apr-2024 10:04                3095
eventbase.free.php                                 14-Apr-2024 10:04                3362
eventbase.getfeatures.php                          14-Apr-2024 10:04                5749
eventbase.getmethod.php                            14-Apr-2024 10:04                4539
eventbase.gettimeofdaycached.php                   14-Apr-2024 10:04                2718
eventbase.gotexit.php                              14-Apr-2024 10:04                3339
eventbase.gotstop.php                              14-Apr-2024 10:04                3311
eventbase.loop.php                                 14-Apr-2024 10:04                3637
eventbase.priorityinit.php                         14-Apr-2024 10:04                3072
eventbase.reinit.php                               14-Apr-2024 10:04                2403
eventbase.stop.php                                 14-Apr-2024 10:04                2873
eventbuffer.add.php                                14-Apr-2024 10:04                3073
eventbuffer.addbuffer.php                          14-Apr-2024 10:04                3425
eventbuffer.appendfrom.php                         14-Apr-2024 10:04                4920
eventbuffer.construct.php                          14-Apr-2024 10:04                1953
eventbuffer.copyout.php                            14-Apr-2024 10:04                3960
eventbuffer.drain.php                              14-Apr-2024 10:04                3548
eventbuffer.enablelocking.php                      14-Apr-2024 10:04                2890
eventbuffer.expand.php                             14-Apr-2024 10:04                2868
eventbuffer.freeze.php                             14-Apr-2024 10:04                3121
eventbuffer.lock.php                               14-Apr-2024 10:04                3015
eventbuffer.prepend.php                            14-Apr-2024 10:04                3548
eventbuffer.prependbuffer.php                      14-Apr-2024 10:04                3710
eventbuffer.pullup.php                             14-Apr-2024 10:04                4667
eventbuffer.read.php                               14-Apr-2024 10:04                4945
eventbuffer.readfrom.php                           14-Apr-2024 10:04                4373
eventbuffer.readline.php                           14-Apr-2024 10:04                4294
eventbuffer.search.php                             14-Apr-2024 10:04                8398
eventbuffer.searcheol.php                          14-Apr-2024 10:04                4939
eventbuffer.substr.php                             14-Apr-2024 10:04                3580
eventbuffer.unfreeze.php                           14-Apr-2024 10:04                3135
eventbuffer.unlock.php                             14-Apr-2024 10:04                2848
eventbuffer.write.php                              14-Apr-2024 10:04                3486
eventbufferevent.about.callbacks.php               14-Apr-2024 10:04                6105
eventbufferevent.close.php                         14-Apr-2024 10:04                2578
eventbufferevent.connect.php                       14-Apr-2024 10:04               23922
eventbufferevent.connecthost.php                   14-Apr-2024 10:04               17811
eventbufferevent.construct.php                     14-Apr-2024 10:04                6873
eventbufferevent.createpair.php                    14-Apr-2024 10:04                4335
eventbufferevent.disable.php                       14-Apr-2024 10:04                3576
eventbufferevent.enable.php                        14-Apr-2024 10:04                4046
eventbufferevent.free.php                          14-Apr-2024 10:04                2799
eventbufferevent.getdnserrorstring.php             14-Apr-2024 10:04                3118
eventbufferevent.getenabled.php                    14-Apr-2024 10:04                3067
eventbufferevent.getinput.php                      14-Apr-2024 10:04                5007
eventbufferevent.getoutput.php                     14-Apr-2024 10:04                7888
eventbufferevent.read.php                          14-Apr-2024 10:04                3082
eventbufferevent.readbuffer.php                    14-Apr-2024 10:04                3262
eventbufferevent.setcallbacks.php                  14-Apr-2024 10:04                4579
eventbufferevent.setpriority.php                   14-Apr-2024 10:04                2977
eventbufferevent.settimeouts.php                   14-Apr-2024 10:04                3202
eventbufferevent.setwatermark.php                  14-Apr-2024 10:04                4110
eventbufferevent.sslerror.php                      14-Apr-2024 10:04                5889
eventbufferevent.sslfilter.php                     14-Apr-2024 10:04               34498
eventbufferevent.sslgetcipherinfo.php              14-Apr-2024 10:04                2928
eventbufferevent.sslgetciphername.php              14-Apr-2024 10:04                2831
eventbufferevent.sslgetcipherversion.php           14-Apr-2024 10:04                2860
eventbufferevent.sslgetprotocol.php                14-Apr-2024 10:04                2737
eventbufferevent.sslrenegotiate.php                14-Apr-2024 10:04                2834
eventbufferevent.sslsocket.php                     14-Apr-2024 10:04                5905
eventbufferevent.write.php                         14-Apr-2024 10:04                3258
eventbufferevent.writebuffer.php                   14-Apr-2024 10:04                3380
eventconfig.avoidmethod.php                        14-Apr-2024 10:04                4418
eventconfig.construct.php                          14-Apr-2024 10:04                4046
eventconfig.requirefeatures.php                    14-Apr-2024 10:04                6019
eventconfig.setflags.php                           14-Apr-2024 10:04                3375
eventconfig.setmaxdispatchinterval.php             14-Apr-2024 10:04                4570
eventdnsbase.addnameserverip.php                   14-Apr-2024 10:04                3004
eventdnsbase.addsearch.php                         14-Apr-2024 10:04                2568
eventdnsbase.clearsearch.php                       14-Apr-2024 10:04                2821
eventdnsbase.construct.php                         14-Apr-2024 10:04                7528
eventdnsbase.countnameservers.php                  14-Apr-2024 10:04                2544
eventdnsbase.loadhosts.php                         14-Apr-2024 10:04                2877
eventdnsbase.parseresolvconf.php                   14-Apr-2024 10:04                4253
eventdnsbase.setoption.php                         14-Apr-2024 10:04                3451
eventdnsbase.setsearchndots.php                    14-Apr-2024 10:04                2940
eventhttp.accept.php                               14-Apr-2024 10:04               12419
eventhttp.addserveralias.php                       14-Apr-2024 10:04                6460
eventhttp.bind.php                                 14-Apr-2024 10:04                7882
eventhttp.construct.php                            14-Apr-2024 10:04               17397
eventhttp.removeserveralias.php                    14-Apr-2024 10:04                3268
eventhttp.setallowedmethods.php                    14-Apr-2024 10:04                3407
eventhttp.setcallback.php                          14-Apr-2024 10:04               18081
eventhttp.setdefaultcallback.php                   14-Apr-2024 10:04                7878
eventhttp.setmaxbodysize.php                       14-Apr-2024 10:04                2923
eventhttp.setmaxheaderssize.php                    14-Apr-2024 10:04                2835
eventhttp.settimeout.php                           14-Apr-2024 10:04                2521
eventhttpconnection.construct.php                  14-Apr-2024 10:04                5119
eventhttpconnection.getbase.php                    14-Apr-2024 10:04                2619
eventhttpconnection.getpeer.php                    14-Apr-2024 10:04                3037
eventhttpconnection.makerequest.php                14-Apr-2024 10:04               11689
eventhttpconnection.setclosecallback.php           14-Apr-2024 10:04                9440
eventhttpconnection.setlocaladdress.php            14-Apr-2024 10:04                3222
eventhttpconnection.setlocalport.php               14-Apr-2024 10:04                3103
eventhttpconnection.setmaxbodysize.php             14-Apr-2024 10:04                3147
eventhttpconnection.setmaxheaderssize.php          14-Apr-2024 10:04                3168
eventhttpconnection.setretries.php                 14-Apr-2024 10:04                2751
eventhttpconnection.settimeout.php                 14-Apr-2024 10:04                2648
eventhttprequest.addheader.php                     14-Apr-2024 10:04                3990
eventhttprequest.cancel.php                        14-Apr-2024 10:04                2853
eventhttprequest.clearheaders.php                  14-Apr-2024 10:04                2806
eventhttprequest.closeconnection.php               14-Apr-2024 10:04                2408
eventhttprequest.construct.php                     14-Apr-2024 10:04               11405
eventhttprequest.findheader.php                    14-Apr-2024 10:04                3545
eventhttprequest.free.php                          14-Apr-2024 10:04                2316
eventhttprequest.getbufferevent.php                14-Apr-2024 10:04                3679
eventhttprequest.getcommand.php                    14-Apr-2024 10:04                2683
eventhttprequest.getconnection.php                 14-Apr-2024 10:04                4433
eventhttprequest.gethost.php                       14-Apr-2024 10:04                2861
eventhttprequest.getinputbuffer.php                14-Apr-2024 10:04                2763
eventhttprequest.getinputheaders.php               14-Apr-2024 10:04                2854
eventhttprequest.getoutputbuffer.php               14-Apr-2024 10:04                2822
eventhttprequest.getoutputheaders.php              14-Apr-2024 10:04                2805
eventhttprequest.getresponsecode.php               14-Apr-2024 10:04                3141
eventhttprequest.geturi.php                        14-Apr-2024 10:04                3054
eventhttprequest.removeheader.php                  14-Apr-2024 10:04                3505
eventhttprequest.senderror.php                     14-Apr-2024 10:04                5848
eventhttprequest.sendreply.php                     14-Apr-2024 10:04                4058
eventhttprequest.sendreplychunk.php                14-Apr-2024 10:04                3430
eventhttprequest.sendreplyend.php                  14-Apr-2024 10:04                3039
eventhttprequest.sendreplystart.php                14-Apr-2024 10:04                4317
eventlistener.construct.php                        14-Apr-2024 10:04               22409
eventlistener.disable.php                          14-Apr-2024 10:04                2824
eventlistener.enable.php                           14-Apr-2024 10:04                2810
eventlistener.getbase.php                          14-Apr-2024 10:04                2322
eventlistener.getsocketname.php                    14-Apr-2024 10:04                3372
eventlistener.setcallback.php                      14-Apr-2024 10:04                6029
eventlistener.seterrorcallback.php                 14-Apr-2024 10:04                4394
eventsslcontext.construct.php                      14-Apr-2024 10:04                5281
eventutil.construct.php                            14-Apr-2024 10:04                2147
eventutil.getlastsocketerrno.php                   14-Apr-2024 10:04                3294
eventutil.getlastsocketerror.php                   14-Apr-2024 10:04                3110
eventutil.getsocketfd.php                          14-Apr-2024 10:04                3211
eventutil.getsocketname.php                        14-Apr-2024 10:04                3775
eventutil.setsocketoption.php                      14-Apr-2024 10:04                5704
eventutil.sslrandpoll.php                          14-Apr-2024 10:04                2381
evfork.construct.php                               14-Apr-2024 10:04                3649
evfork.createstopped.php                           14-Apr-2024 10:04                3935
evidle.construct.php                               14-Apr-2024 10:04                3653
evidle.createstopped.php                           14-Apr-2024 10:04                4133
evio.construct.php                                 14-Apr-2024 10:04                4801
evio.createstopped.php                             14-Apr-2024 10:04                5139
evio.set.php                                       14-Apr-2024 10:04                2833
evloop.backend.php                                 14-Apr-2024 10:04                2707
evloop.check.php                                   14-Apr-2024 10:04                3290
evloop.child.php                                   14-Apr-2024 10:04                3772
evloop.construct.php                               14-Apr-2024 10:04                4020
evloop.defaultloop.php                             14-Apr-2024 10:04                4619
evloop.embed.php                                   14-Apr-2024 10:04                3815
evloop.fork.php                                    14-Apr-2024 10:04                3372
evloop.idle.php                                    14-Apr-2024 10:04                3392
evloop.invokepending.php                           14-Apr-2024 10:04                2223
evloop.io.php                                      14-Apr-2024 10:04                3828
evloop.loopfork.php                                14-Apr-2024 10:04                2561
evloop.now.php                                     14-Apr-2024 10:04                2821
evloop.nowupdate.php                               14-Apr-2024 10:04                3143
evloop.periodic.php                                14-Apr-2024 10:04                3966
evloop.prepare.php                                 14-Apr-2024 10:04                3390
evloop.resume.php                                  14-Apr-2024 10:04                2803
evloop.run.php                                     14-Apr-2024 10:04                5037
evloop.signal.php                                  14-Apr-2024 10:04                3695
evloop.stat.php                                    14-Apr-2024 10:04                3876
evloop.stop.php                                    14-Apr-2024 10:04                2967
evloop.suspend.php                                 14-Apr-2024 10:04                2795
evloop.timer.php                                   14-Apr-2024 10:04                3893
evloop.verify.php                                  14-Apr-2024 10:04                2568
evperiodic.again.php                               14-Apr-2024 10:04                2558
evperiodic.at.php                                  14-Apr-2024 10:04                2623
evperiodic.construct.php                           14-Apr-2024 10:04               10004
evperiodic.createstopped.php                       14-Apr-2024 10:04                5841
evperiodic.set.php                                 14-Apr-2024 10:04                3190
evprepare.construct.php                            14-Apr-2024 10:04                3556
evprepare.createstopped.php                        14-Apr-2024 10:04                4296
evsignal.construct.php                             14-Apr-2024 10:04                5476
evsignal.createstopped.php                         14-Apr-2024 10:04                4821
evsignal.set.php                                   14-Apr-2024 10:04                2490
evstat.attr.php                                    14-Apr-2024 10:04                8205
evstat.construct.php                               14-Apr-2024 10:04                7194
evstat.createstopped.php                           14-Apr-2024 10:04                5197
evstat.prev.php                                    14-Apr-2024 10:04                2919
evstat.set.php                                     14-Apr-2024 10:04                2849
evstat.stat.php                                    14-Apr-2024 10:04                2976
evtimer.again.php                                  14-Apr-2024 10:04                3053
evtimer.construct.php                              14-Apr-2024 10:04               12642
evtimer.createstopped.php                          14-Apr-2024 10:04                8335
evtimer.set.php                                    14-Apr-2024 10:04                3006
evwatcher.clear.php                                14-Apr-2024 10:04                2810
evwatcher.construct.php                            14-Apr-2024 10:04                2088
evwatcher.feed.php                                 14-Apr-2024 10:04                2603
evwatcher.getloop.php                              14-Apr-2024 10:04                2296
evwatcher.invoke.php                               14-Apr-2024 10:04                2610
evwatcher.keepalive.php                            14-Apr-2024 10:04                5315
evwatcher.setcallback.php                          14-Apr-2024 10:04                2565
evwatcher.start.php                                14-Apr-2024 10:04                2500
evwatcher.stop.php                                 14-Apr-2024 10:04                2469
example.xml-external-entity.php                    14-Apr-2024 10:04               21330
example.xml-map-tags.php                           14-Apr-2024 10:04                8104
example.xml-structure.php                          14-Apr-2024 10:04                6190
example.xmlwriter-namespace.php                    14-Apr-2024 10:04                5342
example.xmlwriter-oop.php                          14-Apr-2024 10:04                3350
example.xmlwriter-simple.php                       14-Apr-2024 10:04                8595
exception.clone.php                                14-Apr-2024 10:04                3040
exception.construct.php                            14-Apr-2024 10:04                3755
exception.getcode.php                              14-Apr-2024 10:04                4570
exception.getfile.php                              14-Apr-2024 10:04                3860
exception.getline.php                              14-Apr-2024 10:04                4070
exception.getmessage.php                           14-Apr-2024 10:04                3955
exception.getprevious.php                          14-Apr-2024 10:04                6826
exception.gettrace.php                             14-Apr-2024 10:04                4395
exception.gettraceasstring.php                     14-Apr-2024 10:04                4178
exception.tostring.php                             14-Apr-2024 10:04                4131
exec.configuration.php                             14-Apr-2024 10:04                1226
exec.constants.php                                 14-Apr-2024 10:04                1132
exec.installation.php                              14-Apr-2024 10:04                1205
exec.requirements.php                              14-Apr-2024 10:04                1162
exec.resources.php                                 14-Apr-2024 10:04                1301
exec.setup.php                                     14-Apr-2024 10:04                1550
exif.configuration.php                             14-Apr-2024 10:04                7233
exif.constants.php                                 14-Apr-2024 10:04                1990
exif.installation.php                              14-Apr-2024 10:04                1620
exif.requirements.php                              14-Apr-2024 10:04                1735
exif.resources.php                                 14-Apr-2024 10:04                1165
exif.setup.php                                     14-Apr-2024 10:04                1548
expect.configuration.php                           14-Apr-2024 10:04                5372
expect.constants.php                               14-Apr-2024 10:04                3827
expect.examples-usage.php                          14-Apr-2024 10:04               12152
expect.examples.php                                14-Apr-2024 10:04                1352
expect.installation.php                            14-Apr-2024 10:04                2370
expect.requirements.php                            14-Apr-2024 10:04                1287
expect.resources.php                               14-Apr-2024 10:04                1378
expect.setup.php                                   14-Apr-2024 10:04                1574
extensions.alphabetical.php                        14-Apr-2024 10:04               20773
extensions.membership.php                          14-Apr-2024 10:04               20496
extensions.php                                     14-Apr-2024 10:04                1632
extensions.state.php                               14-Apr-2024 10:04                2707
fann.configuration.php                             14-Apr-2024 10:04                1226
fann.constants.php                                 14-Apr-2024 10:04               23551
fann.examples-1.php                                14-Apr-2024 10:04                8462
fann.examples.php                                  14-Apr-2024 10:04                1306
fann.installation.php                              14-Apr-2024 10:04                4865
fann.requirements.php                              14-Apr-2024 10:04                1142
fann.resources.php                                 14-Apr-2024 10:04                1115
fann.setup.php                                     14-Apr-2024 10:04                1521
fannconnection.construct.php                       14-Apr-2024 10:04                2981
fannconnection.getfromneuron.php                   14-Apr-2024 10:04                2349
fannconnection.gettoneuron.php                     14-Apr-2024 10:04                2337
fannconnection.getweight.php                       14-Apr-2024 10:04                2272
fannconnection.setweight.php                       14-Apr-2024 10:04                2912
faq.build.php                                      14-Apr-2024 10:04               27187
faq.com.php                                        14-Apr-2024 10:04               12286
faq.databases.php                                  14-Apr-2024 10:04               12188
faq.general.php                                    14-Apr-2024 10:04                4943
faq.html.php                                       14-Apr-2024 10:04               19517
faq.installation.php                               14-Apr-2024 10:04               25586
faq.mailinglist.php                                14-Apr-2024 10:04               11254
faq.misc.php                                       14-Apr-2024 10:04                4596
faq.obtaining.php                                  14-Apr-2024 10:04               10770
faq.passwords.php                                  14-Apr-2024 10:04                9496
faq.php                                            14-Apr-2024 10:04                1995
faq.using.php                                      14-Apr-2024 10:04               21762
fdf.configuration.php                              14-Apr-2024 10:04                1219
fdf.constants.php                                  14-Apr-2024 10:04                9164
fdf.examples.php                                   14-Apr-2024 10:04                5951
fdf.installation.php                               14-Apr-2024 10:04                3407
fdf.requirements.php                               14-Apr-2024 10:04                1479
fdf.resources.php                                  14-Apr-2024 10:04                1675
fdf.setup.php                                      14-Apr-2024 10:04                1529
features.commandline.differences.php               14-Apr-2024 10:04               12477
features.commandline.ini.php                       14-Apr-2024 10:04                2295
features.commandline.interactive.php               14-Apr-2024 10:04                7680
features.commandline.introduction.php              14-Apr-2024 10:04                6810
features.commandline.io-streams.php                14-Apr-2024 10:04                5952
features.commandline.options.php                   14-Apr-2024 10:04               26794
features.commandline.php                           14-Apr-2024 10:04                2000
features.commandline.usage.php                     14-Apr-2024 10:04               14251
features.commandline.webserver.php                 14-Apr-2024 10:04               12964
features.connection-handling.php                   14-Apr-2024 10:04                5560
features.cookies.php                               14-Apr-2024 10:04                3004
features.dtrace.dtrace.php                         14-Apr-2024 10:04               13910
features.dtrace.introduction.php                   14-Apr-2024 10:04                3080
features.dtrace.php                                14-Apr-2024 10:04                1612
features.dtrace.systemtap.php                      14-Apr-2024 10:04                8002
features.file-upload.common-pitfalls.php           14-Apr-2024 10:04                5441
features.file-upload.errors.php                    14-Apr-2024 10:04                3872
features.file-upload.errors.seealso.php            14-Apr-2024 10:04                1317
features.file-upload.multiple.php                  14-Apr-2024 10:04                4587
features.file-upload.php                           14-Apr-2024 10:04                1898
features.file-upload.post-method.php               14-Apr-2024 10:04               15687
features.file-upload.put-method.php                14-Apr-2024 10:04                5813
features.gc.collecting-cycles.php                  14-Apr-2024 10:04                7909
features.gc.performance-considerations.php         14-Apr-2024 10:04               13789
features.gc.php                                    14-Apr-2024 10:04                1707
features.gc.refcounting-basics.php                 14-Apr-2024 10:04               21416
features.http-auth.php                             14-Apr-2024 10:04               23495
features.persistent-connections.php                14-Apr-2024 10:04                9822
features.php                                       14-Apr-2024 10:04                4046
features.remote-files.php                          14-Apr-2024 10:04                8993
features.session.security.management.php           14-Apr-2024 10:04               23576
features.sessions.php                              14-Apr-2024 10:04                1396
features.xforms.php                                14-Apr-2024 10:04                5219
ffi-ctype.getalignment.php                         14-Apr-2024 10:04                2337
ffi-ctype.getarrayelementtype.php                  14-Apr-2024 10:04                2423
ffi-ctype.getarraylength.php                       14-Apr-2024 10:04                2380
ffi-ctype.getattributes.php                        14-Apr-2024 10:04                2356
ffi-ctype.getenumkind.php                          14-Apr-2024 10:04                2332
ffi-ctype.getfuncabi.php                           14-Apr-2024 10:04                2340
ffi-ctype.getfuncparametercount.php                14-Apr-2024 10:04                2446
ffi-ctype.getfuncparametertype.php                 14-Apr-2024 10:04                2684
ffi-ctype.getfuncreturntype.php                    14-Apr-2024 10:04                2405
ffi-ctype.getkind.php                              14-Apr-2024 10:04                2294
ffi-ctype.getname.php                              14-Apr-2024 10:04                2300
ffi-ctype.getpointertype.php                       14-Apr-2024 10:04                2349
ffi-ctype.getsize.php                              14-Apr-2024 10:04                2312
ffi-ctype.getstructfieldnames.php                  14-Apr-2024 10:04                2422
ffi-ctype.getstructfieldoffset.php                 14-Apr-2024 10:04                2680
ffi-ctype.getstructfieldtype.php                   14-Apr-2024 10:04                2642
ffi.addr.php                                       14-Apr-2024 10:04                2757
ffi.alignof.php                                    14-Apr-2024 10:04                2887
ffi.arraytype.php                                  14-Apr-2024 10:04                4587
ffi.cast.php                                       14-Apr-2024 10:04                4805
ffi.cdef.php                                       14-Apr-2024 10:04                4423
ffi.configuration.php                              14-Apr-2024 10:04                4288
ffi.constants.php                                  14-Apr-2024 10:04                1096
ffi.examples-basic.php                             14-Apr-2024 10:04               15762
ffi.examples-callback.php                          14-Apr-2024 10:04                4727
ffi.examples-complete.php                          14-Apr-2024 10:04                5401
ffi.examples.php                                   14-Apr-2024 10:04                1463
ffi.free.php                                       14-Apr-2024 10:04                2404
ffi.installation.php                               14-Apr-2024 10:04                1389
ffi.isnull.php                                     14-Apr-2024 10:04                2500
ffi.load.php                                       14-Apr-2024 10:04                4271
ffi.memcmp.php                                     14-Apr-2024 10:04                4065
ffi.memcpy.php                                     14-Apr-2024 10:04                3256
ffi.memset.php                                     14-Apr-2024 10:04                3096
ffi.new.php                                        14-Apr-2024 10:04                5137
ffi.requirements.php                               14-Apr-2024 10:04                1238
ffi.resources.php                                  14-Apr-2024 10:04                1158
ffi.scope.php                                      14-Apr-2024 10:04                3110
ffi.setup.php                                      14-Apr-2024 10:04                1519
ffi.sizeof.php                                     14-Apr-2024 10:04                2728
ffi.string.php                                     14-Apr-2024 10:04                4174
ffi.type.php                                       14-Apr-2024 10:04                3551
ffi.typeof.php                                     14-Apr-2024 10:04                2821
fiber.construct.php                                14-Apr-2024 10:04                2323
fiber.getcurrent.php                               14-Apr-2024 10:04                2484
fiber.getreturn.php                                14-Apr-2024 10:04                2557
fiber.isrunning.php                                14-Apr-2024 10:04                2705
fiber.isstarted.php                                14-Apr-2024 10:04                2319
fiber.issuspended.php                              14-Apr-2024 10:04                2334
fiber.isterminated.php                             14-Apr-2024 10:04                2391
fiber.resume.php                                   14-Apr-2024 10:04                3307
fiber.start.php                                    14-Apr-2024 10:04                2984
fiber.suspend.php                                  14-Apr-2024 10:04                4023
fiber.throw.php                                    14-Apr-2024 10:04                3167
fibererror.construct.php                           14-Apr-2024 10:04                2146
fileinfo.configuration.php                         14-Apr-2024 10:04                1254
fileinfo.constants.php                             14-Apr-2024 10:04                6012
fileinfo.installation.php                          14-Apr-2024 10:04                1659
fileinfo.requirements.php                          14-Apr-2024 10:04                1190
fileinfo.resources.php                             14-Apr-2024 10:04                1362
fileinfo.setup.php                                 14-Apr-2024 10:04                1594
filesystem.configuration.php                       14-Apr-2024 10:04                7484
filesystem.constants.php                           14-Apr-2024 10:04               13274
filesystem.installation.php                        14-Apr-2024 10:04                1247
filesystem.requirements.php                        14-Apr-2024 10:04                1204
filesystem.resources.php                           14-Apr-2024 10:04                1350
filesystem.setup.php                               14-Apr-2024 10:04                1621
filesystemiterator.construct.php                   14-Apr-2024 10:04                7502
filesystemiterator.current.php                     14-Apr-2024 10:04                5351
filesystemiterator.getflags.php                    14-Apr-2024 10:04                3176
filesystemiterator.key.php                         14-Apr-2024 10:04                5069
filesystemiterator.next.php                        14-Apr-2024 10:04                4489
filesystemiterator.rewind.php                      14-Apr-2024 10:04                5118
filesystemiterator.setflags.php                    14-Apr-2024 10:04                6631
filter.configuration.php                           14-Apr-2024 10:04                5030
filter.constants.php                               14-Apr-2024 10:04               24946
filter.examples.php                                14-Apr-2024 10:04                1413
filter.examples.sanitization.php                   14-Apr-2024 10:04                5526
filter.examples.validation.php                     14-Apr-2024 10:04               10098
filter.filters.flags.php                           14-Apr-2024 10:04               16809
filter.filters.misc.php                            14-Apr-2024 10:04                1887
filter.filters.php                                 14-Apr-2024 10:04                1570
filter.filters.sanitize.php                        14-Apr-2024 10:04               13581
filter.filters.validate.php                        14-Apr-2024 10:04               13895
filter.installation.php                            14-Apr-2024 10:04                1316
filter.requirements.php                            14-Apr-2024 10:04                1176
filter.resources.php                               14-Apr-2024 10:04                1173
filter.setup.php                                   14-Apr-2024 10:04                1558
filteriterator.accept.php                          14-Apr-2024 10:04                5270
filteriterator.construct.php                       14-Apr-2024 10:04                3060
filteriterator.current.php                         14-Apr-2024 10:04                2953
filteriterator.key.php                             14-Apr-2024 10:04                2893
filteriterator.next.php                            14-Apr-2024 10:04                2916
filteriterator.rewind.php                          14-Apr-2024 10:04                3094
filteriterator.valid.php                           14-Apr-2024 10:04                2786
filters.compression.php                            14-Apr-2024 10:04               15238
filters.convert.php                                14-Apr-2024 10:04               11420
filters.encryption.php                             14-Apr-2024 10:04               40801
filters.php                                        14-Apr-2024 10:04                3216
filters.string.php                                 14-Apr-2024 10:04                9900
finfo.buffer.php                                   14-Apr-2024 10:04                2847
finfo.construct.php                                14-Apr-2024 10:04                3028
finfo.file.php                                     14-Apr-2024 10:04                2838
finfo.set-flags.php                                14-Apr-2024 10:04                2051
fpm.observability.php                              14-Apr-2024 10:04                1355
fpm.setup.php                                      14-Apr-2024 10:04                1253
fpm.status.php                                     14-Apr-2024 10:04               10045
ftp.configuration.php                              14-Apr-2024 10:04                1219
ftp.constants.php                                  14-Apr-2024 10:04                5267
ftp.examples-basic.php                             14-Apr-2024 10:04                4733
ftp.examples.php                                   14-Apr-2024 10:04                1302
ftp.installation.php                               14-Apr-2024 10:04                1428
ftp.requirements.php                               14-Apr-2024 10:04                1155
ftp.resources.php                                  14-Apr-2024 10:04                1451
ftp.setup.php                                      14-Apr-2024 10:04                1529
funchand.configuration.php                         14-Apr-2024 10:04                1254
funchand.constants.php                             14-Apr-2024 10:04                1160
funchand.installation.php                          14-Apr-2024 10:04                1233
funchand.requirements.php                          14-Apr-2024 10:04                1190
funchand.resources.php                             14-Apr-2024 10:04                1193
funchand.setup.php                                 14-Apr-2024 10:04                1582
funcref.php                                        14-Apr-2024 10:04               14078
function.abs.php                                   14-Apr-2024 10:04                3620
function.acos.php                                  14-Apr-2024 10:04                2519
function.acosh.php                                 14-Apr-2024 10:04                2484
function.addcslashes.php                           14-Apr-2024 10:04                8655
function.addslashes.php                            14-Apr-2024 10:04                7280
function.apache-child-terminate.php                14-Apr-2024 10:04                4353
function.apache-get-modules.php                    14-Apr-2024 10:04                3373
function.apache-get-version.php                    14-Apr-2024 10:04                3889
function.apache-getenv.php                         14-Apr-2024 10:04                5172
function.apache-lookup-uri.php                     14-Apr-2024 10:04                5920
function.apache-note.php                           14-Apr-2024 10:04                2734
function.apache-request-headers.php                14-Apr-2024 10:04                5544
function.apache-response-headers.php               14-Apr-2024 10:04                4175
function.apache-setenv.php                         14-Apr-2024 10:04                3943
function.apcu-add.php                              14-Apr-2024 10:04                8460
function.apcu-cache-info.php                       14-Apr-2024 10:04                6701
function.apcu-cas.php                              14-Apr-2024 10:04                8768
function.apcu-clear-cache.php                      14-Apr-2024 10:04                2583
function.apcu-dec.php                              14-Apr-2024 10:04                8227
function.apcu-delete.php                           14-Apr-2024 10:04                6058
function.apcu-enabled.php                          14-Apr-2024 10:04                2371
function.apcu-entry.php                            14-Apr-2024 10:04                8433
function.apcu-exists.php                           14-Apr-2024 10:04                6933
function.apcu-fetch.php                            14-Apr-2024 10:04                5770
function.apcu-inc.php                              14-Apr-2024 10:04                8211
function.apcu-key-info.php                         14-Apr-2024 10:04                4955
function.apcu-sma-info.php                         14-Apr-2024 10:04                4602
function.apcu-store.php                            14-Apr-2024 10:04                7343
function.array-change-key-case.php                 14-Apr-2024 10:04                5734
function.array-chunk.php                           14-Apr-2024 10:04                6830
function.array-column.php                          14-Apr-2024 10:04               16950
function.array-combine.php                         14-Apr-2024 10:04                6589
function.array-count-values.php                    14-Apr-2024 10:04                5723
function.array-diff-assoc.php                      14-Apr-2024 10:04               10612
function.array-diff-key.php                        14-Apr-2024 10:04               12788
function.array-diff-uassoc.php                     14-Apr-2024 10:04               11909
function.array-diff-ukey.php                       14-Apr-2024 10:04               12254
function.array-diff.php                            14-Apr-2024 10:04                5940
function.array-fill-keys.php                       14-Apr-2024 10:04                5320
function.array-fill.php                            14-Apr-2024 10:04                4224
function.array-filter.php                          14-Apr-2024 10:04                9695
function.array-flip.php                            14-Apr-2024 10:04                5995
function.array-intersect-assoc.php                 14-Apr-2024 10:04                6515
function.array-intersect-key.php                   14-Apr-2024 10:04               10088
function.array-intersect-uassoc.php                14-Apr-2024 10:04                9005
function.array-intersect-ukey.php                  14-Apr-2024 10:04               11938
function.array-intersect.php                       14-Apr-2024 10:04                5192
function.array-is-list.php                         14-Apr-2024 10:04                7088
function.array-key-exists.php                      14-Apr-2024 10:04                8944
function.array-key-first.php                       14-Apr-2024 10:04                7095
function.array-key-last.php                        14-Apr-2024 10:04                3341
function.array-keys.php                            14-Apr-2024 10:04                3937
function.array-map.php                             14-Apr-2024 10:04               22655
function.array-merge-recursive.php                 14-Apr-2024 10:04                6333
function.array-merge.php                           14-Apr-2024 10:04               11464
function.array-multisort.php                       14-Apr-2024 10:04               23911
function.array-pad.php                             14-Apr-2024 10:04                5256
function.array-pop.php                             14-Apr-2024 10:04                5379
function.array-product.php                         14-Apr-2024 10:04                5708
function.array-push.php                            14-Apr-2024 10:04                5370
function.array-rand.php                            14-Apr-2024 10:04                3936
function.array-reduce.php                          14-Apr-2024 10:04                6719
function.array-replace-recursive.php               14-Apr-2024 10:04               11203
function.array-replace.php                         14-Apr-2024 10:04                6850
function.array-reverse.php                         14-Apr-2024 10:04                5010
function.array-search.php                          14-Apr-2024 10:04                7189
function.array-shift.php                           14-Apr-2024 10:04                4716
function.array-slice.php                           14-Apr-2024 10:04                6538
function.array-splice.php                          14-Apr-2024 10:04               11547
function.array-sum.php                             14-Apr-2024 10:04                4635
function.array-udiff-assoc.php                     14-Apr-2024 10:04               17880
function.array-udiff-uassoc.php                    14-Apr-2024 10:04               19324
function.array-udiff.php                           14-Apr-2024 10:04               30080
function.array-uintersect-assoc.php                14-Apr-2024 10:04               11801
function.array-uintersect-uassoc.php               14-Apr-2024 10:04               12149
function.array-uintersect.php                      14-Apr-2024 10:04               11402
function.array-unique.php                          14-Apr-2024 10:04                6300
function.array-unshift.php                         14-Apr-2024 10:04                4527
function.array-values.php                          14-Apr-2024 10:04                3561
function.array-walk-recursive.php                  14-Apr-2024 10:04                7633
function.array-walk.php                            14-Apr-2024 10:04               10061
function.array.php                                 14-Apr-2024 10:04                9111
function.arsort.php                                14-Apr-2024 10:04                5761
function.asin.php                                  14-Apr-2024 10:04                2521
function.asinh.php                                 14-Apr-2024 10:04                2485
function.asort.php                                 14-Apr-2024 10:04                5707
function.assert-options.php                        14-Apr-2024 10:04                4086
function.assert.php                                14-Apr-2024 10:04               25364
function.atan.php                                  14-Apr-2024 10:04                2458
function.atan2.php                                 14-Apr-2024 10:04                2705
function.atanh.php                                 14-Apr-2024 10:04                2516
function.autoload.php                              14-Apr-2024 10:04                3124
function.base-convert.php                          14-Apr-2024 10:04                4426
function.base64-decode.php                         14-Apr-2024 10:04                5143
function.base64-encode.php                         14-Apr-2024 10:04                4650
function.basename.php                              14-Apr-2024 10:04                4252
function.bcadd.php                                 14-Apr-2024 10:04                4259
function.bccomp.php                                14-Apr-2024 10:04                4639
function.bcdiv.php                                 14-Apr-2024 10:04                3646
function.bcmod.php                                 14-Apr-2024 10:04                3491
function.bcmul.php                                 14-Apr-2024 10:04                3960
function.bcpow.php                                 14-Apr-2024 10:04                3692
function.bcpowmod.php                              14-Apr-2024 10:04                5103
function.bcscale.php                               14-Apr-2024 10:04                3832
function.bcsqrt.php                                14-Apr-2024 10:04                3357
function.bcsub.php                                 14-Apr-2024 10:04                4260
function.bin2hex.php                               14-Apr-2024 10:04                2344
function.bind-textdomain-codeset.php               14-Apr-2024 10:04                4571
function.bindec.php                                14-Apr-2024 10:04                4124
function.bindtextdomain.php                        14-Apr-2024 10:04                5517
function.boolval.php                               14-Apr-2024 10:04               10234
function.bzclose.php                               14-Apr-2024 10:04                2558
function.bzcompress.php                            14-Apr-2024 10:04                4400
function.bzdecompress.php                          14-Apr-2024 10:04                4655
function.bzerrno.php                               14-Apr-2024 10:04                2224
function.bzerror.php                               14-Apr-2024 10:04                3278
function.bzerrstr.php                              14-Apr-2024 10:04                2200
function.bzflush.php                               14-Apr-2024 10:04                2463
function.bzopen.php                                14-Apr-2024 10:04                3998
function.bzread.php                                14-Apr-2024 10:04                5144
function.bzwrite.php                               14-Apr-2024 10:04                4341
function.cal-days-in-month.php                     14-Apr-2024 10:04                3731
function.cal-from-jd.php                           14-Apr-2024 10:04                4814
function.cal-info.php                              14-Apr-2024 10:04                2772
function.cal-to-jd.php                             14-Apr-2024 10:04                3255
function.call-user-func-array.php                  14-Apr-2024 10:04               17512
function.call-user-func.php                        14-Apr-2024 10:04               14328
function.ceil.php                                  14-Apr-2024 10:04                3540
function.chdir.php                                 14-Apr-2024 10:04                5630
function.checkdate.php                             14-Apr-2024 10:04                5590
function.checkdnsrr.php                            14-Apr-2024 10:04                3360
function.chgrp.php                                 14-Apr-2024 10:04                6627
function.chmod.php                                 14-Apr-2024 10:04                8820
function.chop.php                                  14-Apr-2024 10:04                1921
function.chown.php                                 14-Apr-2024 10:04                6734
function.chr.php                                   14-Apr-2024 10:04                3824
function.chroot.php                                14-Apr-2024 10:04                2718
function.chunk-split.php                           14-Apr-2024 10:04                4217
function.class-alias.php                           14-Apr-2024 10:04                9034
function.class-exists.php                          14-Apr-2024 10:04                6994
function.class-implements.php                      14-Apr-2024 10:04                7309
function.class-parents.php                         14-Apr-2024 10:04                7018
function.class-uses.php                            14-Apr-2024 10:04                6291
function.clearstatcache.php                        14-Apr-2024 10:04                5678
function.cli-get-process-title.php                 14-Apr-2024 10:04                4468
function.cli-set-process-title.php                 14-Apr-2024 10:04                5540
function.closedir.php                              14-Apr-2024 10:04                2076
function.closelog.php                              14-Apr-2024 10:04                2255
function.com-create-guid.php                       14-Apr-2024 10:04                2847
function.com-event-sink.php                        14-Apr-2024 10:04               10408
function.com-get-active-object.php                 14-Apr-2024 10:04                5670
function.com-load-typelib.php                      14-Apr-2024 10:04                2340
function.com-message-pump.php                      14-Apr-2024 10:04                4049
function.com-print-typeinfo.php                    14-Apr-2024 10:04                5145
function.commonmark-parse.php                      14-Apr-2024 10:04                4129
function.commonmark-render-html.php                14-Apr-2024 10:04                4684
function.commonmark-render-latex.php               14-Apr-2024 10:04                5014
function.commonmark-render-man.php                 14-Apr-2024 10:04                4996
function.commonmark-render-xml.php                 14-Apr-2024 10:04                4641
function.commonmark-render.php                     14-Apr-2024 10:04                4942
function.compact.php                               14-Apr-2024 10:04                5777
function.connection-aborted.php                    14-Apr-2024 10:04                2961
function.connection-status.php                     14-Apr-2024 10:04                3150
function.constant.php                              14-Apr-2024 10:04                6505
function.convert-cyr-string.php                    14-Apr-2024 10:04                3484
function.convert-uudecode.php                      14-Apr-2024 10:04                2945
function.convert-uuencode.php                      14-Apr-2024 10:04                3312
function.copy.php                                  14-Apr-2024 10:04                5336
function.cos.php                                   14-Apr-2024 10:04                2984
function.cosh.php                                  14-Apr-2024 10:04                2346
function.count-chars.php                           14-Apr-2024 10:04                6764
function.count.php                                 14-Apr-2024 10:04               10047
function.crc32.php                                 14-Apr-2024 10:04                3759
function.create-function.php                       14-Apr-2024 10:04               30948
function.crypt.php                                 14-Apr-2024 10:04               11315
function.ctype-alnum.php                           14-Apr-2024 10:04                6846
function.ctype-alpha.php                           14-Apr-2024 10:04                7198
function.ctype-cntrl.php                           14-Apr-2024 10:04                6846
function.ctype-digit.php                           14-Apr-2024 10:04                8991
function.ctype-graph.php                           14-Apr-2024 10:04                7526
function.ctype-lower.php                           14-Apr-2024 10:04                6895
function.ctype-print.php                           14-Apr-2024 10:04                7591
function.ctype-punct.php                           14-Apr-2024 10:04                6901
function.ctype-space.php                           14-Apr-2024 10:04                7673
function.ctype-upper.php                           14-Apr-2024 10:04                6940
function.ctype-xdigit.php                          14-Apr-2024 10:04                6769
function.cubrid-affected-rows.php                  14-Apr-2024 10:04                9390
function.cubrid-bind.php                           14-Apr-2024 10:04               20699
function.cubrid-client-encoding.php                14-Apr-2024 10:04                5270
function.cubrid-close-prepare.php                  14-Apr-2024 10:04                6240
function.cubrid-close-request.php                  14-Apr-2024 10:04                6251
function.cubrid-close.php                          14-Apr-2024 10:04                6384
function.cubrid-col-get.php                        14-Apr-2024 10:04                8545
function.cubrid-col-size.php                       14-Apr-2024 10:04                8657
function.cubrid-column-names.php                   14-Apr-2024 10:04                8495
function.cubrid-column-types.php                   14-Apr-2024 10:04                8475
function.cubrid-commit.php                         14-Apr-2024 10:04               15323
function.cubrid-connect-with-url.php               14-Apr-2024 10:04               15091
function.cubrid-connect.php                        14-Apr-2024 10:04               12309
function.cubrid-current-oid.php                    14-Apr-2024 10:04                5976
function.cubrid-data-seek.php                      14-Apr-2024 10:04                7477
function.cubrid-db-name.php                        14-Apr-2024 10:04                6576
function.cubrid-disconnect.php                     14-Apr-2024 10:04                7123
function.cubrid-drop.php                           14-Apr-2024 10:04               11418
function.cubrid-errno.php                          14-Apr-2024 10:04                6799
function.cubrid-error-code-facility.php            14-Apr-2024 10:04                5811
function.cubrid-error-code.php                     14-Apr-2024 10:04                5721
function.cubrid-error-msg.php                      14-Apr-2024 10:04                5171
function.cubrid-error.php                          14-Apr-2024 10:04                6359
function.cubrid-execute.php                        14-Apr-2024 10:04               14363
function.cubrid-fetch-array.php                    14-Apr-2024 10:04                9825
function.cubrid-fetch-assoc.php                    14-Apr-2024 10:04                9034
function.cubrid-fetch-field.php                    14-Apr-2024 10:04               14065
function.cubrid-fetch-lengths.php                  14-Apr-2024 10:04                6115
function.cubrid-fetch-object.php                   14-Apr-2024 10:04               11979
function.cubrid-fetch-row.php                      14-Apr-2024 10:04                8958
function.cubrid-fetch.php                          14-Apr-2024 10:04                9931
function.cubrid-field-flags.php                    14-Apr-2024 10:04                7773
function.cubrid-field-len.php                      14-Apr-2024 10:04                8282
function.cubrid-field-name.php                     14-Apr-2024 10:04                7188
function.cubrid-field-seek.php                     14-Apr-2024 10:04               10958
function.cubrid-field-table.php                    14-Apr-2024 10:04                7393
function.cubrid-field-type.php                     14-Apr-2024 10:04                7489
function.cubrid-free-result.php                    14-Apr-2024 10:04                5930
function.cubrid-get-autocommit.php                 14-Apr-2024 10:04                3788
function.cubrid-get-charset.php                    14-Apr-2024 10:04                4988
function.cubrid-get-class-name.php                 14-Apr-2024 10:04                6318
function.cubrid-get-client-info.php                14-Apr-2024 10:04                8121
function.cubrid-get-db-parameter.php               14-Apr-2024 10:04               14279
function.cubrid-get-query-timeout.php              14-Apr-2024 10:04                6704
function.cubrid-get-server-info.php                14-Apr-2024 10:04                8412
function.cubrid-get.php                            14-Apr-2024 10:04                9841
function.cubrid-insert-id.php                      14-Apr-2024 10:04                7128
function.cubrid-is-instance.php                    14-Apr-2024 10:04                7165
function.cubrid-list-dbs.php                       14-Apr-2024 10:04                4574
function.cubrid-load-from-glo.php                  14-Apr-2024 10:04                6882
function.cubrid-lob-close.php                      14-Apr-2024 10:04                7242
function.cubrid-lob-export.php                     14-Apr-2024 10:04                7821
function.cubrid-lob-get.php                        14-Apr-2024 10:04                7628
function.cubrid-lob-send.php                       14-Apr-2024 10:04                6996
function.cubrid-lob-size.php                       14-Apr-2024 10:04                5817
function.cubrid-lob2-bind.php                      14-Apr-2024 10:04                9706
function.cubrid-lob2-close.php                     14-Apr-2024 10:04                3399
function.cubrid-lob2-export.php                    14-Apr-2024 10:04                8699
function.cubrid-lob2-import.php                    14-Apr-2024 10:04                8568
function.cubrid-lob2-new.php                       14-Apr-2024 10:04                3913
function.cubrid-lob2-read.php                      14-Apr-2024 10:04               13670
function.cubrid-lob2-seek.php                      14-Apr-2024 10:04               11230
function.cubrid-lob2-seek64.php                    14-Apr-2024 10:04               12650
function.cubrid-lob2-size.php                      14-Apr-2024 10:04                4294
function.cubrid-lob2-size64.php                    14-Apr-2024 10:04                4474
function.cubrid-lob2-tell.php                      14-Apr-2024 10:04                4313
function.cubrid-lob2-tell64.php                    14-Apr-2024 10:04                4511
function.cubrid-lob2-write.php                     14-Apr-2024 10:04               13992
function.cubrid-lock-read.php                      14-Apr-2024 10:04                9139
function.cubrid-lock-write.php                     14-Apr-2024 10:04                9527
function.cubrid-move-cursor.php                    14-Apr-2024 10:04                9511
function.cubrid-new-glo.php                        14-Apr-2024 10:04                6933
function.cubrid-next-result.php                    14-Apr-2024 10:04               16298
function.cubrid-num-cols.php                       14-Apr-2024 10:04                5962
function.cubrid-num-fields.php                     14-Apr-2024 10:04                5682
function.cubrid-num-rows.php                       14-Apr-2024 10:04                7146
function.cubrid-pconnect-with-url.php              14-Apr-2024 10:04               14418
function.cubrid-pconnect.php                       14-Apr-2024 10:04               12090
function.cubrid-ping.php                           14-Apr-2024 10:04                6065
function.cubrid-prepare.php                        14-Apr-2024 10:04               10245
function.cubrid-put.php                            14-Apr-2024 10:04               11360
function.cubrid-query.php                          14-Apr-2024 10:04               14732
function.cubrid-real-escape-string.php             14-Apr-2024 10:04                8231
function.cubrid-result.php                         14-Apr-2024 10:04                7413
function.cubrid-rollback.php                       14-Apr-2024 10:04               14618
function.cubrid-save-to-glo.php                    14-Apr-2024 10:04                6795
function.cubrid-schema.php                         14-Apr-2024 10:04               20448
function.cubrid-send-glo.php                       14-Apr-2024 10:04                6262
function.cubrid-seq-drop.php                       14-Apr-2024 10:04                9788
function.cubrid-seq-insert.php                     14-Apr-2024 10:04               10294
function.cubrid-seq-put.php                        14-Apr-2024 10:04               10221
function.cubrid-set-add.php                        14-Apr-2024 10:04                9560
function.cubrid-set-autocommit.php                 14-Apr-2024 10:04                4162
function.cubrid-set-db-parameter.php               14-Apr-2024 10:04                8175
function.cubrid-set-drop.php                       14-Apr-2024 10:04                9537
function.cubrid-set-query-timeout.php              14-Apr-2024 10:04                3550
function.cubrid-unbuffered-query.php               14-Apr-2024 10:04                6992
function.cubrid-version.php                        14-Apr-2024 10:04                8673
function.curl-close.php                            14-Apr-2024 10:04                5971
function.curl-copy-handle.php                      14-Apr-2024 10:04                6311
function.curl-errno.php                            14-Apr-2024 10:04                6066
function.curl-error.php                            14-Apr-2024 10:04                5979
function.curl-escape.php                           14-Apr-2024 10:04                7413
function.curl-exec.php                             14-Apr-2024 10:04                5581
function.curl-getinfo.php                          14-Apr-2024 10:04               20448
function.curl-init.php                             14-Apr-2024 10:04                6238
function.curl-multi-add-handle.php                 14-Apr-2024 10:04               10164
function.curl-multi-close.php                      14-Apr-2024 10:04                9503
function.curl-multi-errno.php                      14-Apr-2024 10:04                3841
function.curl-multi-exec.php                       14-Apr-2024 10:04               10254
function.curl-multi-getcontent.php                 14-Apr-2024 10:04                4311
function.curl-multi-info-read.php                  14-Apr-2024 10:04               12216
function.curl-multi-init.php                       14-Apr-2024 10:04                9002
function.curl-multi-remove-handle.php              14-Apr-2024 10:04                5421
function.curl-multi-select.php                     14-Apr-2024 10:04                4395
function.curl-multi-setopt.php                     14-Apr-2024 10:04               12875
function.curl-multi-strerror.php                   14-Apr-2024 10:04                6999
function.curl-pause.php                            14-Apr-2024 10:04                3816
function.curl-reset.php                            14-Apr-2024 10:04                6298
function.curl-setopt-array.php                     14-Apr-2024 10:04                7514
function.curl-setopt.php                           14-Apr-2024 10:04               95196
function.curl-share-close.php                      14-Apr-2024 10:04                7819
function.curl-share-errno.php                      14-Apr-2024 10:04                3843
function.curl-share-init.php                       14-Apr-2024 10:04                7407
function.curl-share-setopt.php                     14-Apr-2024 10:04               10044
function.curl-share-strerror.php                   14-Apr-2024 10:04                3377
function.curl-strerror.php                         14-Apr-2024 10:04                6186
function.curl-unescape.php                         14-Apr-2024 10:04                7836
function.curl-version.php                          14-Apr-2024 10:04                6483
function.curl_upkeep.php                           14-Apr-2024 10:04                6859
function.current.php                               14-Apr-2024 10:04                6350
function.date-add.php                              14-Apr-2024 10:04                1688
function.date-create-from-format.php               14-Apr-2024 10:04                1863
function.date-create-immutable-from-format.php     14-Apr-2024 10:04                1975
function.date-create-immutable.php                 14-Apr-2024 10:04                4231
function.date-create.php                           14-Apr-2024 10:04                4385
function.date-date-set.php                         14-Apr-2024 10:04                1747
function.date-default-timezone-get.php             14-Apr-2024 10:04                6909
function.date-default-timezone-set.php             14-Apr-2024 10:04                5582
function.date-diff.php                             14-Apr-2024 10:04                1707
function.date-format.php                           14-Apr-2024 10:04                1715
function.date-get-last-errors.php                  14-Apr-2024 10:04                1880
function.date-interval-create-from-date-string.php 14-Apr-2024 10:04                1991
function.date-interval-format.php                  14-Apr-2024 10:04                1842
function.date-isodate-set.php                      14-Apr-2024 10:04                1770
function.date-modify.php                           14-Apr-2024 10:04                1719
function.date-offset-get.php                       14-Apr-2024 10:04                1763
function.date-parse-from-format.php                14-Apr-2024 10:04               13759
function.date-parse.php                            14-Apr-2024 10:04               19415
function.date-sub.php                              14-Apr-2024 10:04                2295
function.date-sun-info.php                         14-Apr-2024 10:04               15740
function.date-sunrise.php                          14-Apr-2024 10:04               14455
function.date-sunset.php                           14-Apr-2024 10:04               14435
function.date-time-set.php                         14-Apr-2024 10:04                1733
function.date-timestamp-get.php                    14-Apr-2024 10:04                1792
function.date-timestamp-set.php                    14-Apr-2024 10:04                1800
function.date-timezone-get.php                     14-Apr-2024 10:04                1789
function.date-timezone-set.php                     14-Apr-2024 10:04                1761
function.date.php                                  14-Apr-2024 10:04               21740
function.db2-autocommit.php                        14-Apr-2024 10:04               10933
function.db2-bind-param.php                        14-Apr-2024 10:04               22425
function.db2-client-info.php                       14-Apr-2024 10:04               11614
function.db2-close.php                             14-Apr-2024 10:04                5638
function.db2-column-privileges.php                 14-Apr-2024 10:04                9124
function.db2-columns.php                           14-Apr-2024 10:04               11173
function.db2-commit.php                            14-Apr-2024 10:04                3706
function.db2-conn-error.php                        14-Apr-2024 10:04                6939
function.db2-conn-errormsg.php                     14-Apr-2024 10:04                6703
function.db2-connect.php                           14-Apr-2024 10:04               38725
function.db2-cursor-type.php                       14-Apr-2024 10:04                3170
function.db2-escape-string.php                     14-Apr-2024 10:04                7548
function.db2-exec.php                              14-Apr-2024 10:04               26292
function.db2-execute.php                           14-Apr-2024 10:04               25646
function.db2-fetch-array.php                       14-Apr-2024 10:04               11263
function.db2-fetch-assoc.php                       14-Apr-2024 10:04               11279
function.db2-fetch-both.php                        14-Apr-2024 10:04               11812
function.db2-fetch-object.php                      14-Apr-2024 10:04                8986
function.db2-fetch-row.php                         14-Apr-2024 10:04               16276
function.db2-field-display-size.php                14-Apr-2024 10:04                5088
function.db2-field-name.php                        14-Apr-2024 10:04                4976
function.db2-field-num.php                         14-Apr-2024 10:04                4984
function.db2-field-precision.php                   14-Apr-2024 10:04                5016
function.db2-field-scale.php                       14-Apr-2024 10:04                4978
function.db2-field-type.php                        14-Apr-2024 10:04                4981
function.db2-field-width.php                       14-Apr-2024 10:04                5186
function.db2-foreign-keys.php                      14-Apr-2024 10:04                9029
function.db2-free-result.php                       14-Apr-2024 10:04                3364
function.db2-free-stmt.php                         14-Apr-2024 10:04                3352
function.db2-get-option.php                        14-Apr-2024 10:04               24057
function.db2-last-insert-id.php                    14-Apr-2024 10:04                8122
function.db2-lob-read.php                          14-Apr-2024 10:04               16355
function.db2-next-result.php                       14-Apr-2024 10:04                8796
function.db2-num-fields.php                        14-Apr-2024 10:04                7142
function.db2-num-rows.php                          14-Apr-2024 10:04                4708
function.db2-pclose.php                            14-Apr-2024 10:04                5831
function.db2-pconnect.php                          14-Apr-2024 10:04               31809
function.db2-prepare.php                           14-Apr-2024 10:04               10542
function.db2-primary-keys.php                      14-Apr-2024 10:04                7663
function.db2-procedure-columns.php                 14-Apr-2024 10:04               12131
function.db2-procedures.php                        14-Apr-2024 10:04                7992
function.db2-result.php                            14-Apr-2024 10:04                7945
function.db2-rollback.php                          14-Apr-2024 10:04                9290
function.db2-server-info.php                       14-Apr-2024 10:04               22460
function.db2-set-option.php                        14-Apr-2024 10:04               65928
function.db2-special-columns.php                   14-Apr-2024 10:04               10244
function.db2-statistics.php                        14-Apr-2024 10:04               12515
function.db2-stmt-error.php                        14-Apr-2024 10:04                4593
function.db2-stmt-errormsg.php                     14-Apr-2024 10:04                4224
function.db2-table-privileges.php                  14-Apr-2024 10:04                8553
function.db2-tables.php                            14-Apr-2024 10:04                8883
function.dba-close.php                             14-Apr-2024 10:04                3164
function.dba-delete.php                            14-Apr-2024 10:04                4110
function.dba-exists.php                            14-Apr-2024 10:04                4133
function.dba-fetch.php                             14-Apr-2024 10:04                7085
function.dba-firstkey.php                          14-Apr-2024 10:04                3622
function.dba-handlers.php                          14-Apr-2024 10:04                5495
function.dba-insert.php                            14-Apr-2024 10:04                4748
function.dba-key-split.php                         14-Apr-2024 10:04                3922
function.dba-list.php                              14-Apr-2024 10:04                2205
function.dba-nextkey.php                           14-Apr-2024 10:04                3544
function.dba-open.php                              14-Apr-2024 10:04               13803
function.dba-optimize.php                          14-Apr-2024 10:04                3194
function.dba-popen.php                             14-Apr-2024 10:04                9133
function.dba-replace.php                           14-Apr-2024 10:04                4576
function.dba-sync.php                              14-Apr-2024 10:04                3214
function.dbase-add-record.php                      14-Apr-2024 10:04                2398
function.dbase-close.php                           14-Apr-2024 10:04                1986
function.dbase-create.php                          14-Apr-2024 10:04                6264
function.dbase-delete-record.php                   14-Apr-2024 10:04                2406
function.dbase-get-header-info.php                 14-Apr-2024 10:04                5774
function.dbase-get-record-with-names.php           14-Apr-2024 10:04                3104
function.dbase-get-record.php                      14-Apr-2024 10:04                3013
function.dbase-numfields.php                       14-Apr-2024 10:04                3791
function.dbase-numrecords.php                      14-Apr-2024 10:04                2187
function.dbase-open.php                            14-Apr-2024 10:04                6744
function.dbase-pack.php                            14-Apr-2024 10:04                2142
function.dbase-replace-record.php                  14-Apr-2024 10:04                2983
function.dcgettext.php                             14-Apr-2024 10:04                3491
function.dcngettext.php                            14-Apr-2024 10:04                4143
function.debug-backtrace.php                       14-Apr-2024 10:04                9382
function.debug-print-backtrace.php                 14-Apr-2024 10:04                5190
function.debug-zval-dump.php                       14-Apr-2024 10:04                9517
function.decbin.php                                14-Apr-2024 10:04                3623
function.dechex.php                                14-Apr-2024 10:04                3605
function.decoct.php                                14-Apr-2024 10:04                3709
function.define.php                                14-Apr-2024 10:04                6880
function.defined.php                               14-Apr-2024 10:04                5149
function.deflate-add.php                           14-Apr-2024 10:04                5847
function.deflate-init.php                          14-Apr-2024 10:04                7791
function.deg2rad.php                               14-Apr-2024 10:04                3162
function.delete.php                                14-Apr-2024 10:04                2566
function.dgettext.php                              14-Apr-2024 10:04                3243
function.die.php                                   14-Apr-2024 10:04                1519
function.dio-close.php                             14-Apr-2024 10:04                3951
function.dio-fcntl.php                             14-Apr-2024 10:04                9776
function.dio-open.php                              14-Apr-2024 10:04                7358
function.dio-read.php                              14-Apr-2024 10:04                3527
function.dio-seek.php                              14-Apr-2024 10:04                7433
function.dio-stat.php                              14-Apr-2024 10:04                4346
function.dio-tcsetattr.php                         14-Apr-2024 10:04                6862
function.dio-truncate.php                          14-Apr-2024 10:04                3844
function.dio-write.php                             14-Apr-2024 10:04                3863
function.dir.php                                   14-Apr-2024 10:04                7327
function.dirname.php                               14-Apr-2024 10:04                5506
function.disk-free-space.php                       14-Apr-2024 10:04                3777
function.disk-total-space.php                      14-Apr-2024 10:04                3118
function.diskfreespace.php                         14-Apr-2024 10:04                1732
function.dl.php                                    14-Apr-2024 10:04               10252
function.dngettext.php                             14-Apr-2024 10:04                3907
function.dns-check-record.php                      14-Apr-2024 10:04                1704
function.dns-get-mx.php                            14-Apr-2024 10:04                1674
function.dns-get-record.php                        14-Apr-2024 10:04               22580
function.dom-import-simplexml.php                  14-Apr-2024 10:04                6598
function.doubleval.php                             14-Apr-2024 10:04                1657
function.each.php                                  14-Apr-2024 10:04                9561
function.easter-date.php                           14-Apr-2024 10:04                5546
function.easter-days.php                           14-Apr-2024 10:04                5819
function.echo.php                                  14-Apr-2024 10:04               11319
function.eio-busy.php                              14-Apr-2024 10:04                4887
function.eio-cancel.php                            14-Apr-2024 10:04                7451
function.eio-chmod.php                             14-Apr-2024 10:04                6113
function.eio-chown.php                             14-Apr-2024 10:04                6315
function.eio-close.php                             14-Apr-2024 10:04                5546
function.eio-custom.php                            14-Apr-2024 10:04               10201
function.eio-dup2.php                              14-Apr-2024 10:04                5595
function.eio-event-loop.php                        14-Apr-2024 10:04                5745
function.eio-fallocate.php                         14-Apr-2024 10:04                7450
function.eio-fchmod.php                            14-Apr-2024 10:04                6073
function.eio-fchown.php                            14-Apr-2024 10:04                6375
function.eio-fdatasync.php                         14-Apr-2024 10:04                5459
function.eio-fstat.php                             14-Apr-2024 10:04               11443
function.eio-fstatvfs.php                          14-Apr-2024 10:04                5588
function.eio-fsync.php                             14-Apr-2024 10:04                5562
function.eio-ftruncate.php                         14-Apr-2024 10:04                6091
function.eio-futime.php                            14-Apr-2024 10:04                6397
function.eio-get-event-stream.php                  14-Apr-2024 10:04                8017
function.eio-get-last-error.php                    14-Apr-2024 10:04                3163
function.eio-grp-add.php                           14-Apr-2024 10:04               11414
function.eio-grp-cancel.php                        14-Apr-2024 10:04                3102
function.eio-grp-limit.php                         14-Apr-2024 10:04                3016
function.eio-grp.php                               14-Apr-2024 10:04               11639
function.eio-init.php                              14-Apr-2024 10:04                2564
function.eio-link.php                              14-Apr-2024 10:04               12453
function.eio-lstat.php                             14-Apr-2024 10:04                9826
function.eio-mkdir.php                             14-Apr-2024 10:04                9129
function.eio-mknod.php                             14-Apr-2024 10:04               11431
function.eio-nop.php                               14-Apr-2024 10:04                5219
function.eio-npending.php                          14-Apr-2024 10:04                2974
function.eio-nready.php                            14-Apr-2024 10:04                2722
function.eio-nreqs.php                             14-Apr-2024 10:04                5505
function.eio-nthreads.php                          14-Apr-2024 10:04                3396
function.eio-open.php                              14-Apr-2024 10:04               11408
function.eio-poll.php                              14-Apr-2024 10:04                5633
function.eio-read.php                              14-Apr-2024 10:04               12423
function.eio-readahead.php                         14-Apr-2024 10:04                6128
function.eio-readdir.php                           14-Apr-2024 10:04               18152
function.eio-readlink.php                          14-Apr-2024 10:04               12140
function.eio-realpath.php                          14-Apr-2024 10:04                5306
function.eio-rename.php                            14-Apr-2024 10:04                9213
function.eio-rmdir.php                             14-Apr-2024 10:04                8160
function.eio-seek.php                              14-Apr-2024 10:04                6938
function.eio-sendfile.php                          14-Apr-2024 10:04                6453
function.eio-set-max-idle.php                      14-Apr-2024 10:04                3105
function.eio-set-max-parallel.php                  14-Apr-2024 10:04                3154
function.eio-set-max-poll-reqs.php                 14-Apr-2024 10:04                2471
function.eio-set-max-poll-time.php                 14-Apr-2024 10:04                2541
function.eio-set-min-parallel.php                  14-Apr-2024 10:04                3145
function.eio-stat.php                              14-Apr-2024 10:04                9803
function.eio-statvfs.php                           14-Apr-2024 10:04                8287
function.eio-symlink.php                           14-Apr-2024 10:04               10774
function.eio-sync-file-range.php                   14-Apr-2024 10:04                7233
function.eio-sync.php                              14-Apr-2024 10:04                2861
function.eio-syncfs.php                            14-Apr-2024 10:04                5142
function.eio-truncate.php                          14-Apr-2024 10:04                6068
function.eio-unlink.php                            14-Apr-2024 10:04                5248
function.eio-utime.php                             14-Apr-2024 10:04                6106
function.eio-write.php                             14-Apr-2024 10:04                6824
function.empty.php                                 14-Apr-2024 10:04               11651
function.enchant-broker-describe.php               14-Apr-2024 10:04                6037
function.enchant-broker-dict-exists.php            14-Apr-2024 10:04                5714
function.enchant-broker-free-dict.php              14-Apr-2024 10:04                4791
function.enchant-broker-free.php                   14-Apr-2024 10:04                4343
function.enchant-broker-get-dict-path.php          14-Apr-2024 10:04                5295
function.enchant-broker-get-error.php              14-Apr-2024 10:04                3665
function.enchant-broker-init.php                   14-Apr-2024 10:04                3479
function.enchant-broker-list-dicts.php             14-Apr-2024 10:04                6917
function.enchant-broker-request-dict.php           14-Apr-2024 10:04                7035
function.enchant-broker-request-pwl-dict.php       14-Apr-2024 10:04                5360
function.enchant-broker-set-dict-path.php          14-Apr-2024 10:04                5588
function.enchant-broker-set-ordering.php           14-Apr-2024 10:04                4804
function.enchant-dict-add-to-personal.php          14-Apr-2024 10:04                2141
function.enchant-dict-add-to-session.php           14-Apr-2024 10:04                4436
function.enchant-dict-add.php                      14-Apr-2024 10:04                6351
function.enchant-dict-check.php                    14-Apr-2024 10:04                4246
function.enchant-dict-describe.php                 14-Apr-2024 10:04                6533
function.enchant-dict-get-error.php                14-Apr-2024 10:04                3868
function.enchant-dict-is-added.php                 14-Apr-2024 10:04                4478
function.enchant-dict-is-in-session.php            14-Apr-2024 10:04                2127
function.enchant-dict-quick-check.php              14-Apr-2024 10:04                8289
function.enchant-dict-store-replacement.php        14-Apr-2024 10:04                4715
function.enchant-dict-suggest.php                  14-Apr-2024 10:04                7436
function.end.php                                   14-Apr-2024 10:04                3478
function.enum-exists.php                           14-Apr-2024 10:04                5325
function.error-clear-last.php                      14-Apr-2024 10:04                4594
function.error-get-last.php                        14-Apr-2024 10:04                4830
function.error-log.php                             14-Apr-2024 10:04                9034
function.error-reporting.php                       14-Apr-2024 10:04               11784
function.escapeshellarg.php                        14-Apr-2024 10:04                3811
function.escapeshellcmd.php                        14-Apr-2024 10:04                4653
function.eval.php                                  14-Apr-2024 10:04                8490
function.exec.php                                  14-Apr-2024 10:04                7846
function.exif-imagetype.php                        14-Apr-2024 10:04                9943
function.exif-read-data.php                        14-Apr-2024 10:04               22168
function.exif-tagname.php                          14-Apr-2024 10:04                4709
function.exif-thumbnail.php                        14-Apr-2024 10:04                8881
function.exit.php                                  14-Apr-2024 10:04                9060
function.exp.php                                   14-Apr-2024 10:04                3530
function.expect-expectl.php                        14-Apr-2024 10:04               11053
function.expect-popen.php                          14-Apr-2024 10:04                4602
function.explode.php                               14-Apr-2024 10:04                9459
function.expm1.php                                 14-Apr-2024 10:04                2646
function.extension-loaded.php                      14-Apr-2024 10:04                4703
function.extract.php                               14-Apr-2024 10:04               14496
function.ezmlm-hash.php                            14-Apr-2024 10:04                3534
function.fann-cascadetrain-on-data.php             14-Apr-2024 10:04                6754
function.fann-cascadetrain-on-file.php             14-Apr-2024 10:04                5636
function.fann-clear-scaling-params.php             14-Apr-2024 10:04                2766
function.fann-copy.php                             14-Apr-2024 10:04                3288
function.fann-create-from-file.php                 14-Apr-2024 10:04                3304
function.fann-create-shortcut-array.php            14-Apr-2024 10:04                4131
function.fann-create-shortcut.php                  14-Apr-2024 10:04                5151
function.fann-create-sparse-array.php              14-Apr-2024 10:04                4770
function.fann-create-sparse.php                    14-Apr-2024 10:04                5528
function.fann-create-standard-array.php            14-Apr-2024 10:04                4444
function.fann-create-standard.php                  14-Apr-2024 10:04                5219
function.fann-create-train-from-callback.php       14-Apr-2024 10:04                9080
function.fann-create-train.php                     14-Apr-2024 10:04                4609
function.fann-descale-input.php                    14-Apr-2024 10:04                3827
function.fann-descale-output.php                   14-Apr-2024 10:04                3843
function.fann-descale-train.php                    14-Apr-2024 10:04                3856
function.fann-destroy-train.php                    14-Apr-2024 10:04                2719
function.fann-destroy.php                          14-Apr-2024 10:04                2753
function.fann-duplicate-train-data.php             14-Apr-2024 10:04                2962
function.fann-get-activation-function.php          14-Apr-2024 10:04                5297
function.fann-get-activation-steepness.php         14-Apr-2024 10:04                5710
function.fann-get-bias-array.php                   14-Apr-2024 10:04                2636
function.fann-get-bit-fail-limit.php               14-Apr-2024 10:04                3857
function.fann-get-bit-fail.php                     14-Apr-2024 10:04                4945
function.fann-get-cascade-activation-functions-..> 14-Apr-2024 10:04                3894
function.fann-get-cascade-activation-functions.php 14-Apr-2024 10:04                4710
function.fann-get-cascade-activation-steepnesse..> 14-Apr-2024 10:04                3950
function.fann-get-cascade-activation-steepnesse..> 14-Apr-2024 10:04                4101
function.fann-get-cascade-candidate-change-frac..> 14-Apr-2024 10:04                5207
function.fann-get-cascade-candidate-limit.php      14-Apr-2024 10:04                3597
function.fann-get-cascade-candidate-stagnation-..> 14-Apr-2024 10:04                4333
function.fann-get-cascade-max-cand-epochs.php      14-Apr-2024 10:04                3479
function.fann-get-cascade-max-out-epochs.php       14-Apr-2024 10:04                3400
function.fann-get-cascade-min-cand-epochs.php      14-Apr-2024 10:04                3783
function.fann-get-cascade-min-out-epochs.php       14-Apr-2024 10:04                3740
function.fann-get-cascade-num-candidate-groups.php 14-Apr-2024 10:04                3877
function.fann-get-cascade-num-candidates.php       14-Apr-2024 10:04                6011
function.fann-get-cascade-output-change-fractio..> 14-Apr-2024 10:04                5135
function.fann-get-cascade-output-stagnation-epo..> 14-Apr-2024 10:04                4276
function.fann-get-cascade-weight-multiplier.php    14-Apr-2024 10:04                3555
function.fann-get-connection-array.php             14-Apr-2024 10:04                2663
function.fann-get-connection-rate.php              14-Apr-2024 10:04                2786
function.fann-get-errno.php                        14-Apr-2024 10:04                3265
function.fann-get-errstr.php                       14-Apr-2024 10:04                3270
function.fann-get-layer-array.php                  14-Apr-2024 10:04                2737
function.fann-get-learning-momentum.php            14-Apr-2024 10:04                3940
function.fann-get-learning-rate.php                14-Apr-2024 10:04                3874
function.fann-get-mse.php                          14-Apr-2024 10:04                3260
function.fann-get-network-type.php                 14-Apr-2024 10:04                2756
function.fann-get-num-input.php                    14-Apr-2024 10:04                2643
function.fann-get-num-layers.php                   14-Apr-2024 10:04                2698
function.fann-get-num-output.php                   14-Apr-2024 10:04                2662
function.fann-get-quickprop-decay.php              14-Apr-2024 10:04                3412
function.fann-get-quickprop-mu.php                 14-Apr-2024 10:04                3305
function.fann-get-rprop-decrease-factor.php        14-Apr-2024 10:04                3366
function.fann-get-rprop-delta-max.php              14-Apr-2024 10:04                3428
function.fann-get-rprop-delta-min.php              14-Apr-2024 10:04                3239
function.fann-get-rprop-delta-zero.php             14-Apr-2024 10:04                3612
function.fann-get-rprop-increase-factor.php        14-Apr-2024 10:04                3391
function.fann-get-sarprop-step-error-shift.php     14-Apr-2024 10:04                3700
function.fann-get-sarprop-step-error-threshold-..> 14-Apr-2024 10:04                3852
function.fann-get-sarprop-temperature.php          14-Apr-2024 10:04                3614
function.fann-get-sarprop-weight-decay-shift.php   14-Apr-2024 10:04                3681
function.fann-get-total-connections.php            14-Apr-2024 10:04                2835
function.fann-get-total-neurons.php                14-Apr-2024 10:04                2882
function.fann-get-train-error-function.php         14-Apr-2024 10:04                3644
function.fann-get-train-stop-function.php          14-Apr-2024 10:04                3630
function.fann-get-training-algorithm.php           14-Apr-2024 10:04                3864
function.fann-init-weights.php                     14-Apr-2024 10:04                4507
function.fann-length-train-data.php                14-Apr-2024 10:04                2958
function.fann-merge-train-data.php                 14-Apr-2024 10:04                3331
function.fann-num-input-train-data.php             14-Apr-2024 10:04                3596
function.fann-num-output-train-data.php            14-Apr-2024 10:04                3594
function.fann-print-error.php                      14-Apr-2024 10:04                3016
function.fann-randomize-weights.php                14-Apr-2024 10:04                4017
function.fann-read-train-from-file.php             14-Apr-2024 10:04                5013
function.fann-reset-errno.php                      14-Apr-2024 10:04                3192
function.fann-reset-errstr.php                     14-Apr-2024 10:04                3173
function.fann-reset-mse.php                        14-Apr-2024 10:04                3504
function.fann-run.php                              14-Apr-2024 10:04                2952
function.fann-save-train.php                       14-Apr-2024 10:04                3567
function.fann-save.php                             14-Apr-2024 10:04                4380
function.fann-scale-input-train-data.php           14-Apr-2024 10:04                4194
function.fann-scale-input.php                      14-Apr-2024 10:04                3841
function.fann-scale-output-train-data.php          14-Apr-2024 10:04                4222
function.fann-scale-output.php                     14-Apr-2024 10:04                3845
function.fann-scale-train-data.php                 14-Apr-2024 10:04                4192
function.fann-scale-train.php                      14-Apr-2024 10:04                3874
function.fann-set-activation-function-hidden.php   14-Apr-2024 10:04                4536
function.fann-set-activation-function-layer.php    14-Apr-2024 10:04                5050
function.fann-set-activation-function-output.php   14-Apr-2024 10:04                4552
function.fann-set-activation-function.php          14-Apr-2024 10:04                6527
function.fann-set-activation-steepness-hidden.php  14-Apr-2024 10:04                4822
function.fann-set-activation-steepness-layer.php   14-Apr-2024 10:04                5287
function.fann-set-activation-steepness-output.php  14-Apr-2024 10:04                4803
function.fann-set-activation-steepness.php         14-Apr-2024 10:04                6183
function.fann-set-bit-fail-limit.php               14-Apr-2024 10:04                3525
function.fann-set-callback.php                     14-Apr-2024 10:04                5698
function.fann-set-cascade-activation-functions.php 14-Apr-2024 10:04                4181
function.fann-set-cascade-activation-steepnesse..> 14-Apr-2024 10:04                4394
function.fann-set-cascade-candidate-change-frac..> 14-Apr-2024 10:04                3876
function.fann-set-cascade-candidate-limit.php      14-Apr-2024 10:04                3683
function.fann-set-cascade-candidate-stagnation-..> 14-Apr-2024 10:04                3938
function.fann-set-cascade-max-cand-epochs.php      14-Apr-2024 10:04                3684
function.fann-set-cascade-max-out-epochs.php       14-Apr-2024 10:04                3635
function.fann-set-cascade-min-cand-epochs.php      14-Apr-2024 10:04                3993
function.fann-set-cascade-min-out-epochs.php       14-Apr-2024 10:04                3975
function.fann-set-cascade-num-candidate-groups.php 14-Apr-2024 10:04                3769
function.fann-set-cascade-output-change-fractio..> 14-Apr-2024 10:04                3833
function.fann-set-cascade-output-stagnation-epo..> 14-Apr-2024 10:04                3899
function.fann-set-cascade-weight-multiplier.php    14-Apr-2024 10:04                3668
function.fann-set-error-log.php                    14-Apr-2024 10:04                3036
function.fann-set-input-scaling-params.php         14-Apr-2024 10:04                4634
function.fann-set-learning-momentum.php            14-Apr-2024 10:04                3909
function.fann-set-learning-rate.php                14-Apr-2024 10:04                3835
function.fann-set-output-scaling-params.php        14-Apr-2024 10:04                4654
function.fann-set-quickprop-decay.php              14-Apr-2024 10:04                3596
function.fann-set-quickprop-mu.php                 14-Apr-2024 10:04                3451
function.fann-set-rprop-decrease-factor.php        14-Apr-2024 10:04                3653
function.fann-set-rprop-delta-max.php              14-Apr-2024 10:04                3765
function.fann-set-rprop-delta-min.php              14-Apr-2024 10:04                3571
function.fann-set-rprop-delta-zero.php             14-Apr-2024 10:04                3953
function.fann-set-rprop-increase-factor.php        14-Apr-2024 10:04                3679
function.fann-set-sarprop-step-error-shift.php     14-Apr-2024 10:04                4043
function.fann-set-sarprop-step-error-threshold-..> 14-Apr-2024 10:04                4237
function.fann-set-sarprop-temperature.php          14-Apr-2024 10:04                3954
function.fann-set-sarprop-weight-decay-shift.php   14-Apr-2024 10:04                4037
function.fann-set-scaling-params.php               14-Apr-2024 10:04                5671
function.fann-set-train-error-function.php         14-Apr-2024 10:04                3865
function.fann-set-train-stop-function.php          14-Apr-2024 10:04                3853
function.fann-set-training-algorithm.php           14-Apr-2024 10:04                3801
function.fann-set-weight-array.php                 14-Apr-2024 10:04                3308
function.fann-set-weight.php                       14-Apr-2024 10:04                3756
function.fann-shuffle-train-data.php               14-Apr-2024 10:04                2919
function.fann-subset-train-data.php                14-Apr-2024 10:04                4330
function.fann-test-data.php                        14-Apr-2024 10:04                4265
function.fann-test.php                             14-Apr-2024 10:04                4558
function.fann-train-epoch.php                      14-Apr-2024 10:04                4639
function.fann-train-on-data.php                    14-Apr-2024 10:04                6581
function.fann-train-on-file.php                    14-Apr-2024 10:04                6509
function.fann-train.php                            14-Apr-2024 10:04                4636
function.fastcgi-finish-request.php                14-Apr-2024 10:04                2582
function.fbird-add-user.php                        14-Apr-2024 10:04                2283
function.fbird-affected-rows.php                   14-Apr-2024 10:04                2299
function.fbird-backup.php                          14-Apr-2024 10:04                1725
function.fbird-blob-add.php                        14-Apr-2024 10:04                2612
function.fbird-blob-cancel.php                     14-Apr-2024 10:04                3673
function.fbird-blob-close.php                      14-Apr-2024 10:04                2643
function.fbird-blob-create.php                     14-Apr-2024 10:04                2643
function.fbird-blob-echo.php                       14-Apr-2024 10:04                2446
function.fbird-blob-get.php                        14-Apr-2024 10:04                2439
function.fbird-blob-import.php                     14-Apr-2024 10:04                2639
function.fbird-blob-info.php                       14-Apr-2024 10:04                1757
function.fbird-blob-open.php                       14-Apr-2024 10:04                2436
function.fbird-close.php                           14-Apr-2024 10:04                2222
function.fbird-commit-ret.php                      14-Apr-2024 10:04                1750
function.fbird-commit.php                          14-Apr-2024 10:04                1718
function.fbird-connect.php                         14-Apr-2024 10:04                2228
function.fbird-db-info.php                         14-Apr-2024 10:04                1731
function.fbird-delete-user.php                     14-Apr-2024 10:04                2296
function.fbird-drop-db.php                         14-Apr-2024 10:04                2244
function.fbird-errcode.php                         14-Apr-2024 10:04                2067
function.fbird-errmsg.php                          14-Apr-2024 10:04                2060
function.fbird-execute.php                         14-Apr-2024 10:04                2072
function.fbird-fetch-assoc.php                     14-Apr-2024 10:04                2312
function.fbird-fetch-object.php                    14-Apr-2024 10:04                2323
function.fbird-fetch-row.php                       14-Apr-2024 10:04                2300
function.fbird-field-info.php                      14-Apr-2024 10:04                2142
function.fbird-free-event-handler.php              14-Apr-2024 10:04                2246
function.fbird-free-query.php                      14-Apr-2024 10:04                1786
function.fbird-free-result.php                     14-Apr-2024 10:04                1771
function.fbird-gen-id.php                          14-Apr-2024 10:04                1728
function.fbird-maintain-db.php                     14-Apr-2024 10:04                1773
function.fbird-modify-user.php                     14-Apr-2024 10:04                2312
function.fbird-name-result.php                     14-Apr-2024 10:04                2295
function.fbird-num-fields.php                      14-Apr-2024 10:04                2131
function.fbird-num-params.php                      14-Apr-2024 10:04                2290
function.fbird-param-info.php                      14-Apr-2024 10:04                2295
function.fbird-pconnect.php                        14-Apr-2024 10:04                2245
function.fbird-prepare.php                         14-Apr-2024 10:04                1721
function.fbird-query.php                           14-Apr-2024 10:04                2561
function.fbird-restore.php                         14-Apr-2024 10:04                1728
function.fbird-rollback-ret.php                    14-Apr-2024 10:04                1780
function.fbird-rollback.php                        14-Apr-2024 10:04                1752
function.fbird-server-info.php                     14-Apr-2024 10:04                1783
function.fbird-service-attach.php                  14-Apr-2024 10:04                1822
function.fbird-service-detach.php                  14-Apr-2024 10:04                1834
function.fbird-set-event-handler.php               14-Apr-2024 10:04                2405
function.fbird-trans.php                           14-Apr-2024 10:04                1727
function.fbird-wait-event.php                      14-Apr-2024 10:04                2330
function.fclose.php                                14-Apr-2024 10:04                3422
function.fdatasync.php                             14-Apr-2024 10:04                5951
function.fdf-add-doc-javascript.php                14-Apr-2024 10:04                5506
function.fdf-add-template.php                      14-Apr-2024 10:04                2879
function.fdf-close.php                             14-Apr-2024 10:04                3057
function.fdf-create.php                            14-Apr-2024 10:04                5554
function.fdf-enum-values.php                       14-Apr-2024 10:04                2452
function.fdf-errno.php                             14-Apr-2024 10:04                2734
function.fdf-error.php                             14-Apr-2024 10:04                3173
function.fdf-get-ap.php                            14-Apr-2024 10:04                4398
function.fdf-get-attachment.php                    14-Apr-2024 10:04                6048
function.fdf-get-encoding.php                      14-Apr-2024 10:04                3355
function.fdf-get-file.php                          14-Apr-2024 10:04                3175
function.fdf-get-flags.php                         14-Apr-2024 10:04                2372
function.fdf-get-opt.php                           14-Apr-2024 10:04                2411
function.fdf-get-status.php                        14-Apr-2024 10:04                3194
function.fdf-get-value.php                         14-Apr-2024 10:04                4502
function.fdf-get-version.php                       14-Apr-2024 10:04                3554
function.fdf-header.php                            14-Apr-2024 10:04                2309
function.fdf-next-field-name.php                   14-Apr-2024 10:04                5346
function.fdf-open-string.php                       14-Apr-2024 10:04                4802
function.fdf-open.php                              14-Apr-2024 10:04                5813
function.fdf-remove-item.php                       14-Apr-2024 10:04                2385
function.fdf-save-string.php                       14-Apr-2024 10:04                5580
function.fdf-save.php                              14-Apr-2024 10:04                4071
function.fdf-set-ap.php                            14-Apr-2024 10:04                4625
function.fdf-set-encoding.php                      14-Apr-2024 10:04                3753
function.fdf-set-file.php                          14-Apr-2024 10:04                6688
function.fdf-set-flags.php                         14-Apr-2024 10:04                4377
function.fdf-set-javascript-action.php             14-Apr-2024 10:04                4574
function.fdf-set-on-import-javascript.php          14-Apr-2024 10:04                3163
function.fdf-set-opt.php                           14-Apr-2024 10:04                4660
function.fdf-set-status.php                        14-Apr-2024 10:04                3790
function.fdf-set-submit-form-action.php            14-Apr-2024 10:04                4873
function.fdf-set-target-frame.php                  14-Apr-2024 10:04                3790
function.fdf-set-value.php                         14-Apr-2024 10:04                5227
function.fdf-set-version.php                       14-Apr-2024 10:04                4014
function.fdiv.php                                  14-Apr-2024 10:04                6139
function.feof.php                                  14-Apr-2024 10:04                3353
function.fflush.php                                14-Apr-2024 10:04                3066
function.fgetc.php                                 14-Apr-2024 10:04                5318
function.fgetcsv.php                               14-Apr-2024 10:04                9701
function.fgets.php                                 14-Apr-2024 10:04                6810
function.fgetss.php                                14-Apr-2024 10:04                3924
function.file-exists.php                           14-Apr-2024 10:04                4759
function.file-get-contents.php                     14-Apr-2024 10:04                6535
function.file-put-contents.php                     14-Apr-2024 10:04               13197
function.file.php                                  14-Apr-2024 10:04                9016
function.fileatime.php                             14-Apr-2024 10:04                5255
function.filectime.php                             14-Apr-2024 10:04                5421
function.filegroup.php                             14-Apr-2024 10:04                5739
function.fileinode.php                             14-Apr-2024 10:04                2948
function.filemtime.php                             14-Apr-2024 10:04                4954
function.fileowner.php                             14-Apr-2024 10:04                3203
function.fileperms.php                             14-Apr-2024 10:04               14649
function.filesize.php                              14-Apr-2024 10:04                4607
function.filetype.php                              14-Apr-2024 10:04                4763
function.filter-has-var.php                        14-Apr-2024 10:04                3389
function.filter-id.php                             14-Apr-2024 10:04                2946
function.filter-input-array.php                    14-Apr-2024 10:04               13177
function.filter-input.php                          14-Apr-2024 10:04                8490
function.filter-list.php                           14-Apr-2024 10:04                3643
function.filter-var-array.php                      14-Apr-2024 10:04               12063
function.filter-var.php                            14-Apr-2024 10:04               14238
function.finfo-buffer.php                          14-Apr-2024 10:04                8456
function.finfo-close.php                           14-Apr-2024 10:04                3542
function.finfo-file.php                            14-Apr-2024 10:04                9040
function.finfo-open.php                            14-Apr-2024 10:04               10070
function.finfo-set-flags.php                       14-Apr-2024 10:04                4741
function.floatval.php                              14-Apr-2024 10:04                6184
function.flock.php                                 14-Apr-2024 10:04                8947
function.floor.php                                 14-Apr-2024 10:04                3501
function.flush.php                                 14-Apr-2024 10:04                4543
function.fmod.php                                  14-Apr-2024 10:04                4977
function.fnmatch.php                               14-Apr-2024 10:04               10994
function.fopen.php                                 14-Apr-2024 10:04               22795
function.forward-static-call-array.php             14-Apr-2024 10:04                9509
function.forward-static-call.php                   14-Apr-2024 10:04                8774
function.fpassthru.php                             14-Apr-2024 10:04                6735
function.fpm-get-status.php                        14-Apr-2024 10:04                2765
function.fprintf.php                               14-Apr-2024 10:04                7487
function.fputcsv.php                               14-Apr-2024 10:04               10325
function.fputs.php                                 14-Apr-2024 10:04                1620
function.fread.php                                 14-Apr-2024 10:04               14520
function.frenchtojd.php                            14-Apr-2024 10:04                2579
function.fscanf.php                                14-Apr-2024 10:04                6332
function.fseek.php                                 14-Apr-2024 10:04                5917
function.fsockopen.php                             14-Apr-2024 10:04               11645
function.fstat.php                                 14-Apr-2024 10:04                5369
function.fsync.php                                 14-Apr-2024 10:04                5713
function.ftell.php                                 14-Apr-2024 10:04                4709
function.ftok.php                                  14-Apr-2024 10:04                2973
function.ftp-alloc.php                             14-Apr-2024 10:04                8410
function.ftp-append.php                            14-Apr-2024 10:04                4588
function.ftp-cdup.php                              14-Apr-2024 10:04                4989
function.ftp-chdir.php                             14-Apr-2024 10:04                5655
function.ftp-chmod.php                             14-Apr-2024 10:04                7048
function.ftp-close.php                             14-Apr-2024 10:04                5426
function.ftp-connect.php                           14-Apr-2024 10:04                5060
function.ftp-delete.php                            14-Apr-2024 10:04                5585
function.ftp-exec.php                              14-Apr-2024 10:04                4819
function.ftp-fget.php                              14-Apr-2024 10:04                7335
function.ftp-fput.php                              14-Apr-2024 10:04                7329
function.ftp-get-option.php                        14-Apr-2024 10:04                4026
function.ftp-get.php                               14-Apr-2024 10:04                6890
function.ftp-login.php                             14-Apr-2024 10:04                5110
function.ftp-mdtm.php                              14-Apr-2024 10:04                5832
function.ftp-mkdir.php                             14-Apr-2024 10:04                4858
function.ftp-mlsd.php                              14-Apr-2024 10:04                9141
function.ftp-nb-continue.php                       14-Apr-2024 10:04                4311
function.ftp-nb-fget.php                           14-Apr-2024 10:04                8081
function.ftp-nb-fput.php                           14-Apr-2024 10:04                7989
function.ftp-nb-get.php                            14-Apr-2024 10:04               11690
function.ftp-nb-put.php                            14-Apr-2024 10:04                9014
function.ftp-nlist.php                             14-Apr-2024 10:04                4727
function.ftp-pasv.php                              14-Apr-2024 10:04                5888
function.ftp-put.php                               14-Apr-2024 10:04                6781
function.ftp-pwd.php                               14-Apr-2024 10:04                4158
function.ftp-quit.php                              14-Apr-2024 10:04                1628
function.ftp-raw.php                               14-Apr-2024 10:04                3807
function.ftp-rawlist.php                           14-Apr-2024 10:04                5480
function.ftp-rename.php                            14-Apr-2024 10:04                5689
function.ftp-rmdir.php                             14-Apr-2024 10:04                5016
function.ftp-set-option.php                        14-Apr-2024 10:04                5070
function.ftp-site.php                              14-Apr-2024 10:04                5058
function.ftp-size.php                              14-Apr-2024 10:04                5311
function.ftp-ssl-connect.php                       14-Apr-2024 10:04                5868
function.ftp-systype.php                           14-Apr-2024 10:04                4160
function.ftruncate.php                             14-Apr-2024 10:04                3267
function.func-get-arg.php                          14-Apr-2024 10:04               11009
function.func-get-args.php                         14-Apr-2024 10:04               11654
function.func-num-args.php                         14-Apr-2024 10:04                5880
function.function-exists.php                       14-Apr-2024 10:04                6022
function.fwrite.php                                14-Apr-2024 10:04                7493
function.gc-collect-cycles.php                     14-Apr-2024 10:04                2513
function.gc-disable.php                            14-Apr-2024 10:04                2553
function.gc-enable.php                             14-Apr-2024 10:04                2526
function.gc-enabled.php                            14-Apr-2024 10:04                3369
function.gc-mem-caches.php                         14-Apr-2024 10:04                2453
function.gc-status.php                             14-Apr-2024 10:04                8700
function.gd-info.php                               14-Apr-2024 10:04                9041
function.geoip-asnum-by-name.php                   14-Apr-2024 10:04                4202
function.geoip-continent-code-by-name.php          14-Apr-2024 10:04                5714
function.geoip-country-code-by-name.php            14-Apr-2024 10:04                5437
function.geoip-country-code3-by-name.php           14-Apr-2024 10:04                5000
function.geoip-country-name-by-name.php            14-Apr-2024 10:04                4964
function.geoip-database-info.php                   14-Apr-2024 10:04                4286
function.geoip-db-avail.php                        14-Apr-2024 10:04                4502
function.geoip-db-filename.php                     14-Apr-2024 10:04                4162
function.geoip-db-get-all-info.php                 14-Apr-2024 10:04                6742
function.geoip-domain-by-name.php                  14-Apr-2024 10:04                4437
function.geoip-id-by-name.php                      14-Apr-2024 10:04                5509
function.geoip-isp-by-name.php                     14-Apr-2024 10:04                4441
function.geoip-netspeedcell-by-name.php            14-Apr-2024 10:04                5179
function.geoip-org-by-name.php                     14-Apr-2024 10:04                4460
function.geoip-record-by-name.php                  14-Apr-2024 10:04                7790
function.geoip-region-by-name.php                  14-Apr-2024 10:04                5121
function.geoip-region-name-by-code.php             14-Apr-2024 10:04                7173
function.geoip-setup-custom-directory.php          14-Apr-2024 10:04                4210
function.geoip-time-zone-by-country-and-region.php 14-Apr-2024 10:04                7383
function.get-browser.php                           14-Apr-2024 10:04                8620
function.get-called-class.php                      14-Apr-2024 10:04                6158
function.get-cfg-var.php                           14-Apr-2024 10:04                2848
function.get-class-methods.php                     14-Apr-2024 10:04                6361
function.get-class-vars.php                        14-Apr-2024 10:04               10977
function.get-class.php                             14-Apr-2024 10:04                9191
function.get-current-user.php                      14-Apr-2024 10:04                2411
function.get-debug-type.php                        14-Apr-2024 10:04                9508
function.get-declared-classes.php                  14-Apr-2024 10:04                4359
function.get-declared-interfaces.php               14-Apr-2024 10:04                4256
function.get-declared-traits.php                   14-Apr-2024 10:04                2805
function.get-defined-constants.php                 14-Apr-2024 10:04                3739
function.get-defined-functions.php                 14-Apr-2024 10:04                7089
function.get-defined-vars.php                      14-Apr-2024 10:04                6107
function.get-extension-funcs.php                   14-Apr-2024 10:04                3562
function.get-headers.php                           14-Apr-2024 10:04                9232
function.get-html-translation-table.php            14-Apr-2024 10:04                5817
function.get-include-path.php                      14-Apr-2024 10:04                3355
function.get-included-files.php                    14-Apr-2024 10:04                6106
function.get-loaded-extensions.php                 14-Apr-2024 10:04                3384
function.get-magic-quotes-gpc.php                  14-Apr-2024 10:04                3999
function.get-magic-quotes-runtime.php              14-Apr-2024 10:04                2331
function.get-mangled-object-vars.php               14-Apr-2024 10:04                8195
function.get-meta-tags.php                         14-Apr-2024 10:04                7823
function.get-object-vars.php                       14-Apr-2024 10:04                6895
function.get-parent-class.php                      14-Apr-2024 10:04                7707
function.get-required-files.php                    14-Apr-2024 10:04                1794
function.get-resource-id.php                       14-Apr-2024 10:04                4834
function.get-resource-type.php                     14-Apr-2024 10:04                5438
function.get-resources.php                         14-Apr-2024 10:04                7941
function.getallheaders.php                         14-Apr-2024 10:04                4533
function.getcwd.php                                14-Apr-2024 10:04                4055
function.getdate.php                               14-Apr-2024 10:04                8867
function.getenv.php                                14-Apr-2024 10:04                4933
function.gethostbyaddr.php                         14-Apr-2024 10:04                2313
function.gethostbyname.php                         14-Apr-2024 10:04                2240
function.gethostbynamel.php                        14-Apr-2024 10:04                2652
function.gethostname.php                           14-Apr-2024 10:04                3950
function.getimagesize.php                          14-Apr-2024 10:04               16855
function.getimagesizefromstring.php                14-Apr-2024 10:04                5600
function.getlastmod.php                            14-Apr-2024 10:04                4106
function.getmxrr.php                               14-Apr-2024 10:04                3458
function.getmygid.php                              14-Apr-2024 10:04                2455
function.getmyinode.php                            14-Apr-2024 10:04                2595
function.getmypid.php                              14-Apr-2024 10:04                2695
function.getmyuid.php                              14-Apr-2024 10:04                2438
function.getopt.php                                14-Apr-2024 10:04                4216
function.getprotobyname.php                        14-Apr-2024 10:04                2339
function.getprotobynumber.php                      14-Apr-2024 10:04                2363
function.getrandmax.php                            14-Apr-2024 10:04                2967
function.getrusage.php                             14-Apr-2024 10:04                4248
function.getservbyname.php                         14-Apr-2024 10:04                5360
function.getservbyport.php                         14-Apr-2024 10:04                2773
function.gettext.php                               14-Apr-2024 10:04                5810
function.gettimeofday.php                          14-Apr-2024 10:04                4961
function.gettype.php                               14-Apr-2024 10:04                9003
function.glob.php                                  14-Apr-2024 10:04               10616
function.gmdate.php                                14-Apr-2024 10:04                8054
function.gmmktime.php                              14-Apr-2024 10:04                3236
function.gmp-abs.php                               14-Apr-2024 10:04                1892
function.gmp-add.php                               14-Apr-2024 10:04                2100
function.gmp-and.php                               14-Apr-2024 10:04                2039
function.gmp-binomial.php                          14-Apr-2024 10:04                4033
function.gmp-clrbit.php                            14-Apr-2024 10:04                2133
function.gmp-cmp.php                               14-Apr-2024 10:04                2176
function.gmp-com.php                               14-Apr-2024 10:04                2050
function.gmp-div-q.php                             14-Apr-2024 10:04                3570
function.gmp-div-qr.php                            14-Apr-2024 10:04                4673
function.gmp-div-r.php                             14-Apr-2024 10:04                2919
function.gmp-div.php                               14-Apr-2024 10:04                2143
function.gmp-divexact.php                          14-Apr-2024 10:04                2355
function.gmp-export.php                            14-Apr-2024 10:04                5677
function.gmp-fact.php                              14-Apr-2024 10:04                1919
function.gmp-gcd.php                               14-Apr-2024 10:04                2214
function.gmp-gcdext.php                            14-Apr-2024 10:04                2240
function.gmp-hamdist.php                           14-Apr-2024 10:04                2207
function.gmp-import.php                            14-Apr-2024 10:04                5996
function.gmp-init.php                              14-Apr-2024 10:04                3489
function.gmp-intval.php                            14-Apr-2024 10:04                2355
function.gmp-invert.php                            14-Apr-2024 10:04                2291
function.gmp-jacobi.php                            14-Apr-2024 10:04                2348
function.gmp-kronecker.php                         14-Apr-2024 10:04                4056
function.gmp-lcm.php                               14-Apr-2024 10:04                3841
function.gmp-legendre.php                          14-Apr-2024 10:04                2340
function.gmp-mod.php                               14-Apr-2024 10:04                2205
function.gmp-mul.php                               14-Apr-2024 10:04                2112
function.gmp-neg.php                               14-Apr-2024 10:04                1895
function.gmp-nextprime.php                         14-Apr-2024 10:04                5063
function.gmp-or.php                                14-Apr-2024 10:04                2058
function.gmp-perfect-power.php                     14-Apr-2024 10:04                3384
function.gmp-perfect-square.php                    14-Apr-2024 10:04                2449
function.gmp-popcount.php                          14-Apr-2024 10:04                1971
function.gmp-pow.php                               14-Apr-2024 10:04                2242
function.gmp-powm.php                              14-Apr-2024 10:04                2448
function.gmp-prob-prime.php                        14-Apr-2024 10:04                2750
function.gmp-random-bits.php                       14-Apr-2024 10:04                5362
function.gmp-random-range.php                      14-Apr-2024 10:04                6727
function.gmp-random-seed.php                       14-Apr-2024 10:04                7577
function.gmp-random.php                            14-Apr-2024 10:04                2161
function.gmp-root.php                              14-Apr-2024 10:04                3219
function.gmp-rootrem.php                           14-Apr-2024 10:04                3385
function.gmp-scan0.php                             14-Apr-2024 10:04                2216
function.gmp-scan1.php                             14-Apr-2024 10:04                2215
function.gmp-setbit.php                            14-Apr-2024 10:04                2442
function.gmp-sign.php                              14-Apr-2024 10:04                1971
function.gmp-sqrt.php                              14-Apr-2024 10:04                1910
function.gmp-sqrtrem.php                           14-Apr-2024 10:04                2241
function.gmp-strval.php                            14-Apr-2024 10:04                3437
function.gmp-sub.php                               14-Apr-2024 10:04                2125
function.gmp-testbit.php                           14-Apr-2024 10:04                6033
function.gmp-xor.php                               14-Apr-2024 10:04                2048
function.gmstrftime.php                            14-Apr-2024 10:04                3134
function.gnupg-adddecryptkey.php                   14-Apr-2024 10:04                5352
function.gnupg-addencryptkey.php                   14-Apr-2024 10:04                4899
function.gnupg-addsignkey.php                      14-Apr-2024 10:04                5372
function.gnupg-cleardecryptkeys.php                14-Apr-2024 10:04                4441
function.gnupg-clearencryptkeys.php                14-Apr-2024 10:04                4446
function.gnupg-clearsignkeys.php                   14-Apr-2024 10:04                4388
function.gnupg-decrypt.php                         14-Apr-2024 10:04                6099
function.gnupg-decryptverify.php                   14-Apr-2024 10:04                7251
function.gnupg-deletekey.php                       14-Apr-2024 10:04                5184
function.gnupg-encrypt.php                         14-Apr-2024 10:04                6002
function.gnupg-encryptsign.php                     14-Apr-2024 10:04                6902
function.gnupg-export.php                          14-Apr-2024 10:04                5202
function.gnupg-getengineinfo.php                   14-Apr-2024 10:04                5575
function.gnupg-geterror.php                        14-Apr-2024 10:04                4353
function.gnupg-geterrorinfo.php                    14-Apr-2024 10:04                5678
function.gnupg-getprotocol.php                     14-Apr-2024 10:04                4441
function.gnupg-gettrustlist.php                    14-Apr-2024 10:04                5263
function.gnupg-import.php                          14-Apr-2024 10:04                5460
function.gnupg-init.php                            14-Apr-2024 10:04                7250
function.gnupg-keyinfo.php                         14-Apr-2024 10:04                5387
function.gnupg-listsignatures.php                  14-Apr-2024 10:04                5487
function.gnupg-setarmor.php                        14-Apr-2024 10:04                5657
function.gnupg-seterrormode.php                    14-Apr-2024 10:04                5711
function.gnupg-setsignmode.php                     14-Apr-2024 10:04                5792
function.gnupg-sign.php                            14-Apr-2024 10:04                6244
function.gnupg-verify.php                          14-Apr-2024 10:04                8492
function.grapheme-extract.php                      14-Apr-2024 10:04                8947
function.grapheme-stripos.php                      14-Apr-2024 10:04                8223
function.grapheme-stristr.php                      14-Apr-2024 10:04                7833
function.grapheme-strlen.php                       14-Apr-2024 10:04                5563
function.grapheme-strpos.php                       14-Apr-2024 10:04                7895
function.grapheme-strripos.php                     14-Apr-2024 10:04                7667
function.grapheme-strrpos.php                      14-Apr-2024 10:04                7331
function.grapheme-strstr.php                       14-Apr-2024 10:04                7482
function.grapheme-substr.php                       14-Apr-2024 10:04                8084
function.gregoriantojd.php                         14-Apr-2024 10:04                4119
function.gzclose.php                               14-Apr-2024 10:04                4310
function.gzcompress.php                            14-Apr-2024 10:04                5901
function.gzdecode.php                              14-Apr-2024 10:04                3768
function.gzdeflate.php                             14-Apr-2024 10:04                5723
function.gzencode.php                              14-Apr-2024 10:04                7881
function.gzeof.php                                 14-Apr-2024 10:04                4139
function.gzfile.php                                14-Apr-2024 10:04                4788
function.gzgetc.php                                14-Apr-2024 10:04                4695
function.gzgets.php                                14-Apr-2024 10:04                6148
function.gzgetss.php                               14-Apr-2024 10:04                6105
function.gzinflate.php                             14-Apr-2024 10:04                5414
function.gzopen.php                                14-Apr-2024 10:04                5726
function.gzpassthru.php                            14-Apr-2024 10:04                4746
function.gzputs.php                                14-Apr-2024 10:04                1614
function.gzread.php                                14-Apr-2024 10:04                6646
function.gzrewind.php                              14-Apr-2024 10:04                3300
function.gzseek.php                                14-Apr-2024 10:04                6353
function.gztell.php                                14-Apr-2024 10:04                3451
function.gzuncompress.php                          14-Apr-2024 10:04                5290
function.gzwrite.php                               14-Apr-2024 10:04                6651
function.halt-compiler.php                         14-Apr-2024 10:04                4905
function.hash-algos.php                            14-Apr-2024 10:04                5789
function.hash-copy.php                             14-Apr-2024 10:04                5503
function.hash-equals.php                           14-Apr-2024 10:04                7181
function.hash-file.php                             14-Apr-2024 10:04                7524
function.hash-final.php                            14-Apr-2024 10:04                4835
function.hash-hkdf.php                             14-Apr-2024 10:04                9799
function.hash-hmac-algos.php                       14-Apr-2024 10:04                5283
function.hash-hmac-file.php                        14-Apr-2024 10:04                8296
function.hash-hmac.php                             14-Apr-2024 10:04                7880
function.hash-init.php                             14-Apr-2024 10:04               10494
function.hash-pbkdf2.php                           14-Apr-2024 10:04               12093
function.hash-update-file.php                      14-Apr-2024 10:04                5813
function.hash-update-stream.php                    14-Apr-2024 10:04                7390
function.hash-update.php                           14-Apr-2024 10:04                4397
function.hash.php                                  14-Apr-2024 10:04                7308
function.header-register-callback.php              14-Apr-2024 10:04                6796
function.header-remove.php                         14-Apr-2024 10:04                6806
function.header.php                                14-Apr-2024 10:04               19342
function.headers-list.php                          14-Apr-2024 10:04                5966
function.headers-sent.php                          14-Apr-2024 10:04                8177
function.hebrev.php                                14-Apr-2024 10:04                2473
function.hebrevc.php                               14-Apr-2024 10:04                2705
function.hex2bin.php                               14-Apr-2024 10:04                4984
function.hexdec.php                                14-Apr-2024 10:04                4291
function.highlight-file.php                        14-Apr-2024 10:04                5580
function.highlight-string.php                      14-Apr-2024 10:04                6834
function.hrtime.php                                14-Apr-2024 10:04                5216
function.html-entity-decode.php                    14-Apr-2024 10:04               11729
function.htmlentities.php                          14-Apr-2024 10:04               10184
function.htmlspecialchars-decode.php               14-Apr-2024 10:04                9367
function.htmlspecialchars.php                      14-Apr-2024 10:04               10341
function.http-build-query.php                      14-Apr-2024 10:04               19776
function.http-response-code.php                    14-Apr-2024 10:04                7016
function.hypot.php                                 14-Apr-2024 10:04                2201
function.ibase-add-user.php                        14-Apr-2024 10:04                5158
function.ibase-affected-rows.php                   14-Apr-2024 10:04                3420
function.ibase-backup.php                          14-Apr-2024 10:04               10470
function.ibase-blob-add.php                        14-Apr-2024 10:04                3968
function.ibase-blob-cancel.php                     14-Apr-2024 10:04                3681
function.ibase-blob-close.php                      14-Apr-2024 10:04                3942
function.ibase-blob-create.php                     14-Apr-2024 10:04                4019
function.ibase-blob-echo.php                       14-Apr-2024 10:04                4208
function.ibase-blob-get.php                        14-Apr-2024 10:04                6539
function.ibase-blob-import.php                     14-Apr-2024 10:04                7956
function.ibase-blob-info.php                       14-Apr-2024 10:04                3484
function.ibase-blob-open.php                       14-Apr-2024 10:04                4414
function.ibase-close.php                           14-Apr-2024 10:04                3783
function.ibase-commit-ret.php                      14-Apr-2024 10:04                3301
function.ibase-commit.php                          14-Apr-2024 10:04                3102
function.ibase-connect.php                         14-Apr-2024 10:04               10485
function.ibase-db-info.php                         14-Apr-2024 10:04                2703
function.ibase-delete-user.php                     14-Apr-2024 10:04                3574
function.ibase-drop-db.php                         14-Apr-2024 10:04                3681
function.ibase-errcode.php                         14-Apr-2024 10:04                2661
function.ibase-errmsg.php                          14-Apr-2024 10:04                2654
function.ibase-execute.php                         14-Apr-2024 10:04                6923
function.ibase-fetch-assoc.php                     14-Apr-2024 10:04                4695
function.ibase-fetch-object.php                    14-Apr-2024 10:04                6621
function.ibase-fetch-row.php                       14-Apr-2024 10:04                4512
function.ibase-field-info.php                      14-Apr-2024 10:04                6917
function.ibase-free-event-handler.php              14-Apr-2024 10:04                3519
function.ibase-free-query.php                      14-Apr-2024 10:04                2817
function.ibase-free-result.php                     14-Apr-2024 10:04                2909
function.ibase-gen-id.php                          14-Apr-2024 10:04                2822
function.ibase-maintain-db.php                     14-Apr-2024 10:04                3149
function.ibase-modify-user.php                     14-Apr-2024 10:04                5163
function.ibase-name-result.php                     14-Apr-2024 10:04                5771
function.ibase-num-fields.php                      14-Apr-2024 10:04                6378
function.ibase-num-params.php                      14-Apr-2024 10:04                3410
function.ibase-param-info.php                      14-Apr-2024 10:04                3662
function.ibase-pconnect.php                        14-Apr-2024 10:04                7889
function.ibase-prepare.php                         14-Apr-2024 10:04                4633
function.ibase-query.php                           14-Apr-2024 10:04                7191
function.ibase-restore.php                         14-Apr-2024 10:04               10737
function.ibase-rollback-ret.php                    14-Apr-2024 10:04                3342
function.ibase-rollback.php                        14-Apr-2024 10:04                3147
function.ibase-server-info.php                     14-Apr-2024 10:04                9809
function.ibase-service-attach.php                  14-Apr-2024 10:04               11008
function.ibase-service-detach.php                  14-Apr-2024 10:04                6126
function.ibase-set-event-handler.php               14-Apr-2024 10:04                7833
function.ibase-trans.php                           14-Apr-2024 10:04                5855
function.ibase-wait-event.php                      14-Apr-2024 10:04                4311
function.iconv-get-encoding.php                    14-Apr-2024 10:04                5583
function.iconv-mime-decode-headers.php             14-Apr-2024 10:04               10431
function.iconv-mime-decode.php                     14-Apr-2024 10:04                8339
function.iconv-mime-encode.php                     14-Apr-2024 10:04               11955
function.iconv-set-encoding.php                    14-Apr-2024 10:04                5046
function.iconv-strlen.php                          14-Apr-2024 10:04                5082
function.iconv-strpos.php                          14-Apr-2024 10:04                7517
function.iconv-strrpos.php                         14-Apr-2024 10:04                6746
function.iconv-substr.php                          14-Apr-2024 10:04                8499
function.iconv.php                                 14-Apr-2024 10:04                7927
function.idate.php                                 14-Apr-2024 10:04               11435
function.idn-to-ascii.php                          14-Apr-2024 10:04                7925
function.idn-to-utf8.php                           14-Apr-2024 10:04                7944
function.igbinary-serialize.php                    14-Apr-2024 10:04                9852
function.igbinary-unserialize.php                  14-Apr-2024 10:04                9881
function.ignore-user-abort.php                     14-Apr-2024 10:04                7373
function.image-type-to-extension.php               14-Apr-2024 10:04                5401
function.image-type-to-mime-type.php               14-Apr-2024 10:04                9032
function.image2wbmp.php                            14-Apr-2024 10:04                6528
function.imageaffine.php                           14-Apr-2024 10:04                4786
function.imageaffinematrixconcat.php               14-Apr-2024 10:04                6622
function.imageaffinematrixget.php                  14-Apr-2024 10:04                6693
function.imagealphablending.php                    14-Apr-2024 10:04                7638
function.imageantialias.php                        14-Apr-2024 10:04               10830
function.imagearc.php                              14-Apr-2024 10:04               13710
function.imageavif.php                             14-Apr-2024 10:04                5963
function.imagebmp.php                              14-Apr-2024 10:04                8119
function.imagechar.php                             14-Apr-2024 10:04               10043
function.imagecharup.php                           14-Apr-2024 10:04                9908
function.imagecolorallocate.php                    14-Apr-2024 10:04                9995
function.imagecolorallocatealpha.php               14-Apr-2024 10:04               18163
function.imagecolorat.php                          14-Apr-2024 10:04               10287
function.imagecolorclosest.php                     14-Apr-2024 10:04               12098
function.imagecolorclosestalpha.php                14-Apr-2024 10:04               12539
function.imagecolorclosesthwb.php                  14-Apr-2024 10:04                6605
function.imagecolordeallocate.php                  14-Apr-2024 10:04                5893
function.imagecolorexact.php                       14-Apr-2024 10:04                8488
function.imagecolorexactalpha.php                  14-Apr-2024 10:04                9430
function.imagecolormatch.php                       14-Apr-2024 10:04                8494
function.imagecolorresolve.php                     14-Apr-2024 10:04                7667
function.imagecolorresolvealpha.php                14-Apr-2024 10:04                8387
function.imagecolorset.php                         14-Apr-2024 10:04                8863
function.imagecolorsforindex.php                   14-Apr-2024 10:04                7336
function.imagecolorstotal.php                      14-Apr-2024 10:04                5778
function.imagecolortransparent.php                 14-Apr-2024 10:04                9107
function.imageconvolution.php                      14-Apr-2024 10:04               11809
function.imagecopy.php                             14-Apr-2024 10:04                9521
function.imagecopymerge.php                        14-Apr-2024 10:04                9775
function.imagecopymergegray.php                    14-Apr-2024 10:04               10298
function.imagecopyresampled.php                    14-Apr-2024 10:04               19266
function.imagecopyresized.php                      14-Apr-2024 10:04               14165
function.imagecreate.php                           14-Apr-2024 10:04                8365
function.imagecreatefromavif.php                   14-Apr-2024 10:04                2904
function.imagecreatefrombmp.php                    14-Apr-2024 10:04                5631
function.imagecreatefromgd.php                     14-Apr-2024 10:04                6197
function.imagecreatefromgd2.php                    14-Apr-2024 10:04                6465
function.imagecreatefromgd2part.php                14-Apr-2024 10:04                9053
function.imagecreatefromgif.php                    14-Apr-2024 10:04                9800
function.imagecreatefromjpeg.php                   14-Apr-2024 10:04                9448
function.imagecreatefrompng.php                    14-Apr-2024 10:04                9392
function.imagecreatefromstring.php                 14-Apr-2024 10:04                8097
function.imagecreatefromtga.php                    14-Apr-2024 10:04                3556
function.imagecreatefromwbmp.php                   14-Apr-2024 10:04                9431
function.imagecreatefromwebp.php                   14-Apr-2024 10:04                5783
function.imagecreatefromxbm.php                    14-Apr-2024 10:04                5623
function.imagecreatefromxpm.php                    14-Apr-2024 10:04                6268
function.imagecreatetruecolor.php                  14-Apr-2024 10:04                7230
function.imagecrop.php                             14-Apr-2024 10:04                7800
function.imagecropauto.php                         14-Apr-2024 10:04               10689
function.imagedashedline.php                       14-Apr-2024 10:04               12706
function.imagedestroy.php                          14-Apr-2024 10:04                5089
function.imageellipse.php                          14-Apr-2024 10:04               10152
function.imagefill.php                             14-Apr-2024 10:04                7649
function.imagefilledarc.php                        14-Apr-2024 10:04               19024
function.imagefilledellipse.php                    14-Apr-2024 10:04                9853
function.imagefilledpolygon.php                    14-Apr-2024 10:04               12145
function.imagefilledrectangle.php                  14-Apr-2024 10:04                8441
function.imagefilltoborder.php                     14-Apr-2024 10:04               11271
function.imagefilter.php                           14-Apr-2024 10:04               33972
function.imageflip.php                             14-Apr-2024 10:04                9816
function.imagefontheight.php                       14-Apr-2024 10:04                6449
function.imagefontwidth.php                        14-Apr-2024 10:04                6402
function.imageftbbox.php                           14-Apr-2024 10:04               14247
function.imagefttext.php                           14-Apr-2024 10:04               15855
function.imagegammacorrect.php                     14-Apr-2024 10:04                5973
function.imagegd.php                               14-Apr-2024 10:04               10603
function.imagegd2.php                              14-Apr-2024 10:04               11557
function.imagegetclip.php                          14-Apr-2024 10:04                6057
function.imagegetinterpolation.php                 14-Apr-2024 10:04                3703
function.imagegif.php                              14-Apr-2024 10:04               16591
function.imagegrabscreen.php                       14-Apr-2024 10:04                4804
function.imagegrabwindow.php                       14-Apr-2024 10:04                9918
function.imageinterlace.php                        14-Apr-2024 10:04                7172
function.imageistruecolor.php                      14-Apr-2024 10:04                7363
function.imagejpeg.php                             14-Apr-2024 10:04               14914
function.imagelayereffect.php                      14-Apr-2024 10:04               12032
function.imageline.php                             14-Apr-2024 10:04               15574
function.imageloadfont.php                         14-Apr-2024 10:04                9385
function.imageopenpolygon.php                      14-Apr-2024 10:04               10505
function.imagepalettecopy.php                      14-Apr-2024 10:04                7457
function.imagepalettetotruecolor.php               14-Apr-2024 10:04                9773
function.imagepng.php                              14-Apr-2024 10:04                8942
function.imagepolygon.php                          14-Apr-2024 10:04               10759
function.imagerectangle.php                        14-Apr-2024 10:04               10616
function.imageresolution.php                       14-Apr-2024 10:04                7865
function.imagerotate.php                           14-Apr-2024 10:04                9155
function.imagesavealpha.php                        14-Apr-2024 10:04                7680
function.imagescale.php                            14-Apr-2024 10:04                6802
function.imagesetbrush.php                         14-Apr-2024 10:04                9406
function.imagesetclip.php                          14-Apr-2024 10:04                5273
function.imagesetinterpolation.php                 14-Apr-2024 10:04               11588
function.imagesetpixel.php                         14-Apr-2024 10:04               11493
function.imagesetstyle.php                         14-Apr-2024 10:04               12363
function.imagesetthickness.php                     14-Apr-2024 10:04                8446
function.imagesettile.php                          14-Apr-2024 10:04                8427
function.imagestring.php                           14-Apr-2024 10:04               10243
function.imagestringup.php                         14-Apr-2024 10:04                9430
function.imagesx.php                               14-Apr-2024 10:04                5011
function.imagesy.php                               14-Apr-2024 10:04                5033
function.imagetruecolortopalette.php               14-Apr-2024 10:04                6901
function.imagettfbbox.php                          14-Apr-2024 10:04               19532
function.imagettftext.php                          14-Apr-2024 10:04               18186
function.imagetypes.php                            14-Apr-2024 10:04                5077
function.imagewbmp.php                             14-Apr-2024 10:04               15103
function.imagewebp.php                             14-Apr-2024 10:04                7456
function.imagexbm.php                              14-Apr-2024 10:04               11999
function.imap-8bit.php                             14-Apr-2024 10:04                3144
function.imap-alerts.php                           14-Apr-2024 10:04                3240
function.imap-append.php                           14-Apr-2024 10:04                9627
function.imap-base64.php                           14-Apr-2024 10:04                3496
function.imap-binary.php                           14-Apr-2024 10:04                3108
function.imap-body.php                             14-Apr-2024 10:04                5621
function.imap-bodystruct.php                       14-Apr-2024 10:04                4723
function.imap-check.php                            14-Apr-2024 10:04                6043
function.imap-clearflag-full.php                   14-Apr-2024 10:04                6471
function.imap-close.php                            14-Apr-2024 10:04                4984
function.imap-create.php                           14-Apr-2024 10:04                1718
function.imap-createmailbox.php                    14-Apr-2024 10:04               13841
function.imap-delete.php                           14-Apr-2024 10:04               10496
function.imap-deletemailbox.php                    14-Apr-2024 10:04                4955
function.imap-errors.php                           14-Apr-2024 10:04                3427
function.imap-expunge.php                          14-Apr-2024 10:04                3614
function.imap-fetch-overview.php                   14-Apr-2024 10:04               11302
function.imap-fetchbody.php                        14-Apr-2024 10:04                6222
function.imap-fetchheader.php                      14-Apr-2024 10:04                5873
function.imap-fetchmime.php                        14-Apr-2024 10:04                6411
function.imap-fetchstructure.php                   14-Apr-2024 10:04                9725
function.imap-fetchtext.php                        14-Apr-2024 10:04                1699
function.imap-gc.php                               14-Apr-2024 10:04                5846
function.imap-get-quota.php                        14-Apr-2024 10:04               12196
function.imap-get-quotaroot.php                    14-Apr-2024 10:04                9155
function.imap-getacl.php                           14-Apr-2024 10:04                5895
function.imap-getmailboxes.php                     14-Apr-2024 10:04               12191
function.imap-getsubscribed.php                    14-Apr-2024 10:04                7927
function.imap-header.php                           14-Apr-2024 10:04                1905
function.imap-headerinfo.php                       14-Apr-2024 10:04               11778
function.imap-headers.php                          14-Apr-2024 10:04                3497
function.imap-is-open.php                          14-Apr-2024 10:04                4179
function.imap-last-error.php                       14-Apr-2024 10:04                3156
function.imap-list.php                             14-Apr-2024 10:04                8704
function.imap-listmailbox.php                      14-Apr-2024 10:04                1704
function.imap-listscan.php                         14-Apr-2024 10:04                6991
function.imap-listsubscribed.php                   14-Apr-2024 10:04                1725
function.imap-lsub.php                             14-Apr-2024 10:04                6036
function.imap-mail-compose.php                     14-Apr-2024 10:04               16542
function.imap-mail-copy.php                        14-Apr-2024 10:04                6283
function.imap-mail-move.php                        14-Apr-2024 10:04                6662
function.imap-mail.php                             14-Apr-2024 10:04                7396
function.imap-mailboxmsginfo.php                   14-Apr-2024 10:04                9265
function.imap-mime-header-decode.php               14-Apr-2024 10:04                6464
function.imap-msgno.php                            14-Apr-2024 10:04                4187
function.imap-mutf7-to-utf8.php                    14-Apr-2024 10:04                3330
function.imap-num-msg.php                          14-Apr-2024 10:04                4044
function.imap-num-recent.php                       14-Apr-2024 10:04                3851
function.imap-open.php                             14-Apr-2024 10:04               21731
function.imap-ping.php                             14-Apr-2024 10:04                4910
function.imap-qprint.php                           14-Apr-2024 10:04                3154
function.imap-rename.php                           14-Apr-2024 10:04                1721
function.imap-renamemailbox.php                    14-Apr-2024 10:04                5595
function.imap-reopen.php                           14-Apr-2024 10:04                8767
function.imap-rfc822-parse-adrlist.php             14-Apr-2024 10:04                7854
function.imap-rfc822-parse-headers.php             14-Apr-2024 10:04                3702
function.imap-rfc822-write-address.php             14-Apr-2024 10:04                5371
function.imap-savebody.php                         14-Apr-2024 10:04                6620
function.imap-scan.php                             14-Apr-2024 10:04                1686
function.imap-scanmailbox.php                      14-Apr-2024 10:04                1716
function.imap-search.php                           14-Apr-2024 10:04               13561
function.imap-set-quota.php                        14-Apr-2024 10:04                6761
function.imap-setacl.php                           14-Apr-2024 10:04                5510
function.imap-setflag-full.php                     14-Apr-2024 10:04                8632
function.imap-sort.php                             14-Apr-2024 10:04                8557
function.imap-status.php                           14-Apr-2024 10:04               10735
function.imap-subscribe.php                        14-Apr-2024 10:04                4463
function.imap-thread.php                           14-Apr-2024 10:04                7888
function.imap-timeout.php                          14-Apr-2024 10:04                4747
function.imap-uid.php                              14-Apr-2024 10:04                4596
function.imap-undelete.php                         14-Apr-2024 10:04                4990
function.imap-unsubscribe.php                      14-Apr-2024 10:04                4540
function.imap-utf7-decode.php                      14-Apr-2024 10:04                3732
function.imap-utf7-encode.php                      14-Apr-2024 10:04                3249
function.imap-utf8-to-mutf7.php                    14-Apr-2024 10:04                3333
function.imap-utf8.php                             14-Apr-2024 10:04                4223
function.implode.php                               14-Apr-2024 10:04                4804
function.in-array.php                              14-Apr-2024 10:04                9018
function.include-once.php                          14-Apr-2024 10:04                2273
function.include.php                               14-Apr-2024 10:04               19703
function.inet-ntop.php                             14-Apr-2024 10:04                6507
function.inet-pton.php                             14-Apr-2024 10:04                5065
function.inflate-add.php                           14-Apr-2024 10:04                6167
function.inflate-get-read-len.php                  14-Apr-2024 10:04                3367
function.inflate-get-status.php                    14-Apr-2024 10:04                3147
function.inflate-init.php                          14-Apr-2024 10:04                6988
function.ini-alter.php                             14-Apr-2024 10:04                1653
function.ini-get-all.php                           14-Apr-2024 10:04                5009
function.ini-get.php                               14-Apr-2024 10:04                8555
function.ini-parse-quantity.php                    14-Apr-2024 10:04                7591
function.ini-restore.php                           14-Apr-2024 10:04                2348
function.ini-set.php                               14-Apr-2024 10:04                3169
function.inotify-add-watch.php                     14-Apr-2024 10:04                4427
function.inotify-init.php                          14-Apr-2024 10:04                8929
function.inotify-queue-len.php                     14-Apr-2024 10:04                3809
function.inotify-read.php                          14-Apr-2024 10:04                4407
function.inotify-rm-watch.php                      14-Apr-2024 10:04                3676
function.intdiv.php                                14-Apr-2024 10:04                7555
function.interface-exists.php                      14-Apr-2024 10:04                5390
function.intl-error-name.php                       14-Apr-2024 10:04                5019
function.intl-get-error-code.php                   14-Apr-2024 10:04                4507
function.intl-get-error-message.php                14-Apr-2024 10:04                4518
function.intl-is-failure.php                       14-Apr-2024 10:04                5573
function.intval.php                                14-Apr-2024 10:04               12492
function.ip2long.php                               14-Apr-2024 10:04                5820
function.iptcembed.php                             14-Apr-2024 10:04               11744
function.iptcparse.php                             14-Apr-2024 10:04                4617
function.is-a.php                                  14-Apr-2024 10:04                8011
function.is-array.php                              14-Apr-2024 10:04                5554
function.is-bool.php                               14-Apr-2024 10:04                5604
function.is-callable.php                           14-Apr-2024 10:04                8379
function.is-countable.php                          14-Apr-2024 10:04                6346
function.is-dir.php                                14-Apr-2024 10:04                6707
function.is-double.php                             14-Apr-2024 10:04                1657
function.is-executable.php                         14-Apr-2024 10:04                4434
function.is-file.php                               14-Apr-2024 10:04                3032
function.is-finite.php                             14-Apr-2024 10:04                2363
function.is-float.php                              14-Apr-2024 10:04                6879
function.is-infinite.php                           14-Apr-2024 10:04                2462
function.is-int.php                                14-Apr-2024 10:04                6666
function.is-integer.php                            14-Apr-2024 10:04                1650
function.is-iterable.php                           14-Apr-2024 10:04                5808
function.is-link.php                               14-Apr-2024 10:04                3023
function.is-long.php                               14-Apr-2024 10:04                1631
function.is-nan.php                                14-Apr-2024 10:04                2330
function.is-null.php                               14-Apr-2024 10:04                6128
function.is-numeric.php                            14-Apr-2024 10:04                8386
function.is-object.php                             14-Apr-2024 10:04                7031
function.is-readable.php                           14-Apr-2024 10:04                3372
function.is-real.php                               14-Apr-2024 10:04                1643
function.is-resource.php                           14-Apr-2024 10:04                4582
function.is-scalar.php                             14-Apr-2024 10:04                8424
function.is-soap-fault.php                         14-Apr-2024 10:04                8118
function.is-string.php                             14-Apr-2024 10:04                6731
function.is-subclass-of.php                        14-Apr-2024 10:04               13649
function.is-tainted.php                            14-Apr-2024 10:04                2368
function.is-uploaded-file.php                      14-Apr-2024 10:04                7133
function.is-writable.php                           14-Apr-2024 10:04                3542
function.is-writeable.php                          14-Apr-2024 10:04                1699
function.isset.php                                 14-Apr-2024 10:04               17198
function.iterator-apply.php                        14-Apr-2024 10:04                6760
function.iterator-count.php                        14-Apr-2024 10:04                8715
function.iterator-to-array.php                     14-Apr-2024 10:04                7968
function.jddayofweek.php                           14-Apr-2024 10:04                2976
function.jdmonthname.php                           14-Apr-2024 10:04                3707
function.jdtofrench.php                            14-Apr-2024 10:04                2026
function.jdtogregorian.php                         14-Apr-2024 10:04                2036
function.jdtojewish.php                            14-Apr-2024 10:04                4474
function.jdtojulian.php                            14-Apr-2024 10:04                2042
function.jdtounix.php                              14-Apr-2024 10:04                2507
function.jewishtojd.php                            14-Apr-2024 10:04                2574
function.join.php                                  14-Apr-2024 10:04                1633
function.jpeg2wbmp.php                             14-Apr-2024 10:04                6679
function.json-decode.php                           14-Apr-2024 10:04               20279
function.json-encode.php                           14-Apr-2024 10:04               31082
function.json-last-error-msg.php                   14-Apr-2024 10:04                3060
function.json-last-error.php                       14-Apr-2024 10:04               13996
function.json-validate.php                         14-Apr-2024 10:04                8632
function.juliantojd.php                            14-Apr-2024 10:04                3116
function.key-exists.php                            14-Apr-2024 10:04                1684
function.key.php                                   14-Apr-2024 10:04                6166
function.krsort.php                                14-Apr-2024 10:04                5643
function.ksort.php                                 14-Apr-2024 10:04                5877
function.lcfirst.php                               14-Apr-2024 10:04                5886
function.lcg-value.php                             14-Apr-2024 10:04                4473
function.lchgrp.php                                14-Apr-2024 10:04                5971
function.lchown.php                                14-Apr-2024 10:04                5827
function.ldap-8859-to-t61.php                      14-Apr-2024 10:04                3366
function.ldap-add-ext.php                          14-Apr-2024 10:04                5815
function.ldap-add.php                              14-Apr-2024 10:04               10466
function.ldap-bind-ext.php                         14-Apr-2024 10:04                5976
function.ldap-bind.php                             14-Apr-2024 10:04                9516
function.ldap-close.php                            14-Apr-2024 10:04                1669
function.ldap-compare.php                          14-Apr-2024 10:04               10331
function.ldap-connect-wallet.php                   14-Apr-2024 10:04                4309
function.ldap-connect.php                          14-Apr-2024 10:04                9788
function.ldap-control-paged-result-response.php    14-Apr-2024 10:04                5899
function.ldap-control-paged-result.php             14-Apr-2024 10:04               14493
function.ldap-count-entries.php                    14-Apr-2024 10:04                5742
function.ldap-count-references.php                 14-Apr-2024 10:04                4765
function.ldap-delete-ext.php                       14-Apr-2024 10:04                5321
function.ldap-delete.php                           14-Apr-2024 10:04                5352
function.ldap-dn2ufn.php                           14-Apr-2024 10:04                2747
function.ldap-err2str.php                          14-Apr-2024 10:04                4627
function.ldap-errno.php                            14-Apr-2024 10:04                7540
function.ldap-error.php                            14-Apr-2024 10:04                4531
function.ldap-escape.php                           14-Apr-2024 10:04                6336
function.ldap-exop-passwd.php                      14-Apr-2024 10:04               10357
function.ldap-exop-refresh.php                     14-Apr-2024 10:04                5177
function.ldap-exop-sync.php                        14-Apr-2024 10:04                5413
function.ldap-exop-whoami.php                      14-Apr-2024 10:04                3951
function.ldap-exop.php                             14-Apr-2024 10:04               12503
function.ldap-explode-dn.php                       14-Apr-2024 10:04                3653
function.ldap-first-attribute.php                  14-Apr-2024 10:04                5473
function.ldap-first-entry.php                      14-Apr-2024 10:04                5824
function.ldap-first-reference.php                  14-Apr-2024 10:04                2349
function.ldap-free-result.php                      14-Apr-2024 10:04                4134
function.ldap-get-attributes.php                   14-Apr-2024 10:04                8238
function.ldap-get-dn.php                           14-Apr-2024 10:04                4328
function.ldap-get-entries.php                      14-Apr-2024 10:04                6151
function.ldap-get-option.php                       14-Apr-2024 10:04               16730
function.ldap-get-values-len.php                   14-Apr-2024 10:04                5532
function.ldap-get-values.php                       14-Apr-2024 10:04                8642
function.ldap-list.php                             14-Apr-2024 10:04               15470
function.ldap-mod-add.php                          14-Apr-2024 10:04                6875
function.ldap-mod-del.php                          14-Apr-2024 10:04                6400
function.ldap-mod-replace.php                      14-Apr-2024 10:04                6820
function.ldap-mod_add-ext.php                      14-Apr-2024 10:04                5790
function.ldap-mod_del-ext.php                      14-Apr-2024 10:04                5806
function.ldap-mod_replace-ext.php                  14-Apr-2024 10:04                5868
function.ldap-modify-batch.php                     14-Apr-2024 10:04               19000
function.ldap-modify.php                           14-Apr-2024 10:04                2076
function.ldap-next-attribute.php                   14-Apr-2024 10:04                5252
function.ldap-next-entry.php                       14-Apr-2024 10:04                5833
function.ldap-next-reference.php                   14-Apr-2024 10:04                2276
function.ldap-parse-exop.php                       14-Apr-2024 10:04                6015
function.ldap-parse-reference.php                  14-Apr-2024 10:04                2418
function.ldap-parse-result.php                     14-Apr-2024 10:04                9952
function.ldap-read.php                             14-Apr-2024 10:04               12789
function.ldap-rename-ext.php                       14-Apr-2024 10:04                6140
function.ldap-rename.php                           14-Apr-2024 10:04                7243
function.ldap-sasl-bind.php                        14-Apr-2024 10:04                7108
function.ldap-search.php                           14-Apr-2024 10:04               15671
function.ldap-set-option.php                       14-Apr-2024 10:04               19315
function.ldap-set-rebind-proc.php                  14-Apr-2024 10:04                3249
function.ldap-sort.php                             14-Apr-2024 10:04                7222
function.ldap-start-tls.php                        14-Apr-2024 10:04                2032
function.ldap-t61-to-8859.php                      14-Apr-2024 10:04                2184
function.ldap-unbind.php                           14-Apr-2024 10:04                3879
function.levenshtein.php                           14-Apr-2024 10:04               10138
function.libxml-clear-errors.php                   14-Apr-2024 10:04                2655
function.libxml-disable-entity-loader.php          14-Apr-2024 10:04                4941
function.libxml-get-errors.php                     14-Apr-2024 10:04               10700
function.libxml-get-external-entity-loader.php     14-Apr-2024 10:04                3478
function.libxml-get-last-error.php                 14-Apr-2024 10:04                3220
function.libxml-set-external-entity-loader.php     14-Apr-2024 10:04               10538
function.libxml-set-streams-context.php            14-Apr-2024 10:04                5059
function.libxml-use-internal-errors.php            14-Apr-2024 10:04                6687
function.link.php                                  14-Apr-2024 10:04                3149
function.linkinfo.php                              14-Apr-2024 10:04                3623
function.list.php                                  14-Apr-2024 10:04               18112
function.localeconv.php                            14-Apr-2024 10:04               14780
function.localtime.php                             14-Apr-2024 10:04                4318
function.log.php                                   14-Apr-2024 10:04                3006
function.log10.php                                 14-Apr-2024 10:04                2003
function.log1p.php                                 14-Apr-2024 10:04                2649
function.long2ip.php                               14-Apr-2024 10:04                2351
function.lstat.php                                 14-Apr-2024 10:04                3217
function.ltrim.php                                 14-Apr-2024 10:04                9610
function.lzf-compress.php                          14-Apr-2024 10:04                2957
function.lzf-decompress.php                        14-Apr-2024 10:04                3047
function.lzf-optimized-for.php                     14-Apr-2024 10:04                2236
function.mail.php                                  14-Apr-2024 10:04               27046
function.mailparse-determine-best-xfer-encoding..> 14-Apr-2024 10:04                4276
function.mailparse-msg-create.php                  14-Apr-2024 10:04                3376
function.mailparse-msg-extract-part-file.php       14-Apr-2024 10:04                5344
function.mailparse-msg-extract-part.php            14-Apr-2024 10:04                4132
function.mailparse-msg-extract-whole-part-file.php 14-Apr-2024 10:04                4149
function.mailparse-msg-free.php                    14-Apr-2024 10:04                3648
function.mailparse-msg-get-part-data.php           14-Apr-2024 10:04                2584
function.mailparse-msg-get-part.php                14-Apr-2024 10:04                2867
function.mailparse-msg-get-structure.php           14-Apr-2024 10:04                2604
function.mailparse-msg-parse-file.php              14-Apr-2024 10:04                4243
function.mailparse-msg-parse.php                   14-Apr-2024 10:04                3562
function.mailparse-rfc822-parse-addresses.php      14-Apr-2024 10:04                5670
function.mailparse-stream-encode.php               14-Apr-2024 10:04                5932
function.mailparse-uudecode-all.php                14-Apr-2024 10:04                6916
function.max.php                                   14-Apr-2024 10:04                7720
function.mb-check-encoding.php                     14-Apr-2024 10:04                5557
function.mb-chr.php                                14-Apr-2024 10:04                6951
function.mb-convert-case.php                       14-Apr-2024 10:04               11901
function.mb-convert-encoding.php                   14-Apr-2024 10:04               11893
function.mb-convert-kana.php                       14-Apr-2024 10:04               10107
function.mb-convert-variables.php                  14-Apr-2024 10:04                6688
function.mb-decode-mimeheader.php                  14-Apr-2024 10:04                3289
function.mb-decode-numericentity.php               14-Apr-2024 10:04               33937
function.mb-detect-encoding.php                    14-Apr-2024 10:04               16480
function.mb-detect-order.php                       14-Apr-2024 10:04                8947
function.mb-encode-mimeheader.php                  14-Apr-2024 10:04                9968
function.mb-encode-numericentity.php               14-Apr-2024 10:04               12666
function.mb-encoding-aliases.php                   14-Apr-2024 10:04                6407
function.mb-ereg-match.php                         14-Apr-2024 10:04                5646
function.mb-ereg-replace-callback.php              14-Apr-2024 10:04               12533
function.mb-ereg-replace.php                       14-Apr-2024 10:04                7308
function.mb-ereg-search-getpos.php                 14-Apr-2024 10:04                3898
function.mb-ereg-search-getregs.php                14-Apr-2024 10:04                4377
function.mb-ereg-search-init.php                   14-Apr-2024 10:04                6191
function.mb-ereg-search-pos.php                    14-Apr-2024 10:04                6043
function.mb-ereg-search-regs.php                   14-Apr-2024 10:04                5795
function.mb-ereg-search-setpos.php                 14-Apr-2024 10:04                4591
function.mb-ereg-search.php                        14-Apr-2024 10:04                5736
function.mb-ereg.php                               14-Apr-2024 10:04                6520
function.mb-eregi-replace.php                      14-Apr-2024 10:04                7192
function.mb-eregi.php                              14-Apr-2024 10:04                6564
function.mb-get-info.php                           14-Apr-2024 10:04                6237
function.mb-http-input.php                         14-Apr-2024 10:04                5042
function.mb-http-output.php                        14-Apr-2024 10:04                4987
function.mb-internal-encoding.php                  14-Apr-2024 10:04                7039
function.mb-language.php                           14-Apr-2024 10:04                6606
function.mb-list-encodings.php                     14-Apr-2024 10:04                5082
function.mb-ord.php                                14-Apr-2024 10:04                6653
function.mb-output-handler.php                     14-Apr-2024 10:04                5240
function.mb-parse-str.php                          14-Apr-2024 10:04                4705
function.mb-preferred-mime-name.php                14-Apr-2024 10:04                4546
function.mb-regex-encoding.php                     14-Apr-2024 10:04                4533
function.mb-regex-set-options.php                  14-Apr-2024 10:04                8662
function.mb-scrub.php                              14-Apr-2024 10:04                4137
function.mb-send-mail.php                          14-Apr-2024 10:04                9985
function.mb-split.php                              14-Apr-2024 10:04                4832
function.mb-str-pad.php                            14-Apr-2024 10:04                8512
function.mb-str-split.php                          14-Apr-2024 10:04                5335
function.mb-strcut.php                             14-Apr-2024 10:04                7522
function.mb-strimwidth.php                         14-Apr-2024 10:04                7978
function.mb-stripos.php                            14-Apr-2024 10:04                6496
function.mb-stristr.php                            14-Apr-2024 10:04                6812
function.mb-strlen.php                             14-Apr-2024 10:04                5120
function.mb-strpos.php                             14-Apr-2024 10:04                6499
function.mb-strrchr.php                            14-Apr-2024 10:04                6630
function.mb-strrichr.php                           14-Apr-2024 10:04                6680
function.mb-strripos.php                           14-Apr-2024 10:04                6412
function.mb-strrpos.php                            14-Apr-2024 10:04                6835
function.mb-strstr.php                             14-Apr-2024 10:04                6617
function.mb-strtolower.php                         14-Apr-2024 10:04                7106
function.mb-strtoupper.php                         14-Apr-2024 10:04                7188
function.mb-strwidth.php                           14-Apr-2024 10:04                9105
function.mb-substitute-character.php               14-Apr-2024 10:04                7354
function.mb-substr-count.php                       14-Apr-2024 10:04                6079
function.mb-substr.php                             14-Apr-2024 10:04                6548
function.mcrypt-create-iv.php                      14-Apr-2024 10:04                6917
function.mcrypt-decrypt.php                        14-Apr-2024 10:04                5931
function.mcrypt-enc-get-algorithms-name.php        14-Apr-2024 10:04                5337
function.mcrypt-enc-get-block-size.php             14-Apr-2024 10:04                3011
function.mcrypt-enc-get-iv-size.php                14-Apr-2024 10:04                3136
function.mcrypt-enc-get-key-size.php               14-Apr-2024 10:04                3015
function.mcrypt-enc-get-modes-name.php             14-Apr-2024 10:04                5239
function.mcrypt-enc-get-supported-key-sizes.php    14-Apr-2024 10:04                5021
function.mcrypt-enc-is-block-algorithm-mode.php    14-Apr-2024 10:04                3585
function.mcrypt-enc-is-block-algorithm.php         14-Apr-2024 10:04                3306
function.mcrypt-enc-is-block-mode.php              14-Apr-2024 10:04                3413
function.mcrypt-enc-self-test.php                  14-Apr-2024 10:04                3097
function.mcrypt-encrypt.php                        14-Apr-2024 10:04               13901
function.mcrypt-generic-deinit.php                 14-Apr-2024 10:04                4051
function.mcrypt-generic-init.php                   14-Apr-2024 10:04                5241
function.mcrypt-generic.php                        14-Apr-2024 10:04                5879
function.mcrypt-get-block-size.php                 14-Apr-2024 10:04                6698
function.mcrypt-get-cipher-name.php                14-Apr-2024 10:04                5076
function.mcrypt-get-iv-size.php                    14-Apr-2024 10:04                6509
function.mcrypt-get-key-size.php                   14-Apr-2024 10:04                6862
function.mcrypt-list-algorithms.php                14-Apr-2024 10:04                4796
function.mcrypt-list-modes.php                     14-Apr-2024 10:04                4654
function.mcrypt-module-close.php                   14-Apr-2024 10:04                3487
function.mcrypt-module-get-algo-block-size.php     14-Apr-2024 10:04                3527
function.mcrypt-module-get-algo-key-size.php       14-Apr-2024 10:04                3594
function.mcrypt-module-get-supported-key-sizes.php 14-Apr-2024 10:04                4667
function.mcrypt-module-is-block-algorithm-mode.php 14-Apr-2024 10:04                4520
function.mcrypt-module-is-block-algorithm.php      14-Apr-2024 10:04                4061
function.mcrypt-module-is-block-mode.php           14-Apr-2024 10:04                4553
function.mcrypt-module-open.php                    14-Apr-2024 10:04               14104
function.mcrypt-module-self-test.php               14-Apr-2024 10:04                5095
function.md5-file.php                              14-Apr-2024 10:04                5169
function.md5.php                                   14-Apr-2024 10:04                6015
function.mdecrypt-generic.php                      14-Apr-2024 10:04               10865
function.memcache-debug.php                        14-Apr-2024 10:04                3733
function.memory-get-peak-usage.php                 14-Apr-2024 10:04                3710
function.memory-get-usage.php                      14-Apr-2024 10:04                4032
function.memory-reset-peak-usage.php               14-Apr-2024 10:04                4990
function.metaphone.php                             14-Apr-2024 10:04                2871
function.method-exists.php                         14-Apr-2024 10:04                6526
function.mhash-count.php                           14-Apr-2024 10:04                4631
function.mhash-get-block-size.php                  14-Apr-2024 10:04                4571
function.mhash-get-hash-name.php                   14-Apr-2024 10:04                4526
function.mhash-keygen-s2k.php                      14-Apr-2024 10:04                5700
function.mhash.php                                 14-Apr-2024 10:04                4850
function.microtime.php                             14-Apr-2024 10:04               10053
function.mime-content-type.php                     14-Apr-2024 10:04                5082
function.min.php                                   14-Apr-2024 10:04                7715
function.mkdir.php                                 14-Apr-2024 10:04                8161
function.mktime.php                                14-Apr-2024 10:04                6787
function.money-format.php                          14-Apr-2024 10:04               16073
function.mongodb.bson-fromjson.php                 14-Apr-2024 10:04                5867
function.mongodb.bson-fromphp.php                  14-Apr-2024 10:04                6207
function.mongodb.bson-tocanonicalextendedjson.php  14-Apr-2024 10:04               13906
function.mongodb.bson-tojson.php                   14-Apr-2024 10:04               14979
function.mongodb.bson-tophp.php                    14-Apr-2024 10:04                9098
function.mongodb.bson-torelaxedextendedjson.php    14-Apr-2024 10:04               13603
function.mongodb.driver.monitoring.addsubscribe..> 14-Apr-2024 10:04                5066
function.mongodb.driver.monitoring.removesubscr..> 14-Apr-2024 10:04                4924
function.move-uploaded-file.php                    14-Apr-2024 10:04                8745
function.mqseries-back.php                         14-Apr-2024 10:04                6461
function.mqseries-begin.php                        14-Apr-2024 10:04                7424
function.mqseries-close.php                        14-Apr-2024 10:04                6646
function.mqseries-cmit.php                         14-Apr-2024 10:04                6389
function.mqseries-conn.php                         14-Apr-2024 10:04                5971
function.mqseries-connx.php                        14-Apr-2024 10:04               12673
function.mqseries-disc.php                         14-Apr-2024 10:04                5673
function.mqseries-get.php                          14-Apr-2024 10:04               12291
function.mqseries-inq.php                          14-Apr-2024 10:04                9349
function.mqseries-open.php                         14-Apr-2024 10:04                7282
function.mqseries-put.php                          14-Apr-2024 10:04               12570
function.mqseries-put1.php                         14-Apr-2024 10:04                6317
function.mqseries-set.php                          14-Apr-2024 10:04                6243
function.mqseries-strerror.php                     14-Apr-2024 10:04                4252
function.msg-get-queue.php                         14-Apr-2024 10:04                3474
function.msg-queue-exists.php                      14-Apr-2024 10:04                3423
function.msg-receive.php                           14-Apr-2024 10:04                9563
function.msg-remove-queue.php                      14-Apr-2024 10:04                2781
function.msg-send.php                              14-Apr-2024 10:04                5880
function.msg-set-queue.php                         14-Apr-2024 10:04                3379
function.msg-stat-queue.php                        14-Apr-2024 10:04                4988
function.mt-getrandmax.php                         14-Apr-2024 10:04                3279
function.mt-rand.php                               14-Apr-2024 10:04                9707
function.mt-srand.php                              14-Apr-2024 10:04                8500
function.mysql-affected-rows.php                   14-Apr-2024 10:04               12180
function.mysql-client-encoding.php                 14-Apr-2024 10:04                6342
function.mysql-close.php                           14-Apr-2024 10:04                7532
function.mysql-connect.php                         14-Apr-2024 10:04               17234
function.mysql-create-db.php                       14-Apr-2024 10:04                8488
function.mysql-data-seek.php                       14-Apr-2024 10:04               12005
function.mysql-db-name.php                         14-Apr-2024 10:04                7855
function.mysql-db-query.php                        14-Apr-2024 10:04                9945
function.mysql-drop-db.php                         14-Apr-2024 10:04                7778
function.mysql-errno.php                           14-Apr-2024 10:04                8313
function.mysql-error.php                           14-Apr-2024 10:04                8279
function.mysql-escape-string.php                   14-Apr-2024 10:04                6492
function.mysql-fetch-array.php                     14-Apr-2024 10:04               15720
function.mysql-fetch-assoc.php                     14-Apr-2024 10:04               11486
function.mysql-fetch-field.php                     14-Apr-2024 10:04               13054
function.mysql-fetch-lengths.php                   14-Apr-2024 10:04                7750
function.mysql-fetch-object.php                    14-Apr-2024 10:04               11942
function.mysql-fetch-row.php                       14-Apr-2024 10:04                7799
function.mysql-field-flags.php                     14-Apr-2024 10:04                8719
function.mysql-field-len.php                       14-Apr-2024 10:04                7154
function.mysql-field-name.php                      14-Apr-2024 10:04                9227
function.mysql-field-seek.php                      14-Apr-2024 10:04                5224
function.mysql-field-table.php                     14-Apr-2024 10:04                7762
function.mysql-field-type.php                      14-Apr-2024 10:04               11792
function.mysql-free-result.php                     14-Apr-2024 10:04                7889
function.mysql-get-client-info.php                 14-Apr-2024 10:04                5201
function.mysql-get-host-info.php                   14-Apr-2024 10:04                7142
function.mysql-get-proto-info.php                  14-Apr-2024 10:04                6723
function.mysql-get-server-info.php                 14-Apr-2024 10:04                7199
function.mysql-info.php                            14-Apr-2024 10:04                6444
function.mysql-insert-id.php                       14-Apr-2024 10:04                8384
function.mysql-list-dbs.php                        14-Apr-2024 10:04                8751
function.mysql-list-fields.php                     14-Apr-2024 10:04                8910
function.mysql-list-processes.php                  14-Apr-2024 10:04                7736
function.mysql-list-tables.php                     14-Apr-2024 10:04                9618
function.mysql-num-fields.php                      14-Apr-2024 10:04                6697
function.mysql-num-rows.php                        14-Apr-2024 10:04                8148
function.mysql-pconnect.php                        14-Apr-2024 10:04                8451
function.mysql-ping.php                            14-Apr-2024 10:04                8039
function.mysql-query.php                           14-Apr-2024 10:04               13931
function.mysql-real-escape-string.php              14-Apr-2024 10:04               15421
function.mysql-result.php                          14-Apr-2024 10:04                9648
function.mysql-select-db.php                       14-Apr-2024 10:04                7852
function.mysql-set-charset.php                     14-Apr-2024 10:04                6017
function.mysql-stat.php                            14-Apr-2024 10:04                9419
function.mysql-tablename.php                       14-Apr-2024 10:04                8183
function.mysql-thread-id.php                       14-Apr-2024 10:04                6745
function.mysql-unbuffered-query.php                14-Apr-2024 10:04                7271
function.mysql-xdevapi-expression.php              14-Apr-2024 10:04                4824
function.mysql-xdevapi-getsession.php              14-Apr-2024 10:04               13071
function.mysqli-connect.php                        14-Apr-2024 10:04                2312
function.mysqli-escape-string.php                  14-Apr-2024 10:04                1912
function.mysqli-execute.php                        14-Apr-2024 10:04                2466
function.mysqli-get-client-stats.php               14-Apr-2024 10:04                8332
function.mysqli-get-links-stats.php                14-Apr-2024 10:04                3381
function.mysqli-report.php                         14-Apr-2024 10:04                1714
function.mysqli-set-opt.php                        14-Apr-2024 10:04                1815
function.natcasesort.php                           14-Apr-2024 10:04                5715
function.natsort.php                               14-Apr-2024 10:04                5204
function.net-get-interfaces.php                    14-Apr-2024 10:04                4746
function.next.php                                  14-Apr-2024 10:04                6151
function.ngettext.php                              14-Apr-2024 10:04                5753
function.nl-langinfo.php                           14-Apr-2024 10:04               11124
function.nl2br.php                                 14-Apr-2024 10:04                3850
function.number-format.php                         14-Apr-2024 10:04                7212
function.oauth-get-sbs.php                         14-Apr-2024 10:04                3138
function.oauth-urlencode.php                       14-Apr-2024 10:04                2580
function.ob-clean.php                              14-Apr-2024 10:04                4586
function.ob-end-clean.php                          14-Apr-2024 10:04                5779
function.ob-end-flush.php                          14-Apr-2024 10:04                5640
function.ob-flush.php                              14-Apr-2024 10:04                4689
function.ob-get-clean.php                          14-Apr-2024 10:04                6846
function.ob-get-contents.php                       14-Apr-2024 10:04                4789
function.ob-get-flush.php                          14-Apr-2024 10:04                6632
function.ob-get-length.php                         14-Apr-2024 10:04                4726
function.ob-get-level.php                          14-Apr-2024 10:04                3624
function.ob-get-status.php                         14-Apr-2024 10:04               10063
function.ob-gzhandler.php                          14-Apr-2024 10:04                5898
function.ob-iconv-handler.php                      14-Apr-2024 10:04                5188
function.ob-implicit-flush.php                     14-Apr-2024 10:04                5241
function.ob-list-handlers.php                      14-Apr-2024 10:04               13874
function.ob-start.php                              14-Apr-2024 10:04               15334
function.ob-tidyhandler.php                        14-Apr-2024 10:04                4383
function.oci-bind-array-by-name.php                14-Apr-2024 10:04               13911
function.oci-bind-by-name.php                      14-Apr-2024 10:04               21285
function.oci-cancel.php                            14-Apr-2024 10:04                2727
function.oci-client-version.php                    14-Apr-2024 10:04                4003
function.oci-close.php                             14-Apr-2024 10:04               18568
function.oci-commit.php                            14-Apr-2024 10:04               11017
function.oci-connect.php                           14-Apr-2024 10:04               35294
function.oci-define-by-name.php                    14-Apr-2024 10:04               23867
function.oci-error.php                             14-Apr-2024 10:04               11905
function.oci-execute.php                           14-Apr-2024 10:04               21355
function.oci-fetch-all.php                         14-Apr-2024 10:04               24726
function.oci-fetch-array.php                       14-Apr-2024 10:04               64350
function.oci-fetch-assoc.php                       14-Apr-2024 10:04                8875
function.oci-fetch-object.php                      14-Apr-2024 10:04               18218
function.oci-fetch-row.php                         14-Apr-2024 10:04                8816
function.oci-fetch.php                             14-Apr-2024 10:04               13502
function.oci-field-is-null.php                     14-Apr-2024 10:04                7870
function.oci-field-name.php                        14-Apr-2024 10:04                9798
function.oci-field-precision.php                   14-Apr-2024 10:04                8656
function.oci-field-scale.php                       14-Apr-2024 10:04                8634
function.oci-field-size.php                        14-Apr-2024 10:04               10250
function.oci-field-type-raw.php                    14-Apr-2024 10:04                7910
function.oci-field-type.php                        14-Apr-2024 10:04               10652
function.oci-free-descriptor.php                   14-Apr-2024 10:04                3534
function.oci-free-statement.php                    14-Apr-2024 10:04                2985
function.oci-get-implicit-resultset.php            14-Apr-2024 10:04               28167
function.oci-internal-debug.php                    14-Apr-2024 10:04                3082
function.oci-lob-copy.php                          14-Apr-2024 10:04                4604
function.oci-lob-is-equal.php                      14-Apr-2024 10:04                3275
function.oci-new-collection.php                    14-Apr-2024 10:04                5111
function.oci-new-connect.php                       14-Apr-2024 10:04               16488
function.oci-new-cursor.php                        14-Apr-2024 10:04                7743
function.oci-new-descriptor.php                    14-Apr-2024 10:04               18223
function.oci-num-fields.php                        14-Apr-2024 10:04                6907
function.oci-num-rows.php                          14-Apr-2024 10:04                7922
function.oci-parse.php                             14-Apr-2024 10:04               12549
function.oci-password-change.php                   14-Apr-2024 10:04               13529
function.oci-pconnect.php                          14-Apr-2024 10:04               14889
function.oci-register-taf-callback.php             14-Apr-2024 10:04                5796
function.oci-result.php                            14-Apr-2024 10:04                8602
function.oci-rollback.php                          14-Apr-2024 10:04               14318
function.oci-server-version.php                    14-Apr-2024 10:04                4753
function.oci-set-action.php                        14-Apr-2024 10:04                8508
function.oci-set-call-timout.php                   14-Apr-2024 10:04                5972
function.oci-set-client-identifier.php             14-Apr-2024 10:04                8167
function.oci-set-client-info.php                   14-Apr-2024 10:04                8430
function.oci-set-db-operation.php                  14-Apr-2024 10:04                7838
function.oci-set-edition.php                       14-Apr-2024 10:04                9744
function.oci-set-module-name.php                   14-Apr-2024 10:04                8624
function.oci-set-prefetch-lob.php                  14-Apr-2024 10:04                8873
function.oci-set-prefetch.php                      14-Apr-2024 10:04               20708
function.oci-statement-type.php                    14-Apr-2024 10:04                7044
function.oci-unregister-taf-callback.php           14-Apr-2024 10:04                3647
function.ocibindbyname.php                         14-Apr-2024 10:04                1962
function.ocicancel.php                             14-Apr-2024 10:04                1903
function.ocicloselob.php                           14-Apr-2024 10:04                1903
function.ocicollappend.php                         14-Apr-2024 10:04                1967
function.ocicollassign.php                         14-Apr-2024 10:04                1972
function.ocicollassignelem.php                     14-Apr-2024 10:04                2017
function.ocicollgetelem.php                        14-Apr-2024 10:04                1984
function.ocicollmax.php                            14-Apr-2024 10:04                1936
function.ocicollsize.php                           14-Apr-2024 10:04                1939
function.ocicolltrim.php                           14-Apr-2024 10:04                1949
function.ocicolumnisnull.php                       14-Apr-2024 10:04                1973
function.ocicolumnname.php                         14-Apr-2024 10:04                1965
function.ocicolumnprecision.php                    14-Apr-2024 10:04                2008
function.ocicolumnscale.php                        14-Apr-2024 10:04                1972
function.ocicolumnsize.php                         14-Apr-2024 10:04                1953
function.ocicolumntype.php                         14-Apr-2024 10:04                1957
function.ocicolumntyperaw.php                      14-Apr-2024 10:04                1980
function.ocicommit.php                             14-Apr-2024 10:04                1917
function.ocidefinebyname.php                       14-Apr-2024 10:04                1963
function.ocierror.php                              14-Apr-2024 10:04                1894
function.ociexecute.php                            14-Apr-2024 10:04                1898
function.ocifetch.php                              14-Apr-2024 10:04                1888
function.ocifetchinto.php                          14-Apr-2024 10:04                2635
function.ocifetchstatement.php                     14-Apr-2024 10:04                1981
function.ocifreecollection.php                     14-Apr-2024 10:04                1999
function.ocifreecursor.php                         14-Apr-2024 10:04                1971
function.ocifreedesc.php                           14-Apr-2024 10:04                1915
function.ocifreestatement.php                      14-Apr-2024 10:04                1990
function.ociinternaldebug.php                      14-Apr-2024 10:04                2004
function.ociloadlob.php                            14-Apr-2024 10:04                1900
function.ocilogoff.php                             14-Apr-2024 10:04                1887
function.ocilogon.php                              14-Apr-2024 10:04                1902
function.ocinewcollection.php                      14-Apr-2024 10:04                1988
function.ocinewcursor.php                          14-Apr-2024 10:04                1956
function.ocinewdescriptor.php                      14-Apr-2024 10:04                1978
function.ocinlogon.php                             14-Apr-2024 10:04                1927
function.ocinumcols.php                            14-Apr-2024 10:04                1912
function.ociparse.php                              14-Apr-2024 10:04                1882
function.ociplogon.php                             14-Apr-2024 10:04                1897
function.ociresult.php                             14-Apr-2024 10:04                1895
function.ocirollback.php                           14-Apr-2024 10:04                1917
function.ocirowcount.php                           14-Apr-2024 10:04                1919
function.ocisavelob.php                            14-Apr-2024 10:04                1900
function.ocisavelobfile.php                        14-Apr-2024 10:04                1938
function.ociserverversion.php                      14-Apr-2024 10:04                1992
function.ocisetprefetch.php                        14-Apr-2024 10:04                1978
function.ocistatementtype.php                      14-Apr-2024 10:04                1998
function.ociwritelobtofile.php                     14-Apr-2024 10:04                1979
function.ociwritetemporarylob.php                  14-Apr-2024 10:04                2003
function.octdec.php                                14-Apr-2024 10:04                3713
function.odbc-autocommit.php                       14-Apr-2024 10:04                4710
function.odbc-binmode.php                          14-Apr-2024 10:04                5402
function.odbc-close-all.php                        14-Apr-2024 10:04                2155
function.odbc-close.php                            14-Apr-2024 10:04                2357
function.odbc-columnprivileges.php                 14-Apr-2024 10:04                4211
function.odbc-columns.php                          14-Apr-2024 10:04                4875
function.odbc-commit.php                           14-Apr-2024 10:04                2336
function.odbc-connect.php                          14-Apr-2024 10:04                4661
function.odbc-connection-string-is-quoted.php      14-Apr-2024 10:04                3692
function.odbc-connection-string-quote.php          14-Apr-2024 10:04                5747
function.odbc-connection-string-should-quote.php   14-Apr-2024 10:04                3956
function.odbc-cursor.php                           14-Apr-2024 10:04                2029
function.odbc-data-source.php                      14-Apr-2024 10:04                2819
function.odbc-do.php                               14-Apr-2024 10:04                2220
function.odbc-error.php                            14-Apr-2024 10:04                3716
function.odbc-errormsg.php                         14-Apr-2024 10:04                3762
function.odbc-exec.php                             14-Apr-2024 10:04                3339
function.odbc-execute.php                          14-Apr-2024 10:04                7250
function.odbc-fetch-array.php                      14-Apr-2024 10:04                4284
function.odbc-fetch-into.php                       14-Apr-2024 10:04                9151
function.odbc-fetch-object.php                     14-Apr-2024 10:04                4235
function.odbc-fetch-row.php                        14-Apr-2024 10:04                4121
function.odbc-field-len.php                        14-Apr-2024 10:04                2637
function.odbc-field-name.php                       14-Apr-2024 10:04                2470
function.odbc-field-num.php                        14-Apr-2024 10:04                2508
function.odbc-field-precision.php                  14-Apr-2024 10:04                2716
function.odbc-field-scale.php                      14-Apr-2024 10:04                2382
function.odbc-field-type.php                       14-Apr-2024 10:04                2393
function.odbc-foreignkeys.php                      14-Apr-2024 10:04                6057
function.odbc-free-result.php                      14-Apr-2024 10:04                3208
function.odbc-gettypeinfo.php                      14-Apr-2024 10:04                4034
function.odbc-longreadlen.php                      14-Apr-2024 10:04                2674
function.odbc-next-result.php                      14-Apr-2024 10:04                2213
function.odbc-num-fields.php                       14-Apr-2024 10:04                2408
function.odbc-num-rows.php                         14-Apr-2024 10:04                2597
function.odbc-pconnect.php                         14-Apr-2024 10:04                4010
function.odbc-prepare.php                          14-Apr-2024 10:04                6510
function.odbc-primarykeys.php                      14-Apr-2024 10:04                3572
function.odbc-procedurecolumns.php                 14-Apr-2024 10:04                4793
function.odbc-procedures.php                       14-Apr-2024 10:04                3976
function.odbc-result-all.php                       14-Apr-2024 10:04                2813
function.odbc-result.php                           14-Apr-2024 10:04                4354
function.odbc-rollback.php                         14-Apr-2024 10:04                2251
function.odbc-setoption.php                        14-Apr-2024 10:04                7427
function.odbc-specialcolumns.php                   14-Apr-2024 10:04                6519
function.odbc-statistics.php                       14-Apr-2024 10:04                5689
function.odbc-tableprivileges.php                  14-Apr-2024 10:04                4919
function.odbc-tables.php                           14-Apr-2024 10:04                7908
function.opcache-compile-file.php                  14-Apr-2024 10:04                3860
function.opcache-get-configuration.php             14-Apr-2024 10:04                3287
function.opcache-get-status.php                    14-Apr-2024 10:04                3837
function.opcache-invalidate.php                    14-Apr-2024 10:04                4379
function.opcache-is-script-cached.php              14-Apr-2024 10:04                3433
function.opcache-reset.php                         14-Apr-2024 10:04                3378
function.openal-buffer-create.php                  14-Apr-2024 10:04                2868
function.openal-buffer-data.php                    14-Apr-2024 10:04                5005
function.openal-buffer-destroy.php                 14-Apr-2024 10:04                3200
function.openal-buffer-get.php                     14-Apr-2024 10:04                3989
function.openal-buffer-loadwav.php                 14-Apr-2024 10:04                3741
function.openal-context-create.php                 14-Apr-2024 10:04                3385
function.openal-context-current.php                14-Apr-2024 10:04                3255
function.openal-context-destroy.php                14-Apr-2024 10:04                3241
function.openal-context-process.php                14-Apr-2024 10:04                3629
function.openal-context-suspend.php                14-Apr-2024 10:04                3623
function.openal-device-close.php                   14-Apr-2024 10:04                3207
function.openal-device-open.php                    14-Apr-2024 10:04                3378
function.openal-listener-get.php                   14-Apr-2024 10:04                3425
function.openal-listener-set.php                   14-Apr-2024 10:04                3836
function.openal-source-create.php                  14-Apr-2024 10:04                3062
function.openal-source-destroy.php                 14-Apr-2024 10:04                3208
function.openal-source-get.php                     14-Apr-2024 10:04                5616
function.openal-source-pause.php                   14-Apr-2024 10:04                3509
function.openal-source-play.php                    14-Apr-2024 10:04                3508
function.openal-source-rewind.php                  14-Apr-2024 10:04                3518
function.openal-source-set.php                     14-Apr-2024 10:04                6367
function.openal-source-stop.php                    14-Apr-2024 10:04                3490
function.openal-stream.php                         14-Apr-2024 10:04                4451
function.opendir.php                               14-Apr-2024 10:04                8376
function.openlog.php                               14-Apr-2024 10:04                6929
function.openssl-cipher-iv-length.php              14-Apr-2024 10:04                4511
function.openssl-cipher-key-length.php             14-Apr-2024 10:04                4433
function.openssl-cms-decrypt.php                   14-Apr-2024 10:04                5533
function.openssl-cms-encrypt.php                   14-Apr-2024 10:04                6717
function.openssl-cms-read.php                      14-Apr-2024 10:04                3300
function.openssl-cms-sign.php                      14-Apr-2024 10:04                8277
function.openssl-cms-verify.php                    14-Apr-2024 10:04                7468
function.openssl-csr-export-to-file.php            14-Apr-2024 10:04                8608
function.openssl-csr-export.php                    14-Apr-2024 10:04                8535
function.openssl-csr-get-public-key.php            14-Apr-2024 10:04                8835
function.openssl-csr-get-subject.php               14-Apr-2024 10:04                9594
function.openssl-csr-new.php                       14-Apr-2024 10:04               22065
function.openssl-csr-sign.php                      14-Apr-2024 10:04               13536
function.openssl-decrypt.php                       14-Apr-2024 10:04                8020
function.openssl-dh-compute-key.php                14-Apr-2024 10:04               16409
function.openssl-digest.php                        14-Apr-2024 10:04                4649
function.openssl-encrypt.php                       14-Apr-2024 10:04               18221
function.openssl-error-string.php                  14-Apr-2024 10:04                3806
function.openssl-free-key.php                      14-Apr-2024 10:04                3772
function.openssl-get-cert-locations.php            14-Apr-2024 10:04                4065
function.openssl-get-cipher-methods.php            14-Apr-2024 10:04               14137
function.openssl-get-curve-names.php               14-Apr-2024 10:04                7185
function.openssl-get-md-methods.php                14-Apr-2024 10:04                7075
function.openssl-get-privatekey.php                14-Apr-2024 10:04                1873
function.openssl-get-publickey.php                 14-Apr-2024 10:04                1844
function.openssl-open.php                          14-Apr-2024 10:04               10244
function.openssl-pbkdf2.php                        14-Apr-2024 10:04                7541
function.openssl-pkcs12-export-to-file.php         14-Apr-2024 10:04                7535
function.openssl-pkcs12-export.php                 14-Apr-2024 10:04                7533
function.openssl-pkcs12-read.php                   14-Apr-2024 10:04                5653
function.openssl-pkcs7-decrypt.php                 14-Apr-2024 10:04                7722
function.openssl-pkcs7-encrypt.php                 14-Apr-2024 10:04               10824
function.openssl-pkcs7-read.php                    14-Apr-2024 10:04                6978
function.openssl-pkcs7-sign.php                    14-Apr-2024 10:04               12098
function.openssl-pkcs7-verify.php                  14-Apr-2024 10:04                8456
function.openssl-pkey-derive.php                   14-Apr-2024 10:04                8124
function.openssl-pkey-export-to-file.php           14-Apr-2024 10:04                6668
function.openssl-pkey-export.php                   14-Apr-2024 10:04                6531
function.openssl-pkey-free.php                     14-Apr-2024 10:04                4004
function.openssl-pkey-get-details.php              14-Apr-2024 10:04                9698
function.openssl-pkey-get-private.php              14-Apr-2024 10:04                6126
function.openssl-pkey-get-public.php               14-Apr-2024 10:04                5541
function.openssl-pkey-new.php                      14-Apr-2024 10:04                7075
function.openssl-private-decrypt.php               14-Apr-2024 10:04                6899
function.openssl-private-encrypt.php               14-Apr-2024 10:04                6592
function.openssl-public-decrypt.php                14-Apr-2024 10:04                6646
function.openssl-public-encrypt.php                14-Apr-2024 10:04                6983
function.openssl-random-pseudo-bytes.php           14-Apr-2024 10:04                9410
function.openssl-seal.php                          14-Apr-2024 10:04               11452
function.openssl-sign.php                          14-Apr-2024 10:04               12813
function.openssl-spki-export-challenge.php         14-Apr-2024 10:04                7601
function.openssl-spki-export.php                   14-Apr-2024 10:04                8410
function.openssl-spki-new.php                      14-Apr-2024 10:04                9218
function.openssl-spki-verify.php                   14-Apr-2024 10:04                7790
function.openssl-verify.php                        14-Apr-2024 10:04               13387
function.openssl-x509-check-private-key.php        14-Apr-2024 10:04                5886
function.openssl-x509-checkpurpose.php             14-Apr-2024 10:04                7505
function.openssl-x509-export-to-file.php           14-Apr-2024 10:04                5213
function.openssl-x509-export.php                   14-Apr-2024 10:04                5175
function.openssl-x509-fingerprint.php              14-Apr-2024 10:04                5441
function.openssl-x509-free.php                     14-Apr-2024 10:04                4029
function.openssl-x509-parse.php                    14-Apr-2024 10:04                4809
function.openssl-x509-read.php                     14-Apr-2024 10:04                4552
function.openssl-x509-verify.php                   14-Apr-2024 10:04               12514
function.ord.php                                   14-Apr-2024 10:04                3318
function.output-add-rewrite-var.php                14-Apr-2024 10:04                9485
function.output-reset-rewrite-vars.php             14-Apr-2024 10:04                6666
function.pack.php                                  14-Apr-2024 10:04               12637
function.parse-ini-file.php                        14-Apr-2024 10:04               18314
function.parse-ini-string.php                      14-Apr-2024 10:04                7571
function.parse-str.php                             14-Apr-2024 10:04                6510
function.parse-url.php                             14-Apr-2024 10:04               16859
function.passthru.php                              14-Apr-2024 10:04                5792
function.password-algos.php                        14-Apr-2024 10:04                3377
function.password-get-info.php                     14-Apr-2024 10:04                3523
function.password-hash.php                         14-Apr-2024 10:04               22996
function.password-needs-rehash.php                 14-Apr-2024 10:04                8391
function.password-verify.php                       14-Apr-2024 10:04                6755
function.pathinfo.php                              14-Apr-2024 10:04                5804
function.pclose.php                                14-Apr-2024 10:04                2474
function.pcntl-alarm.php                           14-Apr-2024 10:04                2957
function.pcntl-async-signals.php                   14-Apr-2024 10:04                4230
function.pcntl-errno.php                           14-Apr-2024 10:04                1736
function.pcntl-exec.php                            14-Apr-2024 10:04                3809
function.pcntl-fork.php                            14-Apr-2024 10:04                5010
function.pcntl-get-last-error.php                  14-Apr-2024 10:04                2777
function.pcntl-getpriority.php                     14-Apr-2024 10:04                5870
function.pcntl-rfork.php                           14-Apr-2024 10:04                7671
function.pcntl-setpriority.php                     14-Apr-2024 10:04                5738
function.pcntl-signal-dispatch.php                 14-Apr-2024 10:04                5673
function.pcntl-signal-get-handler.php              14-Apr-2024 10:04                6792
function.pcntl-signal.php                          14-Apr-2024 10:04               11311
function.pcntl-sigprocmask.php                     14-Apr-2024 10:04                6121
function.pcntl-sigtimedwait.php                    14-Apr-2024 10:04                5164
function.pcntl-sigwaitinfo.php                     14-Apr-2024 10:04                7521
function.pcntl-strerror.php                        14-Apr-2024 10:04                2978
function.pcntl-unshare.php                         14-Apr-2024 10:04                4625
function.pcntl-wait.php                            14-Apr-2024 10:04                7969
function.pcntl-waitpid.php                         14-Apr-2024 10:04                9416
function.pcntl-wexitstatus.php                     14-Apr-2024 10:04                3770
function.pcntl-wifexited.php                       14-Apr-2024 10:04                3492
function.pcntl-wifsignaled.php                     14-Apr-2024 10:04                3544
function.pcntl-wifstopped.php                      14-Apr-2024 10:04                3560
function.pcntl-wstopsig.php                        14-Apr-2024 10:04                3775
function.pcntl-wtermsig.php                        14-Apr-2024 10:04                3950
function.pfsockopen.php                            14-Apr-2024 10:04                3201
function.pg-affected-rows.php                      14-Apr-2024 10:04                3962
function.pg-cancel-query.php                       14-Apr-2024 10:04                2610
function.pg-client-encoding.php                    14-Apr-2024 10:04                3326
function.pg-close.php                              14-Apr-2024 10:04                2886
function.pg-connect-poll.php                       14-Apr-2024 10:04                4145
function.pg-connect.php                            14-Apr-2024 10:04                6577
function.pg-connection-busy.php                    14-Apr-2024 10:04                2699
function.pg-connection-reset.php                   14-Apr-2024 10:04                2760
function.pg-connection-status.php                  14-Apr-2024 10:04                2431
function.pg-consume-input.php                      14-Apr-2024 10:04                3685
function.pg-convert.php                            14-Apr-2024 10:04                3104
function.pg-copy-from.php                          14-Apr-2024 10:04                3474
function.pg-copy-to.php                            14-Apr-2024 10:04                3112
function.pg-dbname.php                             14-Apr-2024 10:04                2249
function.pg-delete.php                             14-Apr-2024 10:04                4862
function.pg-end-copy.php                           14-Apr-2024 10:04                2923
function.pg-escape-bytea.php                       14-Apr-2024 10:04                3511
function.pg-escape-identifier.php                  14-Apr-2024 10:04                7875
function.pg-escape-literal.php                     14-Apr-2024 10:04                8240
function.pg-escape-string.php                      14-Apr-2024 10:04                2683
function.pg-execute.php                            14-Apr-2024 10:04               10386
function.pg-fetch-all-columns.php                  14-Apr-2024 10:04                7096
function.pg-fetch-all.php                          14-Apr-2024 10:04                4905
function.pg-fetch-array.php                        14-Apr-2024 10:04                8261
function.pg-fetch-assoc.php                        14-Apr-2024 10:04                8642
function.pg-fetch-object.php                       14-Apr-2024 10:04               11555
function.pg-fetch-result.php                       14-Apr-2024 10:04                3892
function.pg-fetch-row.php                          14-Apr-2024 10:04                6079
function.pg-field-is-null.php                      14-Apr-2024 10:04                3151
function.pg-field-name.php                         14-Apr-2024 10:04                2746
function.pg-field-num.php                          14-Apr-2024 10:04                2814
function.pg-field-prtlen.php                       14-Apr-2024 10:04                2973
function.pg-field-size.php                         14-Apr-2024 10:04                3068
function.pg-field-table.php                        14-Apr-2024 10:04                8718
function.pg-field-type-oid.php                     14-Apr-2024 10:04                7519
function.pg-field-type.php                         14-Apr-2024 10:04                2914
function.pg-flush.php                              14-Apr-2024 10:04                3697
function.pg-free-result.php                        14-Apr-2024 10:04                3121
function.pg-get-notify.php                         14-Apr-2024 10:04                6950
function.pg-get-pid.php                            14-Apr-2024 10:04                4469
function.pg-get-result.php                         14-Apr-2024 10:04                2684
function.pg-host.php                               14-Apr-2024 10:04                2347
function.pg-insert.php                             14-Apr-2024 10:04                4818
function.pg-last-error.php                         14-Apr-2024 10:04                3273
function.pg-last-notice.php                        14-Apr-2024 10:04                4199
function.pg-last-oid.php                           14-Apr-2024 10:04                3559
function.pg-lo-close.php                           14-Apr-2024 10:04                2909
function.pg-lo-create.php                          14-Apr-2024 10:04                3172
function.pg-lo-export.php                          14-Apr-2024 10:04                3223
function.pg-lo-import.php                          14-Apr-2024 10:04                6716
function.pg-lo-open.php                            14-Apr-2024 10:04                3546
function.pg-lo-read-all.php                        14-Apr-2024 10:04                2890
function.pg-lo-read.php                            14-Apr-2024 10:04                3080
function.pg-lo-seek.php                            14-Apr-2024 10:04                2621
function.pg-lo-tell.php                            14-Apr-2024 10:04                2223
function.pg-lo-truncate.php                        14-Apr-2024 10:04                6677
function.pg-lo-unlink.php                          14-Apr-2024 10:04                3057
function.pg-lo-write.php                           14-Apr-2024 10:04                3185
function.pg-meta-data.php                          14-Apr-2024 10:04                2713
function.pg-num-fields.php                         14-Apr-2024 10:04                2760
function.pg-num-rows.php                           14-Apr-2024 10:04                3103
function.pg-options.php                            14-Apr-2024 10:04                2115
function.pg-parameter-status.php                   14-Apr-2024 10:04                8516
function.pg-pconnect.php                           14-Apr-2024 10:04                3692
function.pg-ping.php                               14-Apr-2024 10:04                5001
function.pg-port.php                               14-Apr-2024 10:04                2073
function.pg-prepare.php                            14-Apr-2024 10:04               10349
function.pg-put-line.php                           14-Apr-2024 10:04                5288
function.pg-query-params.php                       14-Apr-2024 10:04               10835
function.pg-query.php                              14-Apr-2024 10:04                5396
function.pg-result-error-field.php                 14-Apr-2024 10:04                9754
function.pg-result-error.php                       14-Apr-2024 10:04                2968
function.pg-result-seek.php                        14-Apr-2024 10:04                6645
function.pg-result-status.php                      14-Apr-2024 10:04                2449
function.pg-select.php                             14-Apr-2024 10:04                5137
function.pg-send-execute.php                       14-Apr-2024 10:04               10444
function.pg-send-prepare.php                       14-Apr-2024 10:04               10901
function.pg-send-query-params.php                  14-Apr-2024 10:04                8130
function.pg-send-query.php                         14-Apr-2024 10:04                4280
function.pg-set-client-encoding.php                14-Apr-2024 10:04                3522
function.pg-set-error-context-visibility.php       14-Apr-2024 10:04                7048
function.pg-set-error-verbosity.php                14-Apr-2024 10:04                9018
function.pg-socket.php                             14-Apr-2024 10:04                3850
function.pg-trace.php                              14-Apr-2024 10:04                4338
function.pg-transaction-status.php                 14-Apr-2024 10:04                6667
function.pg-tty.php                                14-Apr-2024 10:04                2145
function.pg-unescape-bytea.php                     14-Apr-2024 10:04                7086
function.pg-untrace.php                            14-Apr-2024 10:04                2528
function.pg-update.php                             14-Apr-2024 10:04                5488
function.pg-version.php                            14-Apr-2024 10:04                6582
function.php-ini-loaded-file.php                   14-Apr-2024 10:04                4615
function.php-ini-scanned-files.php                 14-Apr-2024 10:04                5221
function.php-sapi-name.php                         14-Apr-2024 10:04                3415
function.php-strip-whitespace.php                  14-Apr-2024 10:04                4679
function.php-uname.php                             14-Apr-2024 10:04                7960
function.phpcredits.php                            14-Apr-2024 10:04                8321
function.phpdbg-break-file.php                     14-Apr-2024 10:04                3733
function.phpdbg-break-function.php                 14-Apr-2024 10:04                3470
function.phpdbg-break-method.php                   14-Apr-2024 10:04                3804
function.phpdbg-break-next.php                     14-Apr-2024 10:04                3114
function.phpdbg-clear.php                          14-Apr-2024 10:04                3391
function.phpdbg-color.php                          14-Apr-2024 10:04                3670
function.phpdbg-end-oplog.php                      14-Apr-2024 10:04                2624
function.phpdbg-exec.php                           14-Apr-2024 10:04                3114
function.phpdbg-get-executable.php                 14-Apr-2024 10:04                2567
function.phpdbg-prompt.php                         14-Apr-2024 10:04                2813
function.phpdbg-start-oplog.php                    14-Apr-2024 10:04                2282
function.phpinfo.php                               14-Apr-2024 10:04                8107
function.phpversion.php                            14-Apr-2024 10:04                3373
function.pi.php                                    14-Apr-2024 10:04                2984
function.png2wbmp.php                              14-Apr-2024 10:04                6656
function.popen.php                                 14-Apr-2024 10:04                8499
function.pos.php                                   14-Apr-2024 10:04                1580
function.posix-access.php                          14-Apr-2024 10:04                6746
function.posix-ctermid.php                         14-Apr-2024 10:04                1937
function.posix-eaccess.php                         14-Apr-2024 10:04                7548
function.posix-errno.php                           14-Apr-2024 10:04                1742
function.posix-fpathconf.php                       14-Apr-2024 10:04                7014
function.posix-get-last-error.php                  14-Apr-2024 10:04                2366
function.posix-getcwd.php                          14-Apr-2024 10:04                2101
function.posix-getegid.php                         14-Apr-2024 10:04                2046
function.posix-geteuid.php                         14-Apr-2024 10:04                2067
function.posix-getgid.php                          14-Apr-2024 10:04                2036
function.posix-getgrgid.php                        14-Apr-2024 10:04                6352
function.posix-getgrnam.php                        14-Apr-2024 10:04                2127
function.posix-getgroups.php                       14-Apr-2024 10:04                2091
function.posix-getlogin.php                        14-Apr-2024 10:04                2026
function.posix-getpgid.php                         14-Apr-2024 10:04                2344
function.posix-getpgrp.php                         14-Apr-2024 10:04                2020
function.posix-getpid.php                          14-Apr-2024 10:04                1786
function.posix-getppid.php                         14-Apr-2024 10:04                1818
function.posix-getpwnam.php                        14-Apr-2024 10:04                4657
function.posix-getpwuid.php                        14-Apr-2024 10:04                4664
function.posix-getrlimit.php                       14-Apr-2024 10:04                1975
function.posix-getsid.php                          14-Apr-2024 10:04                2409
function.posix-getuid.php                          14-Apr-2024 10:04                2053
function.posix-initgroups.php                      14-Apr-2024 10:04                3302
function.posix-isatty.php                          14-Apr-2024 10:04                2106
function.posix-kill.php                            14-Apr-2024 10:04                2634
function.posix-mkfifo.php                          14-Apr-2024 10:04                3548
function.posix-mknod.php                           14-Apr-2024 10:04                7476
function.posix-pathconf.php                        14-Apr-2024 10:04                6384
function.posix-setegid.php                         14-Apr-2024 10:04                2413
function.posix-seteuid.php                         14-Apr-2024 10:04                2539
function.posix-setgid.php                          14-Apr-2024 10:04                2608
function.posix-setpgid.php                         14-Apr-2024 10:04                2631
function.posix-setrlimit.php                       14-Apr-2024 10:04                4624
function.posix-setsid.php                          14-Apr-2024 10:04                2009
function.posix-setuid.php                          14-Apr-2024 10:04                2530
function.posix-strerror.php                        14-Apr-2024 10:04                2527
function.posix-sysconf.php                         14-Apr-2024 10:04                4025
function.posix-times.php                           14-Apr-2024 10:04                2781
function.posix-ttyname.php                         14-Apr-2024 10:04                2093
function.posix-uname.php                           14-Apr-2024 10:04                3074
function.pow.php                                   14-Apr-2024 10:04                5222
function.preg-filter.php                           14-Apr-2024 10:04               10314
function.preg-grep.php                             14-Apr-2024 10:04                4371
function.preg-last-error-msg.php                   14-Apr-2024 10:04                4045
function.preg-last-error.php                       14-Apr-2024 10:04                5113
function.preg-match-all.php                        14-Apr-2024 10:04               16865
function.preg-match.php                            14-Apr-2024 10:04               11531
function.preg-quote.php                            14-Apr-2024 10:04                6136
function.preg-replace-callback-array.php           14-Apr-2024 10:04               10564
function.preg-replace-callback.php                 14-Apr-2024 10:04               16807
function.preg-replace.php                          14-Apr-2024 10:04               20960
function.preg-split.php                            14-Apr-2024 10:04                9410
function.prev.php                                  14-Apr-2024 10:04                5636
function.print-r.php                               14-Apr-2024 10:04                9250
function.print.php                                 14-Apr-2024 10:04                7570
function.printf.php                                14-Apr-2024 10:04                3208
function.proc-close.php                            14-Apr-2024 10:04                3665
function.proc-get-status.php                       14-Apr-2024 10:04                6799
function.proc-nice.php                             14-Apr-2024 10:04                7715
function.proc-open.php                             14-Apr-2024 10:04               22350
function.proc-terminate.php                        14-Apr-2024 10:04                4736
function.property-exists.php                       14-Apr-2024 10:04                8545
function.ps-add-bookmark.php                       14-Apr-2024 10:04                5105
function.ps-add-launchlink.php                     14-Apr-2024 10:04                5827
function.ps-add-locallink.php                      14-Apr-2024 10:04                6611
function.ps-add-note.php                           14-Apr-2024 10:04                7337
function.ps-add-pdflink.php                        14-Apr-2024 10:04                6984
function.ps-add-weblink.php                        14-Apr-2024 10:04                5913
function.ps-arc.php                                14-Apr-2024 10:04                5323
function.ps-arcn.php                               14-Apr-2024 10:04                5329
function.ps-begin-page.php                         14-Apr-2024 10:04                6984
function.ps-begin-pattern.php                      14-Apr-2024 10:04               13406
function.ps-begin-template.php                     14-Apr-2024 10:04               11400
function.ps-circle.php                             14-Apr-2024 10:04                4842
function.ps-clip.php                               14-Apr-2024 10:04                3121
function.ps-close-image.php                        14-Apr-2024 10:04                4006
function.ps-close.php                              14-Apr-2024 10:04                3759
function.ps-closepath-stroke.php                   14-Apr-2024 10:04                3194
function.ps-closepath.php                          14-Apr-2024 10:04                3355
function.ps-continue-text.php                      14-Apr-2024 10:04                4167
function.ps-curveto.php                            14-Apr-2024 10:04                5198
function.ps-delete.php                             14-Apr-2024 10:04                3638
function.ps-end-page.php                           14-Apr-2024 10:04                3364
function.ps-end-pattern.php                        14-Apr-2024 10:04                3295
function.ps-end-template.php                       14-Apr-2024 10:04                3302
function.ps-fill-stroke.php                        14-Apr-2024 10:04                3400
function.ps-fill.php                               14-Apr-2024 10:04                3333
function.ps-findfont.php                           14-Apr-2024 10:04                7202
function.ps-get-buffer.php                         14-Apr-2024 10:04                3255
function.ps-get-parameter.php                      14-Apr-2024 10:04                7974
function.ps-get-value.php                          14-Apr-2024 10:04                9485
function.ps-hyphenate.php                          14-Apr-2024 10:04                7275
function.ps-include-file.php                       14-Apr-2024 10:04                3215
function.ps-lineto.php                             14-Apr-2024 10:04                8316
function.ps-makespotcolor.php                      14-Apr-2024 10:04               10218
function.ps-moveto.php                             14-Apr-2024 10:04                3932
function.ps-new.php                                14-Apr-2024 10:04                3050
function.ps-open-file.php                          14-Apr-2024 10:04                3773
function.ps-open-image-file.php                    14-Apr-2024 10:04                4977
function.ps-open-image.php                         14-Apr-2024 10:04                7064
function.ps-open-memory-image.php                  14-Apr-2024 10:04                2882
function.ps-place-image.php                        14-Apr-2024 10:04                5333
function.ps-rect.php                               14-Apr-2024 10:04                5053
function.ps-restore.php                            14-Apr-2024 10:04                3477
function.ps-rotate.php                             14-Apr-2024 10:04               12187
function.ps-save.php                               14-Apr-2024 10:04                3224
function.ps-scale.php                              14-Apr-2024 10:04                3841
function.ps-set-border-color.php                   14-Apr-2024 10:04                4959
function.ps-set-border-dash.php                    14-Apr-2024 10:04                4547
function.ps-set-border-style.php                   14-Apr-2024 10:04                4611
function.ps-set-info.php                           14-Apr-2024 10:04                6083
function.ps-set-parameter.php                      14-Apr-2024 10:04                4021
function.ps-set-text-pos.php                       14-Apr-2024 10:04                9393
function.ps-set-value.php                          14-Apr-2024 10:04                4833
function.ps-setcolor.php                           14-Apr-2024 10:04                6035
function.ps-setdash.php                            14-Apr-2024 10:04                3728
function.ps-setflat.php                            14-Apr-2024 10:04                3202
function.ps-setfont.php                            14-Apr-2024 10:04                4146
function.ps-setgray.php                            14-Apr-2024 10:04                3401
function.ps-setlinecap.php                         14-Apr-2024 10:04                3927
function.ps-setlinejoin.php                        14-Apr-2024 10:04                3945
function.ps-setlinewidth.php                       14-Apr-2024 10:04                3809
function.ps-setmiterlimit.php                      14-Apr-2024 10:04                4229
function.ps-setoverprintmode.php                   14-Apr-2024 10:04                3239
function.ps-setpolydash.php                        14-Apr-2024 10:04                7812
function.ps-shading-pattern.php                    14-Apr-2024 10:04                4325
function.ps-shading.php                            14-Apr-2024 10:04                7260
function.ps-shfill.php                             14-Apr-2024 10:04                4050
function.ps-show-boxed.php                         14-Apr-2024 10:04               12813
function.ps-show-xy.php                            14-Apr-2024 10:04                4329
function.ps-show-xy2.php                           14-Apr-2024 10:04                3202
function.ps-show.php                               14-Apr-2024 10:04                5834
function.ps-show2.php                              14-Apr-2024 10:04                3393
function.ps-string-geometry.php                    14-Apr-2024 10:04                4924
function.ps-stringwidth.php                        14-Apr-2024 10:04                4401
function.ps-stroke.php                             14-Apr-2024 10:04                3530
function.ps-symbol-name.php                        14-Apr-2024 10:04                3929
function.ps-symbol-width.php                       14-Apr-2024 10:04                4473
function.ps-symbol.php                             14-Apr-2024 10:04                3796
function.ps-translate.php                          14-Apr-2024 10:04               14206
function.pspell-add-to-personal.php                14-Apr-2024 10:04                6448
function.pspell-add-to-session.php                 14-Apr-2024 10:04                4106
function.pspell-check.php                          14-Apr-2024 10:04                5013
function.pspell-clear-session.php                  14-Apr-2024 10:04                5862
function.pspell-config-create.php                  14-Apr-2024 10:04                8025
function.pspell-config-data-dir.php                14-Apr-2024 10:04                3419
function.pspell-config-dict-dir.php                14-Apr-2024 10:04                3418
function.pspell-config-ignore.php                  14-Apr-2024 10:04                5746
function.pspell-config-mode.php                    14-Apr-2024 10:04                6590
function.pspell-config-personal.php                14-Apr-2024 10:04                6532
function.pspell-config-repl.php                    14-Apr-2024 10:04                6835
function.pspell-config-runtogether.php             14-Apr-2024 10:04                6399
function.pspell-config-save-repl.php               14-Apr-2024 10:04                5338
function.pspell-new-config.php                     14-Apr-2024 10:04                6372
function.pspell-new-personal.php                   14-Apr-2024 10:04               10968
function.pspell-new.php                            14-Apr-2024 10:04                9501
function.pspell-save-wordlist.php                  14-Apr-2024 10:04                6054
function.pspell-store-replacement.php              14-Apr-2024 10:04                7729
function.pspell-suggest.php                        14-Apr-2024 10:04                5549
function.putenv.php                                14-Apr-2024 10:04                4124
function.quoted-printable-decode.php               14-Apr-2024 10:04                2690
function.quoted-printable-encode.php               14-Apr-2024 10:04                5063
function.quotemeta.php                             14-Apr-2024 10:04                2870
function.rad2deg.php                               14-Apr-2024 10:04                2744
function.radius-acct-open.php                      14-Apr-2024 10:04                3217
function.radius-add-server.php                     14-Apr-2024 10:04                7785
function.radius-auth-open.php                      14-Apr-2024 10:04                3228
function.radius-close.php                          14-Apr-2024 10:04                2672
function.radius-config.php                         14-Apr-2024 10:04                4090
function.radius-create-request.php                 14-Apr-2024 10:04                5336
function.radius-cvt-addr.php                       14-Apr-2024 10:04                6192
function.radius-cvt-int.php                        14-Apr-2024 10:04                5592
function.radius-cvt-string.php                     14-Apr-2024 10:04                5646
function.radius-demangle-mppe-key.php              14-Apr-2024 10:04                3226
function.radius-demangle.php                       14-Apr-2024 10:04                2957
function.radius-get-attr.php                       14-Apr-2024 10:04                6446
function.radius-get-tagged-attr-data.php           14-Apr-2024 10:04                6543
function.radius-get-tagged-attr-tag.php            14-Apr-2024 10:04                6596
function.radius-get-vendor-attr.php                14-Apr-2024 10:04                8187
function.radius-put-addr.php                       14-Apr-2024 10:04                5630
function.radius-put-attr.php                       14-Apr-2024 10:04                8865
function.radius-put-int.php                        14-Apr-2024 10:04                7602
function.radius-put-string.php                     14-Apr-2024 10:04                7982
function.radius-put-vendor-addr.php                14-Apr-2024 10:04                5579
function.radius-put-vendor-attr.php                14-Apr-2024 10:04                7844
function.radius-put-vendor-int.php                 14-Apr-2024 10:04                6358
function.radius-put-vendor-string.php              14-Apr-2024 10:04                6751
function.radius-request-authenticator.php          14-Apr-2024 10:04                3155
function.radius-salt-encrypt-attr.php              14-Apr-2024 10:04                4252
function.radius-send-request.php                   14-Apr-2024 10:04                3995
function.radius-server-secret.php                  14-Apr-2024 10:04                2685
function.radius-strerror.php                       14-Apr-2024 10:04                2590
function.rand.php                                  14-Apr-2024 10:04                9588
function.random-bytes.php                          14-Apr-2024 10:04                9563
function.random-int.php                            14-Apr-2024 10:04                9440
function.range.php                                 14-Apr-2024 10:04                7269
function.rar-wrapper-cache-stats.php               14-Apr-2024 10:04                2348
function.rawurldecode.php                          14-Apr-2024 10:04                4571
function.rawurlencode.php                          14-Apr-2024 10:04                6214
function.read-exif-data.php                        14-Apr-2024 10:04                2428
function.readdir.php                               14-Apr-2024 10:04                7709
function.readfile.php                              14-Apr-2024 10:04                4419
function.readgzfile.php                            14-Apr-2024 10:04                4538
function.readline-add-history.php                  14-Apr-2024 10:04                2784
function.readline-callback-handler-install.php     14-Apr-2024 10:04                9427
function.readline-callback-handler-remove.php      14-Apr-2024 10:04                3880
function.readline-callback-read-char.php           14-Apr-2024 10:04                3805
function.readline-clear-history.php                14-Apr-2024 10:04                2513
function.readline-completion-function.php          14-Apr-2024 10:04                3052
function.readline-info.php                         14-Apr-2024 10:04                4910
function.readline-list-history.php                 14-Apr-2024 10:04                2325
function.readline-on-new-line.php                  14-Apr-2024 10:04                2662
function.readline-read-history.php                 14-Apr-2024 10:04                3495
function.readline-redisplay.php                    14-Apr-2024 10:04                2240
function.readline-write-history.php                14-Apr-2024 10:04                3451
function.readline.php                              14-Apr-2024 10:04                5121
function.readlink.php                              14-Apr-2024 10:04                3389
function.realpath-cache-get.php                    14-Apr-2024 10:04                4195
function.realpath-cache-size.php                   14-Apr-2024 10:04                3667
function.realpath.php                              14-Apr-2024 10:04                3509
function.recode-file.php                           14-Apr-2024 10:04                5840
function.recode-string.php                         14-Apr-2024 10:04                5151
function.recode.php                                14-Apr-2024 10:04                1693
function.register-shutdown-function.php            14-Apr-2024 10:04                7537
function.register-tick-function.php                14-Apr-2024 10:04                5438
function.rename.php                                14-Apr-2024 10:04                4922
function.require-once.php                          14-Apr-2024 10:04                1771
function.require.php                               14-Apr-2024 10:04                1941
function.reset.php                                 14-Apr-2024 10:04                4949
function.restore-error-handler.php                 14-Apr-2024 10:04                2713
function.restore-exception-handler.php             14-Apr-2024 10:04                2937
function.restore-include-path.php                  14-Apr-2024 10:04                4036
function.return.php                                14-Apr-2024 10:04                4261
function.rewind.php                                14-Apr-2024 10:04                2993
function.rewinddir.php                             14-Apr-2024 10:04                1993
function.rmdir.php                                 14-Apr-2024 10:04                5163
function.rnp-backend-string.php                    14-Apr-2024 10:04                2228
function.rnp-backend-version.php                   14-Apr-2024 10:04                2162
function.rnp-decrypt.php                           14-Apr-2024 10:04                3205
function.rnp-dump-packets-to-json.php              14-Apr-2024 10:04                3119
function.rnp-dump-packets.php                      14-Apr-2024 10:04                3073
function.rnp-ffi-create.php                        14-Apr-2024 10:04                3168
function.rnp-ffi-destroy.php                       14-Apr-2024 10:04                2405
function.rnp-ffi-set-pass-provider.php             14-Apr-2024 10:04                6699
function.rnp-import-keys.php                       14-Apr-2024 10:04                3457
function.rnp-import-signatures.php                 14-Apr-2024 10:04                3447
function.rnp-key-export-autocrypt.php              14-Apr-2024 10:04                4508
function.rnp-key-export-revocation.php             14-Apr-2024 10:04                5158
function.rnp-key-export.php                        14-Apr-2024 10:04                3427
function.rnp-key-get-info.php                      14-Apr-2024 10:04                7945
function.rnp-key-remove.php                        14-Apr-2024 10:04                3567
function.rnp-key-revoke.php                        14-Apr-2024 10:04                4804
function.rnp-list-keys.php                         14-Apr-2024 10:04                3110
function.rnp-load-keys-from-path.php               14-Apr-2024 10:04                3806
function.rnp-load-keys.php                         14-Apr-2024 10:04                3762
function.rnp-locate-key.php                        14-Apr-2024 10:04                3530
function.rnp-op-encrypt.php                        14-Apr-2024 10:04                7897
function.rnp-op-generate-key.php                   14-Apr-2024 10:04                7516
function.rnp-op-sign-cleartext.php                 14-Apr-2024 10:04                5166
function.rnp-op-sign-detached.php                  14-Apr-2024 10:04                5045
function.rnp-op-sign.php                           14-Apr-2024 10:04                6126
function.rnp-op-verify-detached.php                14-Apr-2024 10:04                7055
function.rnp-op-verify.php                         14-Apr-2024 10:04                6794
function.rnp-save-keys-to-path.php                 14-Apr-2024 10:04                3820
function.rnp-save-keys.php                         14-Apr-2024 10:04                3793
function.rnp-supported-features.php                14-Apr-2024 10:04                2887
function.rnp-version-string-full.php               14-Apr-2024 10:04                2247
function.rnp-version-string.php                    14-Apr-2024 10:04                2144
function.round.php                                 14-Apr-2024 10:04               23544
function.rpmaddtag.php                             14-Apr-2024 10:04                3305
function.rpmdbinfo.php                             14-Apr-2024 10:04                5189
function.rpmdbsearch.php                           14-Apr-2024 10:04                6089
function.rpmgetsymlink.php                         14-Apr-2024 10:04                2932
function.rpminfo.php                               14-Apr-2024 10:04                5371
function.rpmvercmp.php                             14-Apr-2024 10:04                4868
function.rrd-create.php                            14-Apr-2024 10:04                2925
function.rrd-error.php                             14-Apr-2024 10:04                2074
function.rrd-fetch.php                             14-Apr-2024 10:04                2910
function.rrd-first.php                             14-Apr-2024 10:04                2891
function.rrd-graph.php                             14-Apr-2024 10:04                3143
function.rrd-info.php                              14-Apr-2024 10:04                2476
function.rrd-last.php                              14-Apr-2024 10:04                2423
function.rrd-lastupdate.php                        14-Apr-2024 10:04                2606
function.rrd-restore.php                           14-Apr-2024 10:04                3312
function.rrd-tune.php                              14-Apr-2024 10:04                2994
function.rrd-update.php                            14-Apr-2024 10:04                3067
function.rrd-version.php                           14-Apr-2024 10:04                2168
function.rrd-xport.php                             14-Apr-2024 10:04                2650
function.rrdc-disconnect.php                       14-Apr-2024 10:04                2528
function.rsort.php                                 14-Apr-2024 10:04                5209
function.rtrim.php                                 14-Apr-2024 10:04                6630
function.runkit7-constant-add.php                  14-Apr-2024 10:04                4400
function.runkit7-constant-redefine.php             14-Apr-2024 10:04                4294
function.runkit7-constant-remove.php               14-Apr-2024 10:04                3608
function.runkit7-function-add.php                  14-Apr-2024 10:04                9710
function.runkit7-function-copy.php                 14-Apr-2024 10:04                5477
function.runkit7-function-redefine.php             14-Apr-2024 10:04               10145
function.runkit7-function-remove.php               14-Apr-2024 10:04                4094
function.runkit7-function-rename.php               14-Apr-2024 10:04                4371
function.runkit7-import.php                        14-Apr-2024 10:04                3804
function.runkit7-method-add.php                    14-Apr-2024 10:04               11736
function.runkit7-method-copy.php                   14-Apr-2024 10:04                7028
function.runkit7-method-redefine.php               14-Apr-2024 10:04               12172
function.runkit7-method-remove.php                 14-Apr-2024 10:04                6427
function.runkit7-method-rename.php                 14-Apr-2024 10:04                6589
function.runkit7-object-id.php                     14-Apr-2024 10:04                3717
function.runkit7-superglobals.php                  14-Apr-2024 10:04                2604
function.runkit7-zval-inspect.php                  14-Apr-2024 10:04                5075
function.sapi-windows-cp-conv.php                  14-Apr-2024 10:04                4702
function.sapi-windows-cp-get.php                   14-Apr-2024 10:04                3423
function.sapi-windows-cp-is-utf8.php               14-Apr-2024 10:04                2708
function.sapi-windows-cp-set.php                   14-Apr-2024 10:04                3046
function.sapi-windows-generate-ctrl-event.php      14-Apr-2024 10:04                7743
function.sapi-windows-set-ctrl-handler.php         14-Apr-2024 10:04                7552
function.sapi-windows-vt100-support.php            14-Apr-2024 10:04               11183
function.scandir.php                               14-Apr-2024 10:04                9022
function.scoutapm-get-calls.php                    14-Apr-2024 10:04                4427
function.scoutapm-list-instrumented-functions.php  14-Apr-2024 10:04                3765
function.seaslog-get-author.php                    14-Apr-2024 10:04                3084
function.seaslog-get-version.php                   14-Apr-2024 10:04                3083
function.sem-acquire.php                           14-Apr-2024 10:04                3188
function.sem-get.php                               14-Apr-2024 10:04                4344
function.sem-release.php                           14-Apr-2024 10:04                2830
function.sem-remove.php                            14-Apr-2024 10:04                2953
function.serialize.php                             14-Apr-2024 10:04                8648
function.session-abort.php                         14-Apr-2024 10:04                4163
function.session-cache-expire.php                  14-Apr-2024 10:04                5682
function.session-cache-limiter.php                 14-Apr-2024 10:04                5170
function.session-commit.php                        14-Apr-2024 10:04                1787
function.session-create-id.php                     14-Apr-2024 10:04                9814
function.session-decode.php                        14-Apr-2024 10:04                2294
function.session-destroy.php                       14-Apr-2024 10:04                4283
function.session-encode.php                        14-Apr-2024 10:04                1936
function.session-gc.php                            14-Apr-2024 10:04                7571
function.session-get-cookie-params.php             14-Apr-2024 10:04                2806
function.session-id.php                            14-Apr-2024 10:04                2440
function.session-module-name.php                   14-Apr-2024 10:04                2230
function.session-name.php                          14-Apr-2024 10:04                5647
function.session-regenerate-id.php                 14-Apr-2024 10:04               15617
function.session-register-shutdown.php             14-Apr-2024 10:04                2722
function.session-reset.php                         14-Apr-2024 10:04                4251
function.session-save-path.php                     14-Apr-2024 10:04                2699
function.session-set-cookie-params.php             14-Apr-2024 10:04                2593
function.session-set-save-handler.php              14-Apr-2024 10:04               12280
function.session-start.php                         14-Apr-2024 10:04                3623
function.session-status.php                        14-Apr-2024 10:04                3239
function.session-unset.php                         14-Apr-2024 10:04                2424
function.session-write-close.php                   14-Apr-2024 10:04                2579
function.set-error-handler.php                     14-Apr-2024 10:04               26529
function.set-exception-handler.php                 14-Apr-2024 10:04                9207
function.set-file-buffer.php                       14-Apr-2024 10:04                1752
function.set-include-path.php                      14-Apr-2024 10:04                3851
function.set-time-limit.php                        14-Apr-2024 10:04                4818
function.setcookie.php                             14-Apr-2024 10:04               26693
function.setlocale.php                             14-Apr-2024 10:04               16095
function.setrawcookie.php                          14-Apr-2024 10:04                6328
function.settype.php                               14-Apr-2024 10:04                6540
function.sha1-file.php                             14-Apr-2024 10:04                4849
function.sha1.php                                  14-Apr-2024 10:04                4271
function.shell-exec.php                            14-Apr-2024 10:04                5129
function.shm-attach.php                            14-Apr-2024 10:04                3503
function.shm-detach.php                            14-Apr-2024 10:04                2892
function.shm-get-var.php                           14-Apr-2024 10:04                2408
function.shm-has-var.php                           14-Apr-2024 10:04                4379
function.shm-put-var.php                           14-Apr-2024 10:04                3190
function.shm-remove-var.php                        14-Apr-2024 10:04                2355
function.shm-remove.php                            14-Apr-2024 10:04                2291
function.shmop-close.php                           14-Apr-2024 10:04                3011
function.shmop-delete.php                          14-Apr-2024 10:04                3097
function.shmop-open.php                            14-Apr-2024 10:04                6540
function.shmop-read.php                            14-Apr-2024 10:04                3696
function.shmop-size.php                            14-Apr-2024 10:04                3325
function.shmop-write.php                           14-Apr-2024 10:04                3851
function.show-source.php                           14-Apr-2024 10:04                1709
function.shuffle.php                               14-Apr-2024 10:04                4452
function.simdjson-decode.php                       14-Apr-2024 10:04               16968
function.simdjson-is-valid.php                     14-Apr-2024 10:04               10434
function.simdjson-key-count.php                    14-Apr-2024 10:04                4773
function.simdjson-key-exists.php                   14-Apr-2024 10:04                4568
function.simdjson-key-value.php                    14-Apr-2024 10:04                7320
function.similar-text.php                          14-Apr-2024 10:04                3239
function.simplexml-import-dom.php                  14-Apr-2024 10:04                6477
function.simplexml-load-file.php                   14-Apr-2024 10:04               10216
function.simplexml-load-string.php                 14-Apr-2024 10:04                9960
function.sin.php                                   14-Apr-2024 10:04                3499
function.sinh.php                                  14-Apr-2024 10:04                2339
function.sizeof.php                                14-Apr-2024 10:04                1600
function.sleep.php                                 14-Apr-2024 10:04                6573
function.snmp-get-quick-print.php                  14-Apr-2024 10:04                3338
function.snmp-get-valueretrieval.php               14-Apr-2024 10:04                4410
function.snmp-read-mib.php                         14-Apr-2024 10:04                4853
function.snmp-set-enum-print.php                   14-Apr-2024 10:04                5336
function.snmp-set-oid-numeric-print.php            14-Apr-2024 10:04                2287
function.snmp-set-oid-output-format.php            14-Apr-2024 10:04                7766
function.snmp-set-quick-print.php                  14-Apr-2024 10:04                5283
function.snmp-set-valueretrieval.php               14-Apr-2024 10:04                9476
function.snmp2-get.php                             14-Apr-2024 10:04                5762
function.snmp2-getnext.php                         14-Apr-2024 10:04                6130
function.snmp2-real-walk.php                       14-Apr-2024 10:04                6569
function.snmp2-set.php                             14-Apr-2024 10:04               10951
function.snmp2-walk.php                            14-Apr-2024 10:04                7054
function.snmp3-get.php                             14-Apr-2024 10:04                8869
function.snmp3-getnext.php                         14-Apr-2024 10:04                9197
function.snmp3-real-walk.php                       14-Apr-2024 10:04                9885
function.snmp3-set.php                             14-Apr-2024 10:04               13725
function.snmp3-walk.php                            14-Apr-2024 10:04               10342
function.snmpget.php                               14-Apr-2024 10:04                4040
function.snmpgetnext.php                           14-Apr-2024 10:04                6011
function.snmprealwalk.php                          14-Apr-2024 10:04                2983
function.snmpset.php                               14-Apr-2024 10:04                3811
function.snmpwalk.php                              14-Apr-2024 10:04                5684
function.snmpwalkoid.php                           14-Apr-2024 10:04                6431
function.socket-accept.php                         14-Apr-2024 10:04                5292
function.socket-addrinfo-bind.php                  14-Apr-2024 10:04                5418
function.socket-addrinfo-connect.php               14-Apr-2024 10:04                5213
function.socket-addrinfo-explain.php               14-Apr-2024 10:04                4453
function.socket-addrinfo-lookup.php                14-Apr-2024 10:04                6050
function.socket-atmark.php                         14-Apr-2024 10:04                4955
function.socket-bind.php                           14-Apr-2024 10:04               10338
function.socket-clear-error.php                    14-Apr-2024 10:04                3162
function.socket-close.php                          14-Apr-2024 10:04                3891
function.socket-cmsg-space.php                     14-Apr-2024 10:04                3755
function.socket-connect.php                        14-Apr-2024 10:04                5082
function.socket-create-listen.php                  14-Apr-2024 10:04                5341
function.socket-create-pair.php                    14-Apr-2024 10:04               19256
function.socket-create.php                         14-Apr-2024 10:04               10120
function.socket-export-stream.php                  14-Apr-2024 10:04                3521
function.socket-get-option.php                     14-Apr-2024 10:04                7055
function.socket-get-status.php                     14-Apr-2024 10:04                1785
function.socket-getopt.php                         14-Apr-2024 10:04                1766
function.socket-getpeername.php                    14-Apr-2024 10:04                5940
function.socket-getsockname.php                    14-Apr-2024 10:04                5978
function.socket-import-stream.php                  14-Apr-2024 10:04                5133
function.socket-last-error.php                     14-Apr-2024 10:04                5100
function.socket-listen.php                         14-Apr-2024 10:04                5162
function.socket-read.php                           14-Apr-2024 10:04                5693
function.socket-recv.php                           14-Apr-2024 10:04                3074
function.socket-recvfrom.php                       14-Apr-2024 10:04                3692
function.socket-recvmsg.php                        14-Apr-2024 10:04                4432
function.socket-select.php                         14-Apr-2024 10:04               14699
function.socket-send.php                           14-Apr-2024 10:04                4531
function.socket-sendmsg.php                        14-Apr-2024 10:04                4569
function.socket-sendto.php                         14-Apr-2024 10:04                7704
function.socket-set-block.php                      14-Apr-2024 10:04                6191
function.socket-set-blocking.php                   14-Apr-2024 10:04                1805
function.socket-set-nonblock.php                   14-Apr-2024 10:04                5212
function.socket-set-option.php                     14-Apr-2024 10:04                4655
function.socket-set-timeout.php                    14-Apr-2024 10:04                1773
function.socket-setopt.php                         14-Apr-2024 10:04                1760
function.socket-shutdown.php                       14-Apr-2024 10:04                3529
function.socket-strerror.php                       14-Apr-2024 10:04                6248
function.socket-write.php                          14-Apr-2024 10:04                5595
function.socket-wsaprotocol-info-export.php        14-Apr-2024 10:04                5054
function.socket-wsaprotocol-info-import.php        14-Apr-2024 10:04                4439
function.socket-wsaprotocol-info-release.php       14-Apr-2024 10:04                3622
function.sodium-add.php                            14-Apr-2024 10:04                3162
function.sodium-base642bin.php                     14-Apr-2024 10:04                4437
function.sodium-bin2base64.php                     14-Apr-2024 10:04                3967
function.sodium-bin2hex.php                        14-Apr-2024 10:04                2664
function.sodium-compare.php                        14-Apr-2024 10:04                3191
function.sodium-crypto-aead-aes256gcm-decrypt.php  14-Apr-2024 10:04                4666
function.sodium-crypto-aead-aes256gcm-encrypt.php  14-Apr-2024 10:04                4371
function.sodium-crypto-aead-aes256gcm-is-availa..> 14-Apr-2024 10:04                2810
function.sodium-crypto-aead-aes256gcm-keygen.php   14-Apr-2024 10:04                2800
function.sodium-crypto-aead-chacha20poly1305-de..> 14-Apr-2024 10:04                4531
function.sodium-crypto-aead-chacha20poly1305-en..> 14-Apr-2024 10:04                4250
function.sodium-crypto-aead-chacha20poly1305-ie..> 14-Apr-2024 10:04                4761
function.sodium-crypto-aead-chacha20poly1305-ie..> 14-Apr-2024 10:04                4416
function.sodium-crypto-aead-chacha20poly1305-ie..> 14-Apr-2024 10:04                2994
function.sodium-crypto-aead-chacha20poly1305-ke..> 14-Apr-2024 10:04                2929
function.sodium-crypto-aead-xchacha20poly1305-i..> 14-Apr-2024 10:04                4939
function.sodium-crypto-aead-xchacha20poly1305-i..> 14-Apr-2024 10:04                4634
function.sodium-crypto-aead-xchacha20poly1305-i..> 14-Apr-2024 10:04                2970
function.sodium-crypto-auth-keygen.php             14-Apr-2024 10:04                2621
function.sodium-crypto-auth-verify.php             14-Apr-2024 10:04                3862
function.sodium-crypto-auth.php                    14-Apr-2024 10:04                3320
function.sodium-crypto-box-keypair-from-secretk..> 14-Apr-2024 10:04                3399
function.sodium-crypto-box-keypair.php             14-Apr-2024 10:04                2902
function.sodium-crypto-box-open.php                14-Apr-2024 10:04                3966
function.sodium-crypto-box-publickey-from-secre..> 14-Apr-2024 10:04                3230
function.sodium-crypto-box-publickey.php           14-Apr-2024 10:04                2943
function.sodium-crypto-box-seal-open.php           14-Apr-2024 10:04                6015
function.sodium-crypto-box-seal.php                14-Apr-2024 10:04                7143
function.sodium-crypto-box-secretkey.php           14-Apr-2024 10:04                2910
function.sodium-crypto-box-seed-keypair.php        14-Apr-2024 10:04                2969
function.sodium-crypto-box.php                     14-Apr-2024 10:04                4189
function.sodium-crypto-core-ristretto255-add.php   14-Apr-2024 10:04                6118
function.sodium-crypto-core-ristretto255-from-h..> 14-Apr-2024 10:04                5478
function.sodium-crypto-core-ristretto255-is-val..> 14-Apr-2024 10:04                5643
function.sodium-crypto-core-ristretto255-random..> 14-Apr-2024 10:04                5630
function.sodium-crypto-core-ristretto255-scalar..> 14-Apr-2024 10:04                6385
function.sodium-crypto-core-ristretto255-scalar..> 14-Apr-2024 10:04                3622
function.sodium-crypto-core-ristretto255-scalar..> 14-Apr-2024 10:04                5477
function.sodium-crypto-core-ristretto255-scalar..> 14-Apr-2024 10:04                3881
function.sodium-crypto-core-ristretto255-scalar..> 14-Apr-2024 10:04                5461
function.sodium-crypto-core-ristretto255-scalar..> 14-Apr-2024 10:04                5789
function.sodium-crypto-core-ristretto255-scalar..> 14-Apr-2024 10:04                3566
function.sodium-crypto-core-ristretto255-scalar..> 14-Apr-2024 10:04                6376
function.sodium-crypto-core-ristretto255-sub.php   14-Apr-2024 10:04                6155
function.sodium-crypto-generichash-final.php       14-Apr-2024 10:04                6856
function.sodium-crypto-generichash-init.php        14-Apr-2024 10:04                6806
function.sodium-crypto-generichash-keygen.php      14-Apr-2024 10:04                2431
function.sodium-crypto-generichash-update.php      14-Apr-2024 10:04                6536
function.sodium-crypto-generichash.php             14-Apr-2024 10:04                3725
function.sodium-crypto-kdf-derive-from-key.php     14-Apr-2024 10:04                3936
function.sodium-crypto-kdf-keygen.php              14-Apr-2024 10:04                2533
function.sodium-crypto-kx-client-session-keys.php  14-Apr-2024 10:04                3352
function.sodium-crypto-kx-keypair.php              14-Apr-2024 10:04                4982
function.sodium-crypto-kx-publickey.php            14-Apr-2024 10:04                2762
function.sodium-crypto-kx-secretkey.php            14-Apr-2024 10:04                2773
function.sodium-crypto-kx-seed-keypair.php         14-Apr-2024 10:04                2721
function.sodium-crypto-kx-server-session-keys.php  14-Apr-2024 10:04                3418
function.sodium-crypto-pwhash-scryptsalsa208sha..> 14-Apr-2024 10:04                3326
function.sodium-crypto-pwhash-scryptsalsa208sha..> 14-Apr-2024 10:04                3529
function.sodium-crypto-pwhash-scryptsalsa208sha..> 14-Apr-2024 10:04                6418
function.sodium-crypto-pwhash-str-needs-rehash.php 14-Apr-2024 10:04                3992
function.sodium-crypto-pwhash-str-verify.php       14-Apr-2024 10:04                4749
function.sodium-crypto-pwhash-str.php              14-Apr-2024 10:04                8588
function.sodium-crypto-pwhash.php                  14-Apr-2024 10:04               10411
function.sodium-crypto-scalarmult-base.php         14-Apr-2024 10:04                2013
function.sodium-crypto-scalarmult-ristretto255-..> 14-Apr-2024 10:04                3535
function.sodium-crypto-scalarmult-ristretto255.php 14-Apr-2024 10:04                3884
function.sodium-crypto-scalarmult.php              14-Apr-2024 10:04                3041
function.sodium-crypto-secretbox-keygen.php        14-Apr-2024 10:04                6258
function.sodium-crypto-secretbox-open.php          14-Apr-2024 10:04                8764
function.sodium-crypto-secretbox.php               14-Apr-2024 10:04                8669
function.sodium-crypto-secretstream-xchacha20po..> 14-Apr-2024 10:04               10863
function.sodium-crypto-secretstream-xchacha20po..> 14-Apr-2024 10:04               10197
function.sodium-crypto-secretstream-xchacha20po..> 14-Apr-2024 10:04                2697
function.sodium-crypto-secretstream-xchacha20po..> 14-Apr-2024 10:04                5799
function.sodium-crypto-secretstream-xchacha20po..> 14-Apr-2024 10:04                5810
function.sodium-crypto-secretstream-xchacha20po..> 14-Apr-2024 10:04                2958
function.sodium-crypto-shorthash-keygen.php        14-Apr-2024 10:04                2691
function.sodium-crypto-shorthash.php               14-Apr-2024 10:04                3153
function.sodium-crypto-sign-detached.php           14-Apr-2024 10:04                3146
function.sodium-crypto-sign-ed25519-pk-to-curve..> 14-Apr-2024 10:04                2930
function.sodium-crypto-sign-ed25519-sk-to-curve..> 14-Apr-2024 10:04                2986
function.sodium-crypto-sign-keypair-from-secret..> 14-Apr-2024 10:04                3225
function.sodium-crypto-sign-keypair.php            14-Apr-2024 10:04                2419
function.sodium-crypto-sign-open.php               14-Apr-2024 10:04                3332
function.sodium-crypto-sign-publickey-from-secr..> 14-Apr-2024 10:04                2788
function.sodium-crypto-sign-publickey.php          14-Apr-2024 10:04                2798
function.sodium-crypto-sign-secretkey.php          14-Apr-2024 10:04                2774
function.sodium-crypto-sign-seed-keypair.php       14-Apr-2024 10:04                3007
function.sodium-crypto-sign-verify-detached.php    14-Apr-2024 10:04                3639
function.sodium-crypto-sign.php                    14-Apr-2024 10:04                3224
function.sodium-crypto-stream-keygen.php           14-Apr-2024 10:04                2602
function.sodium-crypto-stream-xchacha20-keygen.php 14-Apr-2024 10:04                2760
function.sodium-crypto-stream-xchacha20-xor-ic.php 14-Apr-2024 10:04                9612
function.sodium-crypto-stream-xchacha20-xor.php    14-Apr-2024 10:04                4674
function.sodium-crypto-stream-xchacha20.php        14-Apr-2024 10:04                3680
function.sodium-crypto-stream-xor.php              14-Apr-2024 10:04                3466
function.sodium-crypto-stream.php                  14-Apr-2024 10:04                3399
function.sodium-hex2bin.php                        14-Apr-2024 10:04                3272
function.sodium-increment.php                      14-Apr-2024 10:04                2498
function.sodium-memcmp.php                         14-Apr-2024 10:04                3495
function.sodium-memzero.php                        14-Apr-2024 10:04                2493
function.sodium-pad.php                            14-Apr-2024 10:04                2721
function.sodium-unpad.php                          14-Apr-2024 10:04                2676
function.solr-get-version.php                      14-Apr-2024 10:04                3920
function.sort.php                                  14-Apr-2024 10:04                7024
function.soundex.php                               14-Apr-2024 10:04                5544
function.spl-autoload-call.php                     14-Apr-2024 10:04                2627
function.spl-autoload-extensions.php               14-Apr-2024 10:04                4966
function.spl-autoload-functions.php                14-Apr-2024 10:04                3238
function.spl-autoload-register.php                 14-Apr-2024 10:04               13477
function.spl-autoload-unregister.php               14-Apr-2024 10:04                3081
function.spl-autoload.php                          14-Apr-2024 10:04                4685
function.spl-classes.php                           14-Apr-2024 10:04                3779
function.spl-object-hash.php                       14-Apr-2024 10:04                5004
function.spl-object-id.php                         14-Apr-2024 10:04                4102
function.sprintf.php                               14-Apr-2024 10:04               24527
function.sqlsrv-begin-transaction.php              14-Apr-2024 10:04               11249
function.sqlsrv-cancel.php                         14-Apr-2024 10:04               10320
function.sqlsrv-client-info.php                    14-Apr-2024 10:04                6732
function.sqlsrv-close.php                          14-Apr-2024 10:04                5591
function.sqlsrv-commit.php                         14-Apr-2024 10:04               11106
function.sqlsrv-configure.php                      14-Apr-2024 10:04                4726
function.sqlsrv-connect.php                        14-Apr-2024 10:04               12179
function.sqlsrv-errors.php                         14-Apr-2024 10:04               10019
function.sqlsrv-execute.php                        14-Apr-2024 10:04               10143
function.sqlsrv-fetch-array.php                    14-Apr-2024 10:04               15599
function.sqlsrv-fetch-object.php                   14-Apr-2024 10:04               12356
function.sqlsrv-fetch.php                          14-Apr-2024 10:04               10805
function.sqlsrv-field-metadata.php                 14-Apr-2024 10:04                8843
function.sqlsrv-free-stmt.php                      14-Apr-2024 10:04                7721
function.sqlsrv-get-config.php                     14-Apr-2024 10:04                3320
function.sqlsrv-get-field.php                      14-Apr-2024 10:04               10177
function.sqlsrv-has-rows.php                       14-Apr-2024 10:04                6336
function.sqlsrv-next-result.php                    14-Apr-2024 10:04                9250
function.sqlsrv-num-fields.php                     14-Apr-2024 10:04                8170
function.sqlsrv-num-rows.php                       14-Apr-2024 10:04                7897
function.sqlsrv-prepare.php                        14-Apr-2024 10:04               14513
function.sqlsrv-query.php                          14-Apr-2024 10:04               11866
function.sqlsrv-rollback.php                       14-Apr-2024 10:04               10576
function.sqlsrv-rows-affected.php                  14-Apr-2024 10:04                7947
function.sqlsrv-send-stream-data.php               14-Apr-2024 10:04                8516
function.sqlsrv-server-info.php                    14-Apr-2024 10:04                6147
function.sqrt.php                                  14-Apr-2024 10:04                2994
function.srand.php                                 14-Apr-2024 10:04                7202
function.sscanf.php                                14-Apr-2024 10:04                7761
function.ssdeep-fuzzy-compare.php                  14-Apr-2024 10:04                3257
function.ssdeep-fuzzy-hash-filename.php            14-Apr-2024 10:04                2980
function.ssdeep-fuzzy-hash.php                     14-Apr-2024 10:04                2822
function.ssh2-auth-agent.php                       14-Apr-2024 10:04                4749
function.ssh2-auth-hostbased-file.php              14-Apr-2024 10:04                7725
function.ssh2-auth-none.php                        14-Apr-2024 10:04                4844
function.ssh2-auth-password.php                    14-Apr-2024 10:04                5012
function.ssh2-auth-pubkey-file.php                 14-Apr-2024 10:04                7226
function.ssh2-connect.php                          14-Apr-2024 10:04               15739
function.ssh2-disconnect.php                       14-Apr-2024 10:04                3097
function.ssh2-exec.php                             14-Apr-2024 10:04                7613
function.ssh2-fetch-stream.php                     14-Apr-2024 10:04                5523
function.ssh2-fingerprint.php                      14-Apr-2024 10:04                5515
function.ssh2-forward-accept.php                   14-Apr-2024 10:04                3070
function.ssh2-forward-listen.php                   14-Apr-2024 10:04                4516
function.ssh2-methods-negotiated.php               14-Apr-2024 10:04                7981
function.ssh2-poll.php                             14-Apr-2024 10:04                3551
function.ssh2-publickey-add.php                    14-Apr-2024 10:04                8454
function.ssh2-publickey-init.php                   14-Apr-2024 10:04                4694
function.ssh2-publickey-list.php                   14-Apr-2024 10:04                8848
function.ssh2-publickey-remove.php                 14-Apr-2024 10:04                4742
function.ssh2-scp-recv.php                         14-Apr-2024 10:04                5462
function.ssh2-scp-send.php                         14-Apr-2024 10:04                6073
function.ssh2-send-eof.php                         14-Apr-2024 10:04                3450
function.ssh2-sftp-chmod.php                       14-Apr-2024 10:04                5984
function.ssh2-sftp-lstat.php                       14-Apr-2024 10:04                7269
function.ssh2-sftp-mkdir.php                       14-Apr-2024 10:04                6850
function.ssh2-sftp-readlink.php                    14-Apr-2024 10:04                5331
function.ssh2-sftp-realpath.php                    14-Apr-2024 10:04                5552
function.ssh2-sftp-rename.php                      14-Apr-2024 10:04                5565
function.ssh2-sftp-rmdir.php                       14-Apr-2024 10:04                5556
function.ssh2-sftp-stat.php                        14-Apr-2024 10:04                7184
function.ssh2-sftp-symlink.php                     14-Apr-2024 10:04                5757
function.ssh2-sftp-unlink.php                      14-Apr-2024 10:04                5031
function.ssh2-sftp.php                             14-Apr-2024 10:04                5459
function.ssh2-shell.php                            14-Apr-2024 10:04                8074
function.ssh2-tunnel.php                           14-Apr-2024 10:04                5344
function.stat.php                                  14-Apr-2024 10:04                6339
function.stats-absolute-deviation.php              14-Apr-2024 10:04                2815
function.stats-cdf-beta.php                        14-Apr-2024 10:04                5180
function.stats-cdf-binomial.php                    14-Apr-2024 10:04                5165
function.stats-cdf-cauchy.php                      14-Apr-2024 10:04                5200
function.stats-cdf-chisquare.php                   14-Apr-2024 10:04                4519
function.stats-cdf-exponential.php                 14-Apr-2024 10:04                4550
function.stats-cdf-f.php                           14-Apr-2024 10:04                5105
function.stats-cdf-gamma.php                       14-Apr-2024 10:04                5164
function.stats-cdf-laplace.php                     14-Apr-2024 10:04                5185
function.stats-cdf-logistic.php                    14-Apr-2024 10:04                5220
function.stats-cdf-negative-binomial.php           14-Apr-2024 10:04                5308
function.stats-cdf-noncentral-chisquare.php        14-Apr-2024 10:04                5410
function.stats-cdf-noncentral-f.php                14-Apr-2024 10:04                5984
function.stats-cdf-noncentral-t.php                14-Apr-2024 10:04                5270
function.stats-cdf-normal.php                      14-Apr-2024 10:04                5202
function.stats-cdf-poisson.php                     14-Apr-2024 10:04                4484
function.stats-cdf-t.php                           14-Apr-2024 10:04                4412
function.stats-cdf-uniform.php                     14-Apr-2024 10:04                5165
function.stats-cdf-weibull.php                     14-Apr-2024 10:04                5202
function.stats-covariance.php                      14-Apr-2024 10:04                3013
function.stats-dens-beta.php                       14-Apr-2024 10:04                3499
function.stats-dens-cauchy.php                     14-Apr-2024 10:04                3557
function.stats-dens-chisquare.php                  14-Apr-2024 10:04                3227
function.stats-dens-exponential.php                14-Apr-2024 10:04                3217
function.stats-dens-f.php                          14-Apr-2024 10:04                3497
function.stats-dens-gamma.php                      14-Apr-2024 10:04                3550
function.stats-dens-laplace.php                    14-Apr-2024 10:04                3584
function.stats-dens-logistic.php                   14-Apr-2024 10:04                3596
function.stats-dens-normal.php                     14-Apr-2024 10:04                3567
function.stats-dens-pmf-binomial.php               14-Apr-2024 10:04                3621
function.stats-dens-pmf-hypergeometric.php         14-Apr-2024 10:04                4273
function.stats-dens-pmf-negative-binomial.php      14-Apr-2024 10:04                3750
function.stats-dens-pmf-poisson.php                14-Apr-2024 10:04                3218
function.stats-dens-t.php                          14-Apr-2024 10:04                3131
function.stats-dens-uniform.php                    14-Apr-2024 10:04                3532
function.stats-dens-weibull.php                    14-Apr-2024 10:04                3564
function.stats-harmonic-mean.php                   14-Apr-2024 10:04                2712
function.stats-kurtosis.php                        14-Apr-2024 10:04                2720
function.stats-rand-gen-beta.php                   14-Apr-2024 10:04                3026
function.stats-rand-gen-chisquare.php              14-Apr-2024 10:04                2699
function.stats-rand-gen-exponential.php            14-Apr-2024 10:04                2697
function.stats-rand-gen-f.php                      14-Apr-2024 10:04                3080
function.stats-rand-gen-funiform.php               14-Apr-2024 10:04                3007
function.stats-rand-gen-gamma.php                  14-Apr-2024 10:04                3093
function.stats-rand-gen-ibinomial-negative.php     14-Apr-2024 10:04                3173
function.stats-rand-gen-ibinomial.php              14-Apr-2024 10:04                3097
function.stats-rand-gen-int.php                    14-Apr-2024 10:04                2272
function.stats-rand-gen-ipoisson.php               14-Apr-2024 10:04                2672
function.stats-rand-gen-iuniform.php               14-Apr-2024 10:04                3074
function.stats-rand-gen-noncentral-chisquare.php   14-Apr-2024 10:04                3215
function.stats-rand-gen-noncentral-f.php           14-Apr-2024 10:04                3568
function.stats-rand-gen-noncentral-t.php           14-Apr-2024 10:04                3128
function.stats-rand-gen-normal.php                 14-Apr-2024 10:04                3041
function.stats-rand-gen-t.php                      14-Apr-2024 10:04                2591
function.stats-rand-get-seeds.php                  14-Apr-2024 10:04                2315
function.stats-rand-phrase-to-seeds.php            14-Apr-2024 10:04                2680
function.stats-rand-ranf.php                       14-Apr-2024 10:04                2316
function.stats-rand-setall.php                     14-Apr-2024 10:04                2949
function.stats-skew.php                            14-Apr-2024 10:04                2686
function.stats-standard-deviation.php              14-Apr-2024 10:04                3855
function.stats-stat-binomial-coef.php              14-Apr-2024 10:04                2986
function.stats-stat-correlation.php                14-Apr-2024 10:04                3193
function.stats-stat-factorial.php                  14-Apr-2024 10:04                2559
function.stats-stat-independent-t.php              14-Apr-2024 10:04                3321
function.stats-stat-innerproduct.php               14-Apr-2024 10:04                3135
function.stats-stat-paired-t.php                   14-Apr-2024 10:04                3072
function.stats-stat-percentile.php                 14-Apr-2024 10:04                2938
function.stats-stat-powersum.php                   14-Apr-2024 10:04                2930
function.stats-variance.php                        14-Apr-2024 10:04                3357
function.stomp-connect-error.php                   14-Apr-2024 10:04                3688
function.stomp-version.php                         14-Apr-2024 10:04                3117
function.str-contains.php                          14-Apr-2024 10:04                8348
function.str-decrement.php                         14-Apr-2024 10:04                6506
function.str-ends-with.php                         14-Apr-2024 10:04                8275
function.str-getcsv.php                            14-Apr-2024 10:04                9165
function.str-increment.php                         14-Apr-2024 10:04                6193
function.str-ireplace.php                          14-Apr-2024 10:04                6015
function.str-pad.php                               14-Apr-2024 10:04                6560
function.str-repeat.php                            14-Apr-2024 10:04                3595
function.str-replace.php                           14-Apr-2024 10:04               10758
function.str-rot13.php                             14-Apr-2024 10:04                3376
function.str-shuffle.php                           14-Apr-2024 10:04                3273
function.str-split.php                             14-Apr-2024 10:04                6992
function.str-starts-with.php                       14-Apr-2024 10:04                8303
function.str-word-count.php                        14-Apr-2024 10:04                9044
function.strcasecmp.php                            14-Apr-2024 10:04                4093
function.strchr.php                                14-Apr-2024 10:04                1622
function.strcmp.php                                14-Apr-2024 10:04                5588
function.strcoll.php                               14-Apr-2024 10:04                4001
function.strcspn.php                               14-Apr-2024 10:04                3446
function.stream-bucket-append.php                  14-Apr-2024 10:04                2268
function.stream-bucket-make-writeable.php          14-Apr-2024 10:04                4395
function.stream-bucket-new.php                     14-Apr-2024 10:04                2300
function.stream-bucket-prepend.php                 14-Apr-2024 10:04                6305
function.stream-context-create.php                 14-Apr-2024 10:04                7787
function.stream-context-get-default.php            14-Apr-2024 10:04                8853
function.stream-context-get-options.php            14-Apr-2024 10:04                4476
function.stream-context-get-params.php             14-Apr-2024 10:04                5519
function.stream-context-set-default.php            14-Apr-2024 10:04                6208
function.stream-context-set-option.php             14-Apr-2024 10:04                5524
function.stream-context-set-options.php            14-Apr-2024 10:04                6425
function.stream-context-set-params.php             14-Apr-2024 10:04                4686
function.stream-copy-to-stream.php                 14-Apr-2024 10:04                7721
function.stream-filter-append.php                  14-Apr-2024 10:04               10873
function.stream-filter-prepend.php                 14-Apr-2024 10:04                8193
function.stream-filter-register.php                14-Apr-2024 10:04               18404
function.stream-filter-remove.php                  14-Apr-2024 10:04                6667
function.stream-get-contents.php                   14-Apr-2024 10:04                9075
function.stream-get-filters.php                    14-Apr-2024 10:04                4039
function.stream-get-line.php                       14-Apr-2024 10:04                5025
function.stream-get-meta-data.php                  14-Apr-2024 10:04               14649
function.stream-get-transports.php                 14-Apr-2024 10:04                4025
function.stream-get-wrappers.php                   14-Apr-2024 10:04                4789
function.stream-is-local.php                       14-Apr-2024 10:04                4263
function.stream-isatty.php                         14-Apr-2024 10:04                3999
function.stream-notification-callback.php          14-Apr-2024 10:04               22332
function.stream-register-wrapper.php               14-Apr-2024 10:04                1888
function.stream-resolve-include-path.php           14-Apr-2024 10:04                4356
function.stream-select.php                         14-Apr-2024 10:04               16368
function.stream-set-blocking.php                   14-Apr-2024 10:04                4821
function.stream-set-chunk-size.php                 14-Apr-2024 10:04                4284
function.stream-set-read-buffer.php                14-Apr-2024 10:04                3729
function.stream-set-timeout.php                    14-Apr-2024 10:04                8099
function.stream-set-write-buffer.php               14-Apr-2024 10:04                5850
function.stream-socket-accept.php                  14-Apr-2024 10:04                7637
function.stream-socket-client.php                  14-Apr-2024 10:04               17726
function.stream-socket-enable-crypto.php           14-Apr-2024 10:04               11962
function.stream-socket-get-name.php                14-Apr-2024 10:04                3889
function.stream-socket-pair.php                    14-Apr-2024 10:04                9870
function.stream-socket-recvfrom.php                14-Apr-2024 10:04               10684
function.stream-socket-sendto.php                  14-Apr-2024 10:04                7435
function.stream-socket-server.php                  14-Apr-2024 10:04               15412
function.stream-socket-shutdown.php                14-Apr-2024 10:04                6622
function.stream-supports-lock.php                  14-Apr-2024 10:04                3225
function.stream-wrapper-register.php               14-Apr-2024 10:04                9304
function.stream-wrapper-restore.php                14-Apr-2024 10:04                2926
function.stream-wrapper-unregister.php             14-Apr-2024 10:04                3127
function.strftime.php                              14-Apr-2024 10:04               10933
function.strip-tags.php                            14-Apr-2024 10:04                5660
function.stripcslashes.php                         14-Apr-2024 10:04                2337
function.stripos.php                               14-Apr-2024 10:04                8208
function.stripslashes.php                          14-Apr-2024 10:04                7286
function.stristr.php                               14-Apr-2024 10:04                6193
function.strlen.php                                14-Apr-2024 10:04                3292
function.strnatcasecmp.php                         14-Apr-2024 10:04                3967
function.strnatcmp.php                             14-Apr-2024 10:04                6532
function.strncasecmp.php                           14-Apr-2024 10:04                3488
function.strncmp.php                               14-Apr-2024 10:04                3605
function.strpbrk.php                               14-Apr-2024 10:04                3968
function.strpos.php                                14-Apr-2024 10:04                8027
function.strptime.php                              14-Apr-2024 10:04               11830
function.strrchr.php                               14-Apr-2024 10:04                5108
function.strrev.php                                14-Apr-2024 10:04                2559
function.strripos.php                              14-Apr-2024 10:04                6951
function.strrpos.php                               14-Apr-2024 10:04                6277
function.strspn.php                                14-Apr-2024 10:04                5033
function.strstr.php                                14-Apr-2024 10:04                5133
function.strtok.php                                14-Apr-2024 10:04                8687
function.strtolower.php                            14-Apr-2024 10:04                3878
function.strtotime.php                             14-Apr-2024 10:04               15463
function.strtoupper.php                            14-Apr-2024 10:04                3861
function.strtr.php                                 14-Apr-2024 10:04                6102
function.strval.php                                14-Apr-2024 10:04                6374
function.substr-compare.php                        14-Apr-2024 10:04                7562
function.substr-count.php                          14-Apr-2024 10:04                3619
function.substr-replace.php                        14-Apr-2024 10:04                8709
function.substr.php                                14-Apr-2024 10:04               12066
function.svn-add.php                               14-Apr-2024 10:04                6486
function.svn-auth-get-parameter.php                14-Apr-2024 10:04                4036
function.svn-auth-set-parameter.php                14-Apr-2024 10:04                5483
function.svn-blame.php                             14-Apr-2024 10:04                4980
function.svn-cat.php                               14-Apr-2024 10:04                4898
function.svn-checkout.php                          14-Apr-2024 10:04                7488
function.svn-cleanup.php                           14-Apr-2024 10:04                5258
function.svn-client-version.php                    14-Apr-2024 10:04                3558
function.svn-commit.php                            14-Apr-2024 10:04                8172
function.svn-delete.php                            14-Apr-2024 10:04                4820
function.svn-diff.php                              14-Apr-2024 10:04               13467
function.svn-export.php                            14-Apr-2024 10:04                5363
function.svn-fs-abort-txn.php                      14-Apr-2024 10:04                3296
function.svn-fs-apply-text.php                     14-Apr-2024 10:04                2855
function.svn-fs-begin-txn2.php                     14-Apr-2024 10:04                2798
function.svn-fs-change-node-prop.php               14-Apr-2024 10:04                3326
function.svn-fs-check-path.php                     14-Apr-2024 10:04                2900
function.svn-fs-contents-changed.php               14-Apr-2024 10:04                3331
function.svn-fs-copy.php                           14-Apr-2024 10:04                4289
function.svn-fs-delete.php                         14-Apr-2024 10:04                3574
function.svn-fs-dir-entries.php                    14-Apr-2024 10:04                2913
function.svn-fs-file-contents.php                  14-Apr-2024 10:04                2936
function.svn-fs-file-length.php                    14-Apr-2024 10:04                2859
function.svn-fs-is-dir.php                         14-Apr-2024 10:04                3612
function.svn-fs-is-file.php                        14-Apr-2024 10:04                3600
function.svn-fs-make-dir.php                       14-Apr-2024 10:04                3598
function.svn-fs-make-file.php                      14-Apr-2024 10:04                3615
function.svn-fs-node-created-rev.php               14-Apr-2024 10:04                2902
function.svn-fs-node-prop.php                      14-Apr-2024 10:04                3000
function.svn-fs-props-changed.php                  14-Apr-2024 10:04                3318
function.svn-fs-revision-prop.php                  14-Apr-2024 10:04                3013
function.svn-fs-revision-root.php                  14-Apr-2024 10:04                2881
function.svn-fs-txn-root.php                       14-Apr-2024 10:04                2646
function.svn-fs-youngest-rev.php                   14-Apr-2024 10:04                2688
function.svn-import.php                            14-Apr-2024 10:04                6148
function.svn-log.php                               14-Apr-2024 10:04                9163
function.svn-ls.php                                14-Apr-2024 10:04                7417
function.svn-mkdir.php                             14-Apr-2024 10:04                3279
function.svn-repos-create.php                      14-Apr-2024 10:04                3066
function.svn-repos-fs-begin-txn-for-commit.php     14-Apr-2024 10:04                3386
function.svn-repos-fs-commit-txn.php               14-Apr-2024 10:04                2743
function.svn-repos-fs.php                          14-Apr-2024 10:04                2643
function.svn-repos-hotcopy.php                     14-Apr-2024 10:04                3012
function.svn-repos-open.php                        14-Apr-2024 10:04                2615
function.svn-repos-recover.php                     14-Apr-2024 10:04                2659
function.svn-revert.php                            14-Apr-2024 10:04                3616
function.svn-status.php                            14-Apr-2024 10:04               14823
function.svn-update.php                            14-Apr-2024 10:04                6286
function.swoole-async-dns-lookup.php               14-Apr-2024 10:04                3858
function.swoole-async-read.php                     14-Apr-2024 10:04                4458
function.swoole-async-readfile.php                 14-Apr-2024 10:04                3881
function.swoole-async-set.php                      14-Apr-2024 10:04                2415
function.swoole-async-write.php                    14-Apr-2024 10:04                3761
function.swoole-async-writefile.php                14-Apr-2024 10:04                3789
function.swoole-clear-error.php                    14-Apr-2024 10:04                2280
function.swoole-client-select.php                  14-Apr-2024 10:04                3490
function.swoole-cpu-num.php                        14-Apr-2024 10:04                2124
function.swoole-errno.php                          14-Apr-2024 10:04                2101
function.swoole-error-log.php                      14-Apr-2024 10:04                3566
function.swoole-event-add.php                      14-Apr-2024 10:04                3497
function.swoole-event-defer.php                    14-Apr-2024 10:04                2644
function.swoole-event-del.php                      14-Apr-2024 10:04                2610
function.swoole-event-exit.php                     14-Apr-2024 10:04                2167
function.swoole-event-set.php                      14-Apr-2024 10:04                3485
function.swoole-event-wait.php                     14-Apr-2024 10:04                2138
function.swoole-event-write.php                    14-Apr-2024 10:04                2882
function.swoole-get-local-ip.php                   14-Apr-2024 10:04                2195
function.swoole-last-error.php                     14-Apr-2024 10:04                2150
function.swoole-load-module.php                    14-Apr-2024 10:04                2308
function.swoole-select.php                         14-Apr-2024 10:04                3457
function.swoole-set-process-name.php               14-Apr-2024 10:04                2630
function.swoole-strerror.php                       14-Apr-2024 10:04                2584
function.swoole-timer-after.php                    14-Apr-2024 10:04                3008
function.swoole-timer-exists.php                   14-Apr-2024 10:04                2421
function.swoole-timer-tick.php                     14-Apr-2024 10:04                2885
function.swoole-version.php                        14-Apr-2024 10:04                2129
function.symlink.php                               14-Apr-2024 10:04                3008
function.sys-get-temp-dir.php                      14-Apr-2024 10:04                4128
function.sys-getloadavg.php                        14-Apr-2024 10:04                4143
function.syslog.php                                14-Apr-2024 10:04                7116
function.system.php                                14-Apr-2024 10:04                7706
function.taint.php                                 14-Apr-2024 10:04                2708
function.tan.php                                   14-Apr-2024 10:04                3070
function.tanh.php                                  14-Apr-2024 10:04                2345
function.tcpwrap-check.php                         14-Apr-2024 10:04                5810
function.tempnam.php                               14-Apr-2024 10:04                6065
function.textdomain.php                            14-Apr-2024 10:04                3225
function.tidy-access-count.php                     14-Apr-2024 10:04                6387
function.tidy-config-count.php                     14-Apr-2024 10:04                4300
function.tidy-error-count.php                      14-Apr-2024 10:04                5321
function.tidy-get-output.php                       14-Apr-2024 10:04                4267
function.tidy-warning-count.php                    14-Apr-2024 10:04                4876
function.time-nanosleep.php                        14-Apr-2024 10:04                8579
function.time-sleep-until.php                      14-Apr-2024 10:04                5756
function.time.php                                  14-Apr-2024 10:04                1966
function.timezone-abbreviations-list.php           14-Apr-2024 10:04                1887
function.timezone-identifiers-list.php             14-Apr-2024 10:04                1903
function.timezone-location-get.php                 14-Apr-2024 10:04                1859
function.timezone-name-from-abbr.php               14-Apr-2024 10:04                6250
function.timezone-name-get.php                     14-Apr-2024 10:04                1803
function.timezone-offset-get.php                   14-Apr-2024 10:04                1801
function.timezone-open.php                         14-Apr-2024 10:04                1789
function.timezone-transitions-get.php              14-Apr-2024 10:04                1862
function.timezone-version-get.php                  14-Apr-2024 10:04                4357
function.tmpfile.php                               14-Apr-2024 10:04                4441
function.token-get-all.php                         14-Apr-2024 10:04               11903
function.token-name.php                            14-Apr-2024 10:04                4135
function.touch.php                                 14-Apr-2024 10:04                3953
function.trader-acos.php                           14-Apr-2024 10:04                2463
function.trader-ad.php                             14-Apr-2024 10:04                3378
function.trader-add.php                            14-Apr-2024 10:04                2795
function.trader-adosc.php                          14-Apr-2024 10:04                4238
function.trader-adx.php                            14-Apr-2024 10:04                3464
function.trader-adxr.php                           14-Apr-2024 10:04                3475
function.trader-apo.php                            14-Apr-2024 10:04                3664
function.trader-aroon.php                          14-Apr-2024 10:04                3032
function.trader-aroonosc.php                       14-Apr-2024 10:04                3069
function.trader-asin.php                           14-Apr-2024 10:04                2479
function.trader-atan.php                           14-Apr-2024 10:04                2472
function.trader-atr.php                            14-Apr-2024 10:04                3454
function.trader-avgprice.php                       14-Apr-2024 10:04                3435
function.trader-bbands.php                         14-Apr-2024 10:04                4423
function.trader-beta.php                           14-Apr-2024 10:04                3000
function.trader-bop.php                            14-Apr-2024 10:04                3384
function.trader-cci.php                            14-Apr-2024 10:04                3459
function.trader-cdl2crows.php                      14-Apr-2024 10:04                3457
function.trader-cdl3blackcrows.php                 14-Apr-2024 10:04                3519
function.trader-cdl3inside.php                     14-Apr-2024 10:04                3500
function.trader-cdl3linestrike.php                 14-Apr-2024 10:04                3523
function.trader-cdl3outside.php                    14-Apr-2024 10:04                3515
function.trader-cdl3starsinsouth.php               14-Apr-2024 10:04                3564
function.trader-cdl3whitesoldiers.php              14-Apr-2024 10:04                3588
function.trader-cdlabandonedbaby.php               14-Apr-2024 10:04                3976
function.trader-cdladvanceblock.php                14-Apr-2024 10:04                3541
function.trader-cdlbelthold.php                    14-Apr-2024 10:04                3497
function.trader-cdlbreakaway.php                   14-Apr-2024 10:04                3511
function.trader-cdlclosingmarubozu.php             14-Apr-2024 10:04                3582
function.trader-cdlconcealbabyswall.php            14-Apr-2024 10:04                3605
function.trader-cdlcounterattack.php               14-Apr-2024 10:04                3569
function.trader-cdldarkcloudcover.php              14-Apr-2024 10:04                3970
function.trader-cdldoji.php                        14-Apr-2024 10:04                3454
function.trader-cdldojistar.php                    14-Apr-2024 10:04                3489
function.trader-cdldragonflydoji.php               14-Apr-2024 10:04                3544
function.trader-cdlengulfing.php                   14-Apr-2024 10:04                3529
function.trader-cdleveningdojistar.php             14-Apr-2024 10:04                3987
function.trader-cdleveningstar.php                 14-Apr-2024 10:04                3964
function.trader-cdlgapsidesidewhite.php            14-Apr-2024 10:04                3612
function.trader-cdlgravestonedoji.php              14-Apr-2024 10:04                3565
function.trader-cdlhammer.php                      14-Apr-2024 10:04                3480
function.trader-cdlhangingman.php                  14-Apr-2024 10:04                3501
function.trader-cdlharami.php                      14-Apr-2024 10:04                3482
function.trader-cdlharamicross.php                 14-Apr-2024 10:04                3524
function.trader-cdlhighwave.php                    14-Apr-2024 10:04                3498
function.trader-cdlhikkake.php                     14-Apr-2024 10:04                3487
function.trader-cdlhikkakemod.php                  14-Apr-2024 10:04                3528
function.trader-cdlhomingpigeon.php                14-Apr-2024 10:04                3549
function.trader-cdlidentical3crows.php             14-Apr-2024 10:04                3573
function.trader-cdlinneck.php                      14-Apr-2024 10:04                3499
function.trader-cdlinvertedhammer.php              14-Apr-2024 10:04                3547
function.trader-cdlkicking.php                     14-Apr-2024 10:04                3501
function.trader-cdlkickingbylength.php             14-Apr-2024 10:04                3607
function.trader-cdlladderbottom.php                14-Apr-2024 10:04                3557
function.trader-cdllongleggeddoji.php              14-Apr-2024 10:04                3562
function.trader-cdllongline.php                    14-Apr-2024 10:04                3506
function.trader-cdlmarubozu.php                    14-Apr-2024 10:04                3492
function.trader-cdlmatchinglow.php                 14-Apr-2024 10:04                3518
function.trader-cdlmathold.php                     14-Apr-2024 10:04                3910
function.trader-cdlmorningdojistar.php             14-Apr-2024 10:04                3983
function.trader-cdlmorningstar.php                 14-Apr-2024 10:04                3944
function.trader-cdlonneck.php                      14-Apr-2024 10:04                3479
function.trader-cdlpiercing.php                    14-Apr-2024 10:04                3496
function.trader-cdlrickshawman.php                 14-Apr-2024 10:04                3536
function.trader-cdlrisefall3methods.php            14-Apr-2024 10:04                3606
function.trader-cdlseparatinglines.php             14-Apr-2024 10:04                3588
function.trader-cdlshootingstar.php                14-Apr-2024 10:04                3547
function.trader-cdlshortline.php                   14-Apr-2024 10:04                3519
function.trader-cdlspinningtop.php                 14-Apr-2024 10:04                3534
function.trader-cdlstalledpattern.php              14-Apr-2024 10:04                3569
function.trader-cdlsticksandwich.php               14-Apr-2024 10:04                3550
function.trader-cdltakuri.php                      14-Apr-2024 10:04                3521
function.trader-cdltasukigap.php                   14-Apr-2024 10:04                3496
function.trader-cdlthrusting.php                   14-Apr-2024 10:04                3505
function.trader-cdltristar.php                     14-Apr-2024 10:04                3493
function.trader-cdlunique3river.php                14-Apr-2024 10:04                3544
function.trader-cdlupsidegap2crows.php             14-Apr-2024 10:04                3592
function.trader-cdlxsidegap3methods.php            14-Apr-2024 10:04                3591
function.trader-ceil.php                           14-Apr-2024 10:04                2496
function.trader-cmo.php                            14-Apr-2024 10:04                2713
function.trader-correl.php                         14-Apr-2024 10:04                3052
function.trader-cos.php                            14-Apr-2024 10:04                2462
function.trader-cosh.php                           14-Apr-2024 10:04                2478
function.trader-dema.php                           14-Apr-2024 10:04                2724
function.trader-div.php                            14-Apr-2024 10:04                2811
function.trader-dx.php                             14-Apr-2024 10:04                3440
function.trader-ema.php                            14-Apr-2024 10:04                2707
function.trader-errno.php                          14-Apr-2024 10:04                2194
function.trader-exp.php                            14-Apr-2024 10:04                2506
function.trader-floor.php                          14-Apr-2024 10:04                2488
function.trader-get-compat.php                     14-Apr-2024 10:04                2384
function.trader-get-unstable-period.php            14-Apr-2024 10:04                2710
function.trader-ht-dcperiod.php                    14-Apr-2024 10:04                2476
function.trader-ht-dcphase.php                     14-Apr-2024 10:04                2447
function.trader-ht-phasor.php                      14-Apr-2024 10:04                2428
function.trader-ht-sine.php                        14-Apr-2024 10:04                2407
function.trader-ht-trendline.php                   14-Apr-2024 10:04                2468
function.trader-ht-trendmode.php                   14-Apr-2024 10:04                2458
function.trader-kama.php                           14-Apr-2024 10:04                2762
function.trader-linearreg-angle.php                14-Apr-2024 10:04                2856
function.trader-linearreg-intercept.php            14-Apr-2024 10:04                2914
function.trader-linearreg-slope.php                14-Apr-2024 10:04                2866
function.trader-linearreg.php                      14-Apr-2024 10:04                2778
function.trader-ln.php                             14-Apr-2024 10:04                2464
function.trader-log10.php                          14-Apr-2024 10:04                2468
function.trader-ma.php                             14-Apr-2024 10:04                3128
function.trader-macd.php                           14-Apr-2024 10:04                3649
function.trader-macdext.php                        14-Apr-2024 10:04                5142
function.trader-macdfix.php                        14-Apr-2024 10:04                2808
function.trader-mama.php                           14-Apr-2024 10:04                3149
function.trader-mavp.php                           14-Apr-2024 10:04                4056
function.trader-max.php                            14-Apr-2024 10:04                2728
function.trader-maxindex.php                       14-Apr-2024 10:04                2785
function.trader-medprice.php                       14-Apr-2024 10:04                2699
function.trader-mfi.php                            14-Apr-2024 10:04                3803
function.trader-midpoint.php                       14-Apr-2024 10:04                2759
function.trader-midprice.php                       14-Apr-2024 10:04                3083
function.trader-min.php                            14-Apr-2024 10:04                2735
function.trader-minindex.php                       14-Apr-2024 10:04                2780
function.trader-minmax.php                         14-Apr-2024 10:04                2784
function.trader-minmaxindex.php                    14-Apr-2024 10:04                2835
function.trader-minus-di.php                       14-Apr-2024 10:04                3527
function.trader-minus-dm.php                       14-Apr-2024 10:04                3083
function.trader-mom.php                            14-Apr-2024 10:04                2699
function.trader-mult.php                           14-Apr-2024 10:04                2811
function.trader-natr.php                           14-Apr-2024 10:04                3465
function.trader-obv.php                            14-Apr-2024 10:04                2652
function.trader-plus-di.php                        14-Apr-2024 10:04                3498
function.trader-plus-dm.php                        14-Apr-2024 10:04                3070
function.trader-ppo.php                            14-Apr-2024 10:04                3668
function.trader-roc.php                            14-Apr-2024 10:04                2723
function.trader-rocp.php                           14-Apr-2024 10:04                2751
function.trader-rocr.php                           14-Apr-2024 10:04                2736
function.trader-rocr100.php                        14-Apr-2024 10:04                2776
function.trader-rsi.php                            14-Apr-2024 10:04                2704
function.trader-sar.php                            14-Apr-2024 10:04                3714
function.trader-sarext.php                         14-Apr-2024 10:04                7126
function.trader-set-compat.php                     14-Apr-2024 10:04                2624
function.trader-set-unstable-period.php            14-Apr-2024 10:04                3212
function.trader-sin.php                            14-Apr-2024 10:04                2486
function.trader-sinh.php                           14-Apr-2024 10:04                2474
function.trader-sma.php                            14-Apr-2024 10:04                2704
function.trader-sqrt.php                           14-Apr-2024 10:04                2467
function.trader-stddev.php                         14-Apr-2024 10:04                3048
function.trader-stoch.php                          14-Apr-2024 10:04                5332
function.trader-stochf.php                         14-Apr-2024 10:04                4439
function.trader-stochrsi.php                       14-Apr-2024 10:04                4181
function.trader-sub.php                            14-Apr-2024 10:04                2816
function.trader-sum.php                            14-Apr-2024 10:04                2686
function.trader-t3.php                             14-Apr-2024 10:04                3065
function.trader-tan.php                            14-Apr-2024 10:04                2455
function.trader-tanh.php                           14-Apr-2024 10:04                2479
function.trader-tema.php                           14-Apr-2024 10:04                2730
function.trader-trange.php                         14-Apr-2024 10:04                2987
function.trader-trima.php                          14-Apr-2024 10:04                2732
function.trader-trix.php                           14-Apr-2024 10:04                2742
function.trader-tsf.php                            14-Apr-2024 10:04                2711
function.trader-typprice.php                       14-Apr-2024 10:04                3010
function.trader-ultosc.php                         14-Apr-2024 10:04                4322
function.trader-var.php                            14-Apr-2024 10:04                3018
function.trader-wclprice.php                       14-Apr-2024 10:04                3015
function.trader-willr.php                          14-Apr-2024 10:04                3471
function.trader-wma.php                            14-Apr-2024 10:04                2722
function.trait-exists.php                          14-Apr-2024 10:04                3057
function.trigger-error.php                         14-Apr-2024 10:04                3964
function.trim.php                                  14-Apr-2024 10:04               10067
function.uasort.php                                14-Apr-2024 10:04                3662
function.ucfirst.php                               14-Apr-2024 10:04                4281
function.ucwords.php                               14-Apr-2024 10:04                4530
function.ui-draw-text-font-fontfamilies.php        14-Apr-2024 10:04                2396
function.ui-quit.php                               14-Apr-2024 10:04                2034
function.ui-run.php                                14-Apr-2024 10:04                2410
function.uksort.php                                14-Apr-2024 10:04                6846
function.umask.php                                 14-Apr-2024 10:04                2302
function.uniqid.php                                14-Apr-2024 10:04                7610
function.unixtojd.php                              14-Apr-2024 10:04                2251
function.unlink.php                                14-Apr-2024 10:04                3385
function.unpack.php                                14-Apr-2024 10:04               10511
function.unregister-tick-function.php              14-Apr-2024 10:04                3160
function.unserialize.php                           14-Apr-2024 10:04               11538
function.unset.php                                 14-Apr-2024 10:04               14778
function.untaint.php                               14-Apr-2024 10:04                2531
function.uopz-add-function.php                     14-Apr-2024 10:04                7140
function.uopz-allow-exit.php                       14-Apr-2024 10:04                4622
function.uopz-backup.php                           14-Apr-2024 10:04                4566
function.uopz-compose.php                          14-Apr-2024 10:04                6838
function.uopz-copy.php                             14-Apr-2024 10:04                5153
function.uopz-del-function.php                     14-Apr-2024 10:04                6578
function.uopz-delete.php                           14-Apr-2024 10:04                5978
function.uopz-extend.php                           14-Apr-2024 10:04                5029
function.uopz-flags.php                            14-Apr-2024 10:04               10955
function.uopz-function.php                         14-Apr-2024 10:04                7310
function.uopz-get-exit-status.php                  14-Apr-2024 10:04                4173
function.uopz-get-hook.php                         14-Apr-2024 10:04                5328
function.uopz-get-mock.php                         14-Apr-2024 10:04                4946
function.uopz-get-property.php                     14-Apr-2024 10:04                6191
function.uopz-get-return.php                       14-Apr-2024 10:04                4432
function.uopz-get-static.php                       14-Apr-2024 10:04                5146
function.uopz-implement.php                        14-Apr-2024 10:04                5054
function.uopz-overload.php                         14-Apr-2024 10:04                3919
function.uopz-redefine.php                         14-Apr-2024 10:04                5139
function.uopz-rename.php                           14-Apr-2024 10:04                6763
function.uopz-restore.php                          14-Apr-2024 10:04                4933
function.uopz-set-hook.php                         14-Apr-2024 10:04                5662
function.uopz-set-mock.php                         14-Apr-2024 10:04               10817
function.uopz-set-property.php                     14-Apr-2024 10:04                7499
function.uopz-set-return.php                       14-Apr-2024 10:04                9634
function.uopz-set-static.php                       14-Apr-2024 10:04                5752
function.uopz-undefine.php                         14-Apr-2024 10:04                4697
function.uopz-unset-hook.php                       14-Apr-2024 10:04                5553
function.uopz-unset-mock.php                       14-Apr-2024 10:04                5311
function.uopz-unset-return.php                     14-Apr-2024 10:04                4908
function.urldecode.php                             14-Apr-2024 10:04                6251
function.urlencode.php                             14-Apr-2024 10:04                9595
function.use-soap-error-handler.php                14-Apr-2024 10:04                3951
function.user-error.php                            14-Apr-2024 10:04                1681
function.usleep.php                                14-Apr-2024 10:04                5522
function.usort.php                                 14-Apr-2024 10:04               15511
function.utf8-decode.php                           14-Apr-2024 10:04               18663
function.utf8-encode.php                           14-Apr-2024 10:04               15223
function.var-dump.php                              14-Apr-2024 10:04                6907
function.var-export.php                            14-Apr-2024 10:04               14696
function.var-representation.php                    14-Apr-2024 10:04               13316
function.variant-abs.php                           14-Apr-2024 10:04                4093
function.variant-add.php                           14-Apr-2024 10:04                5459
function.variant-and.php                           14-Apr-2024 10:04                7512
function.variant-cast.php                          14-Apr-2024 10:04                3518
function.variant-cat.php                           14-Apr-2024 10:04                4640
function.variant-cmp.php                           14-Apr-2024 10:04                7923
function.variant-date-from-timestamp.php           14-Apr-2024 10:04                3653
function.variant-date-to-timestamp.php             14-Apr-2024 10:04                3807
function.variant-div.php                           14-Apr-2024 10:04                6331
function.variant-eqv.php                           14-Apr-2024 10:04                4358
function.variant-fix.php                           14-Apr-2024 10:04                5452
function.variant-get-type.php                      14-Apr-2024 10:04                3508
function.variant-idiv.php                          14-Apr-2024 10:04                5697
function.variant-imp.php                           14-Apr-2024 10:04                7059
function.variant-int.php                           14-Apr-2024 10:04                4952
function.variant-mod.php                           14-Apr-2024 10:04                4700
function.variant-mul.php                           14-Apr-2024 10:04                5812
function.variant-neg.php                           14-Apr-2024 10:04                3760
function.variant-not.php                           14-Apr-2024 10:04                4026
function.variant-or.php                            14-Apr-2024 10:04                7668
function.variant-pow.php                           14-Apr-2024 10:04                4547
function.variant-round.php                         14-Apr-2024 10:04                4430
function.variant-set-type.php                      14-Apr-2024 10:04                3657
function.variant-set.php                           14-Apr-2024 10:04                2886
function.variant-sub.php                           14-Apr-2024 10:04                5382
function.variant-xor.php                           14-Apr-2024 10:04                6407
function.version-compare.php                       14-Apr-2024 10:04                6406
function.vfprintf.php                              14-Apr-2024 10:04                4996
function.virtual.php                               14-Apr-2024 10:04                5370
function.vprintf.php                               14-Apr-2024 10:04                2913
function.vsprintf.php                              14-Apr-2024 10:04                2734
function.wddx-add-vars.php                         14-Apr-2024 10:04                3765
function.wddx-deserialize.php                      14-Apr-2024 10:04                3511
function.wddx-packet-end.php                       14-Apr-2024 10:04                2826
function.wddx-packet-start.php                     14-Apr-2024 10:04                3005
function.wddx-serialize-value.php                  14-Apr-2024 10:04                3235
function.wddx-serialize-vars.php                   14-Apr-2024 10:04                5965
function.win32-continue-service.php                14-Apr-2024 10:04                6654
function.win32-create-service.php                  14-Apr-2024 10:04               28730
function.win32-delete-service.php                  14-Apr-2024 10:04                7112
function.win32-get-last-control-message.php        14-Apr-2024 10:04                8707
function.win32-pause-service.php                   14-Apr-2024 10:04                6653
function.win32-query-service-status.php            14-Apr-2024 10:04                8637
function.win32-send-custom-control.php             14-Apr-2024 10:04                7317
function.win32-set-service-exit-code.php           14-Apr-2024 10:04                5849
function.win32-set-service-exit-mode.php           14-Apr-2024 10:04                5997
function.win32-set-service-status.php              14-Apr-2024 10:04                9412
function.win32-start-service-ctrl-dispatcher.php   14-Apr-2024 10:04               11318
function.win32-start-service.php                   14-Apr-2024 10:04                6657
function.win32-stop-service.php                    14-Apr-2024 10:04                6579
function.wincache-fcache-fileinfo.php              14-Apr-2024 10:04                9269
function.wincache-fcache-meminfo.php               14-Apr-2024 10:04                7097
function.wincache-lock.php                         14-Apr-2024 10:04                8533
function.wincache-ocache-fileinfo.php              14-Apr-2024 10:04                9931
function.wincache-ocache-meminfo.php               14-Apr-2024 10:04                7283
function.wincache-refresh-if-changed.php           14-Apr-2024 10:04                7836
function.wincache-rplist-fileinfo.php              14-Apr-2024 10:04                7637
function.wincache-rplist-meminfo.php               14-Apr-2024 10:04                7212
function.wincache-scache-info.php                  14-Apr-2024 10:04                9555
function.wincache-scache-meminfo.php               14-Apr-2024 10:04                6699
function.wincache-ucache-add.php                   14-Apr-2024 10:04               13582
function.wincache-ucache-cas.php                   14-Apr-2024 10:04                6500
function.wincache-ucache-clear.php                 14-Apr-2024 10:04                7601
function.wincache-ucache-dec.php                   14-Apr-2024 10:04                6430
function.wincache-ucache-delete.php                14-Apr-2024 10:04               11419
function.wincache-ucache-exists.php                14-Apr-2024 10:04                6184
function.wincache-ucache-get.php                   14-Apr-2024 10:04               10585
function.wincache-ucache-inc.php                   14-Apr-2024 10:04                6422
function.wincache-ucache-info.php                  14-Apr-2024 10:04               11376
function.wincache-ucache-meminfo.php               14-Apr-2024 10:04                6888
function.wincache-ucache-set.php                   14-Apr-2024 10:04               13648
function.wincache-unlock.php                       14-Apr-2024 10:04                7795
function.wordwrap.php                              14-Apr-2024 10:04                6798
function.xattr-get.php                             14-Apr-2024 10:04                6060
function.xattr-list.php                            14-Apr-2024 10:04                6512
function.xattr-remove.php                          14-Apr-2024 10:04                6316
function.xattr-set.php                             14-Apr-2024 10:04                8061
function.xattr-supported.php                       14-Apr-2024 10:04                5326
function.xdiff-file-bdiff-size.php                 14-Apr-2024 10:04                4836
function.xdiff-file-bdiff.php                      14-Apr-2024 10:04                5955
function.xdiff-file-bpatch.php                     14-Apr-2024 10:04                6512
function.xdiff-file-diff-binary.php                14-Apr-2024 10:04                6377
function.xdiff-file-diff.php                       14-Apr-2024 10:04                7392
function.xdiff-file-merge3.php                     14-Apr-2024 10:04                6799
function.xdiff-file-patch-binary.php               14-Apr-2024 10:04                6665
function.xdiff-file-patch.php                      14-Apr-2024 10:04                8907
function.xdiff-file-rabdiff.php                    14-Apr-2024 10:04                6511
function.xdiff-string-bdiff-size.php               14-Apr-2024 10:04                5152
function.xdiff-string-bdiff.php                    14-Apr-2024 10:04                3855
function.xdiff-string-bpatch.php                   14-Apr-2024 10:04                3953
function.xdiff-string-diff-binary.php              14-Apr-2024 10:04                4345
function.xdiff-string-diff.php                     14-Apr-2024 10:04                7622
function.xdiff-string-merge3.php                   14-Apr-2024 10:04                4802
function.xdiff-string-patch-binary.php             14-Apr-2024 10:04                4487
function.xdiff-string-patch.php                    14-Apr-2024 10:04                8273
function.xdiff-string-rabdiff.php                  14-Apr-2024 10:04                4462
function.xhprof-disable.php                        14-Apr-2024 10:04                3978
function.xhprof-enable.php                         14-Apr-2024 10:04                7143
function.xhprof-sample-disable.php                 14-Apr-2024 10:04                4661
function.xhprof-sample-enable.php                  14-Apr-2024 10:04                3502
function.xml-error-string.php                      14-Apr-2024 10:04                3280
function.xml-get-current-byte-index.php            14-Apr-2024 10:04                4063
function.xml-get-current-column-number.php         14-Apr-2024 10:04                3827
function.xml-get-current-line-number.php           14-Apr-2024 10:04                3649
function.xml-get-error-code.php                    14-Apr-2024 10:04                3328
function.xml-parse-into-struct.php                 14-Apr-2024 10:04               18910
function.xml-parse.php                             14-Apr-2024 10:04                5003
function.xml-parser-create-ns.php                  14-Apr-2024 10:04                4643
function.xml-parser-create.php                     14-Apr-2024 10:04                4166
function.xml-parser-free.php                       14-Apr-2024 10:04                2836
function.xml-parser-get-option.php                 14-Apr-2024 10:04                3774
function.xml-parser-set-option.php                 14-Apr-2024 10:04                5933
function.xml-set-character-data-handler.php        14-Apr-2024 10:04                5515
function.xml-set-default-handler.php               14-Apr-2024 10:04                5397
function.xml-set-element-handler.php               14-Apr-2024 10:04                8417
function.xml-set-end-namespace-decl-handler.php    14-Apr-2024 10:04                6811
function.xml-set-external-entity-ref-handler.php   14-Apr-2024 10:04                8023
function.xml-set-notation-decl-handler.php         14-Apr-2024 10:04                7552
function.xml-set-object.php                        14-Apr-2024 10:04                8701
function.xml-set-processing-instruction-handler..> 14-Apr-2024 10:04                6643
function.xml-set-start-namespace-decl-handler.php  14-Apr-2024 10:04                7001
function.xml-set-unparsed-entity-decl-handler.php  14-Apr-2024 10:04                8211
function.xmlrpc-decode-request.php                 14-Apr-2024 10:04                2854
function.xmlrpc-decode.php                         14-Apr-2024 10:04                4172
function.xmlrpc-encode-request.php                 14-Apr-2024 10:04                8637
function.xmlrpc-encode.php                         14-Apr-2024 10:04                2428
function.xmlrpc-get-type.php                       14-Apr-2024 10:04                6391
function.xmlrpc-is-fault.php                       14-Apr-2024 10:04                4015
function.xmlrpc-parse-method-descriptions.php      14-Apr-2024 10:04                2633
function.xmlrpc-server-add-introspection-data.php  14-Apr-2024 10:04                2829
function.xmlrpc-server-call-method.php             14-Apr-2024 10:04                3244
function.xmlrpc-server-create.php                  14-Apr-2024 10:04                2343
function.xmlrpc-server-destroy.php                 14-Apr-2024 10:04                2560
function.xmlrpc-server-register-introspection-c..> 14-Apr-2024 10:04                2915
function.xmlrpc-server-register-method.php         14-Apr-2024 10:04                2995
function.xmlrpc-set-type.php                       14-Apr-2024 10:04                5588
function.yaml-emit-file.php                        14-Apr-2024 10:04                6733
function.yaml-emit.php                             14-Apr-2024 10:04               12323
function.yaml-parse-file.php                       14-Apr-2024 10:04                6052
function.yaml-parse-url.php                        14-Apr-2024 10:04                6380
function.yaml-parse.php                            14-Apr-2024 10:04                9911
function.yaz-addinfo.php                           14-Apr-2024 10:04                3386
function.yaz-ccl-conf.php                          14-Apr-2024 10:04                5686
function.yaz-ccl-parse.php                         14-Apr-2024 10:04                6745
function.yaz-close.php                             14-Apr-2024 10:04                3551
function.yaz-connect.php                           14-Apr-2024 10:04                9106
function.yaz-database.php                          14-Apr-2024 10:04                3434
function.yaz-element.php                           14-Apr-2024 10:04                3866
function.yaz-errno.php                             14-Apr-2024 10:04                3622
function.yaz-error.php                             14-Apr-2024 10:04                3377
function.yaz-es-result.php                         14-Apr-2024 10:04                3295
function.yaz-es.php                                14-Apr-2024 10:04                7144
function.yaz-get-option.php                        14-Apr-2024 10:04                3372
function.yaz-hits.php                              14-Apr-2024 10:04                4855
function.yaz-itemorder.php                         14-Apr-2024 10:04                7051
function.yaz-present.php                           14-Apr-2024 10:04                3010
function.yaz-range.php                             14-Apr-2024 10:04                3612
function.yaz-record.php                            14-Apr-2024 10:04               14207
function.yaz-scan-result.php                       14-Apr-2024 10:04                4006
function.yaz-scan.php                              14-Apr-2024 10:04                9345
function.yaz-schema.php                            14-Apr-2024 10:04                3448
function.yaz-search.php                            14-Apr-2024 10:04                8692
function.yaz-set-option.php                        14-Apr-2024 10:04                7011
function.yaz-sort.php                              14-Apr-2024 10:04                5569
function.yaz-syntax.php                            14-Apr-2024 10:04                3406
function.yaz-wait.php                              14-Apr-2024 10:04                4147
function.zend-thread-id.php                        14-Apr-2024 10:04                3724
function.zend-version.php                          14-Apr-2024 10:04                3009
function.zip-close.php                             14-Apr-2024 10:04                3028
function.zip-entry-close.php                       14-Apr-2024 10:04                3381
function.zip-entry-compressedsize.php              14-Apr-2024 10:04                3304
function.zip-entry-compressionmethod.php           14-Apr-2024 10:04                3395
function.zip-entry-filesize.php                    14-Apr-2024 10:04                3250
function.zip-entry-name.php                        14-Apr-2024 10:04                3185
function.zip-entry-open.php                        14-Apr-2024 10:04                5074
function.zip-entry-read.php                        14-Apr-2024 10:04                4062
function.zip-open.php                              14-Apr-2024 10:04                3305
function.zip-read.php                              14-Apr-2024 10:04                3666
function.zlib-decode.php                           14-Apr-2024 10:04                3448
function.zlib-encode.php                           14-Apr-2024 10:04                5373
function.zlib-get-coding-type.php                  14-Apr-2024 10:04                2887
function.zookeeper-dispatch.php                    14-Apr-2024 10:04                8309
functional.parallel.php                            14-Apr-2024 10:04                2554
functions.anonymous.php                            14-Apr-2024 10:04               24323
functions.arguments.php                            14-Apr-2024 10:04               37872
functions.arrow.php                                14-Apr-2024 10:04               10215
functions.first_class_callable_syntax.php          14-Apr-2024 10:04               11325
functions.internal.php                             14-Apr-2024 10:04                5227
functions.returning-values.php                     14-Apr-2024 10:04                6327
functions.user-defined.php                         14-Apr-2024 10:04                9520
functions.variable-functions.php                   14-Apr-2024 10:04               11450
gearman.configuration.php                          14-Apr-2024 10:04                1247
gearman.constants.php                              14-Apr-2024 10:04               23802
gearman.examples-reverse-bg.php                    14-Apr-2024 10:04               10659
gearman.examples-reverse-task.php                  14-Apr-2024 10:04               17308
gearman.examples-reverse.php                       14-Apr-2024 10:04               12732
gearman.examples.php                               14-Apr-2024 10:04                1554
gearman.installation.php                           14-Apr-2024 10:04                1604
gearman.requirements.php                           14-Apr-2024 10:04                1478
gearman.resources.php                              14-Apr-2024 10:04                1216
gearman.setup.php                                  14-Apr-2024 10:04                1577
gearmanclient.addoptions.php                       14-Apr-2024 10:04                3323
gearmanclient.addserver.php                        14-Apr-2024 10:04                5461
gearmanclient.addservers.php                       14-Apr-2024 10:04                4903
gearmanclient.addtask.php                          14-Apr-2024 10:04               15104
gearmanclient.addtaskbackground.php                14-Apr-2024 10:04               20862
gearmanclient.addtaskhigh.php                      14-Apr-2024 10:04               11610
gearmanclient.addtaskhighbackground.php            14-Apr-2024 10:04                6524
gearmanclient.addtasklow.php                       14-Apr-2024 10:04               11592
gearmanclient.addtasklowbackground.php             14-Apr-2024 10:04                6517
gearmanclient.addtaskstatus.php                    14-Apr-2024 10:04                9800
gearmanclient.clearcallbacks.php                   14-Apr-2024 10:04                4341
gearmanclient.clone.php                            14-Apr-2024 10:04                2637
gearmanclient.construct.php                        14-Apr-2024 10:04                2815
gearmanclient.context.php                          14-Apr-2024 10:04                2883
gearmanclient.data.php                             14-Apr-2024 10:04                3148
gearmanclient.do.php                               14-Apr-2024 10:04               22129
gearmanclient.dobackground.php                     14-Apr-2024 10:04                9617
gearmanclient.dohigh.php                           14-Apr-2024 10:04                5074
gearmanclient.dohighbackground.php                 14-Apr-2024 10:04                4901
gearmanclient.dojobhandle.php                      14-Apr-2024 10:04                2940
gearmanclient.dolow.php                            14-Apr-2024 10:04                5060
gearmanclient.dolowbackground.php                  14-Apr-2024 10:04                4883
gearmanclient.donormal.php                         14-Apr-2024 10:04               22697
gearmanclient.dostatus.php                         14-Apr-2024 10:04                8118
gearmanclient.echo.php                             14-Apr-2024 10:04                2979
gearmanclient.error.php                            14-Apr-2024 10:04                2875
gearmanclient.geterrno.php                         14-Apr-2024 10:04                2650
gearmanclient.jobstatus.php                        14-Apr-2024 10:04                8310
gearmanclient.ping.php                             14-Apr-2024 10:04                2952
gearmanclient.removeoptions.php                    14-Apr-2024 10:04                2671
gearmanclient.returncode.php                       14-Apr-2024 10:04                2293
gearmanclient.runtasks.php                         14-Apr-2024 10:04                3710
gearmanclient.setclientcallback.php                14-Apr-2024 10:04                5355
gearmanclient.setcompletecallback.php              14-Apr-2024 10:04                5241
gearmanclient.setcontext.php                       14-Apr-2024 10:04                3216
gearmanclient.setcreatedcallback.php               14-Apr-2024 10:04                4780
gearmanclient.setdata.php                          14-Apr-2024 10:04                3414
gearmanclient.setdatacallback.php                  14-Apr-2024 10:04                4765
gearmanclient.setexceptioncallback.php             14-Apr-2024 10:04                4685
gearmanclient.setfailcallback.php                  14-Apr-2024 10:04                4771
gearmanclient.setoptions.php                       14-Apr-2024 10:04                2657
gearmanclient.setstatuscallback.php                14-Apr-2024 10:04                4771
gearmanclient.settimeout.php                       14-Apr-2024 10:04                2701
gearmanclient.setwarningcallback.php               14-Apr-2024 10:04                4774
gearmanclient.setworkloadcallback.php              14-Apr-2024 10:04                4928
gearmanclient.timeout.php                          14-Apr-2024 10:04                2745
gearmanclient.wait.php                             14-Apr-2024 10:04                2792
gearmanjob.complete.php                            14-Apr-2024 10:04                3578
gearmanjob.construct.php                           14-Apr-2024 10:04                2327
gearmanjob.data.php                                14-Apr-2024 10:04                3538
gearmanjob.exception.php                           14-Apr-2024 10:04                3745
gearmanjob.fail.php                                14-Apr-2024 10:04                3671
gearmanjob.functionname.php                        14-Apr-2024 10:04                2921
gearmanjob.handle.php                              14-Apr-2024 10:04                2808
gearmanjob.returncode.php                          14-Apr-2024 10:04                2605
gearmanjob.sendcomplete.php                        14-Apr-2024 10:04                3299
gearmanjob.senddata.php                            14-Apr-2024 10:04                3266
gearmanjob.sendexception.php                       14-Apr-2024 10:04                3479
gearmanjob.sendfail.php                            14-Apr-2024 10:04                3390
gearmanjob.sendstatus.php                          14-Apr-2024 10:04                3994
gearmanjob.sendwarning.php                         14-Apr-2024 10:04                3475
gearmanjob.setreturn.php                           14-Apr-2024 10:04                2543
gearmanjob.status.php                              14-Apr-2024 10:04                4275
gearmanjob.unique.php                              14-Apr-2024 10:04                3045
gearmanjob.warning.php                             14-Apr-2024 10:04                3756
gearmanjob.workload.php                            14-Apr-2024 10:04                2803
gearmanjob.workloadsize.php                        14-Apr-2024 10:04                2621
gearmantask.construct.php                          14-Apr-2024 10:04                2352
gearmantask.create.php                             14-Apr-2024 10:04                2786
gearmantask.data.php                               14-Apr-2024 10:04                2782
gearmantask.datasize.php                           14-Apr-2024 10:04                2805
gearmantask.function.php                           14-Apr-2024 10:04                2637
gearmantask.functionname.php                       14-Apr-2024 10:04                2574
gearmantask.isknown.php                            14-Apr-2024 10:04                2450
gearmantask.isrunning.php                          14-Apr-2024 10:04                2450
gearmantask.jobhandle.php                          14-Apr-2024 10:04                2954
gearmantask.recvdata.php                           14-Apr-2024 10:04                3553
gearmantask.returncode.php                         14-Apr-2024 10:04                2632
gearmantask.senddata.php                           14-Apr-2024 10:04                3366
gearmantask.sendworkload.php                       14-Apr-2024 10:04                3515
gearmantask.taskdenominator.php                    14-Apr-2024 10:04                2998
gearmantask.tasknumerator.php                      14-Apr-2024 10:04                2970
gearmantask.unique.php                             14-Apr-2024 10:04                3215
gearmantask.uuid.php                               14-Apr-2024 10:04                3388
gearmanworker.addfunction.php                      14-Apr-2024 10:04                7889
gearmanworker.addoptions.php                       14-Apr-2024 10:04                3374
gearmanworker.addserver.php                        14-Apr-2024 10:04                5188
gearmanworker.addservers.php                       14-Apr-2024 10:04                4625
gearmanworker.clone.php                            14-Apr-2024 10:04                2308
gearmanworker.construct.php                        14-Apr-2024 10:04                2788
gearmanworker.echo.php                             14-Apr-2024 10:04                3010
gearmanworker.error.php                            14-Apr-2024 10:04                2842
gearmanworker.geterrno.php                         14-Apr-2024 10:04                2617
gearmanworker.options.php                          14-Apr-2024 10:04                2624
gearmanworker.register.php                         14-Apr-2024 10:04                3767
gearmanworker.removeoptions.php                    14-Apr-2024 10:04                3396
gearmanworker.returncode.php                       14-Apr-2024 10:04                2812
gearmanworker.setid.php                            14-Apr-2024 10:04                4079
gearmanworker.setoptions.php                       14-Apr-2024 10:04                3529
gearmanworker.settimeout.php                       14-Apr-2024 10:04                7774
gearmanworker.timeout.php                          14-Apr-2024 10:04                2724
gearmanworker.unregister.php                       14-Apr-2024 10:04                3331
gearmanworker.unregisterall.php                    14-Apr-2024 10:04                2988
gearmanworker.wait.php                             14-Apr-2024 10:04                7867
gearmanworker.work.php                             14-Apr-2024 10:04                5569
gender-gender.connect.php                          14-Apr-2024 10:04                2541
gender-gender.construct.php                        14-Apr-2024 10:04                2392
gender-gender.country.php                          14-Apr-2024 10:04                3793
gender-gender.get.php                              14-Apr-2024 10:04                2857
gender-gender.isnick.php                           14-Apr-2024 10:04                3470
gender-gender.similarnames.php                     14-Apr-2024 10:04                2970
gender.example.admin.php                           14-Apr-2024 10:04                8037
gender.examples.php                                14-Apr-2024 10:04                1332
gender.installation.php                            14-Apr-2024 10:04                1997
gender.setup.php                                   14-Apr-2024 10:04                1363
generator.current.php                              14-Apr-2024 10:04                2093
generator.getreturn.php                            14-Apr-2024 10:04                3818
generator.key.php                                  14-Apr-2024 10:04                3884
generator.next.php                                 14-Apr-2024 10:04                2431
generator.rewind.php                               14-Apr-2024 10:04                2183
generator.send.php                                 14-Apr-2024 10:04                5512
generator.throw.php                                14-Apr-2024 10:04                5082
generator.valid.php                                14-Apr-2024 10:04                2299
generator.wakeup.php                               14-Apr-2024 10:04                2176
geoip.configuration.php                            14-Apr-2024 10:04                2465
geoip.constants.php                                14-Apr-2024 10:04                6253
geoip.installation.php                             14-Apr-2024 10:04                1738
geoip.requirements.php                             14-Apr-2024 10:04                1681
geoip.resources.php                                14-Apr-2024 10:04                1172
geoip.setup.php                                    14-Apr-2024 10:04                1538
gettext.configuration.php                          14-Apr-2024 10:04                1247
gettext.constants.php                              14-Apr-2024 10:04                1133
gettext.installation.php                           14-Apr-2024 10:04                1366
gettext.requirements.php                           14-Apr-2024 10:04                1355
gettext.resources.php                              14-Apr-2024 10:04                1186
gettext.setup.php                                  14-Apr-2024 10:04                1581
getting-started.php                                14-Apr-2024 10:04                2005
globiterator.construct.php                         14-Apr-2024 10:04                7672
globiterator.count.php                             14-Apr-2024 10:04                4431
gmagick.addimage.php                               14-Apr-2024 10:04                2834
gmagick.addnoiseimage.php                          14-Apr-2024 10:04                2889
gmagick.annotateimage.php                          14-Apr-2024 10:04                4424
gmagick.blurimage.php                              14-Apr-2024 10:04                3285
gmagick.borderimage.php                            14-Apr-2024 10:04                3734
gmagick.charcoalimage.php                          14-Apr-2024 10:04                3235
gmagick.chopimage.php                              14-Apr-2024 10:04                3887
gmagick.clear.php                                  14-Apr-2024 10:04                2583
gmagick.commentimage.php                           14-Apr-2024 10:04                2836
gmagick.compositeimage.php                         14-Apr-2024 10:04                4050
gmagick.configuration.php                          14-Apr-2024 10:04                1252
gmagick.constants.php                              14-Apr-2024 10:04              103115
gmagick.construct.php                              14-Apr-2024 10:04                2590
gmagick.cropimage.php                              14-Apr-2024 10:04                4022
gmagick.cropthumbnailimage.php                     14-Apr-2024 10:04                3272
gmagick.current.php                                14-Apr-2024 10:04                2484
gmagick.cyclecolormapimage.php                     14-Apr-2024 10:04                2962
gmagick.deconstructimages.php                      14-Apr-2024 10:04                2732
gmagick.despeckleimage.php                         14-Apr-2024 10:04                3425
gmagick.destroy.php                                14-Apr-2024 10:04                2724
gmagick.drawimage.php                              14-Apr-2024 10:04                2958
gmagick.edgeimage.php                              14-Apr-2024 10:04                2905
gmagick.embossimage.php                            14-Apr-2024 10:04                3413
gmagick.enhanceimage.php                           14-Apr-2024 10:04                2594
gmagick.equalizeimage.php                          14-Apr-2024 10:04                2553
gmagick.examples.php                               14-Apr-2024 10:04                3361
gmagick.flipimage.php                              14-Apr-2024 10:04                2892
gmagick.flopimage.php                              14-Apr-2024 10:04                2889
gmagick.frameimage.php                             14-Apr-2024 10:04                4559
gmagick.gammaimage.php                             14-Apr-2024 10:04                3116
gmagick.getcopyright.php                           14-Apr-2024 10:04                2575
gmagick.getfilename.php                            14-Apr-2024 10:04                2525
gmagick.getimagebackgroundcolor.php                14-Apr-2024 10:04                2662
gmagick.getimageblueprimary.php                    14-Apr-2024 10:04                2964
gmagick.getimagebordercolor.php                    14-Apr-2024 10:04                2706
gmagick.getimagechanneldepth.php                   14-Apr-2024 10:04                2767
gmagick.getimagecolors.php                         14-Apr-2024 10:04                2561
gmagick.getimagecolorspace.php                     14-Apr-2024 10:04                2519
gmagick.getimagecompose.php                        14-Apr-2024 10:04                2599
gmagick.getimagedelay.php                          14-Apr-2024 10:04                2496
gmagick.getimagedepth.php                          14-Apr-2024 10:04                2466
gmagick.getimagedispose.php                        14-Apr-2024 10:04                2520
gmagick.getimageextrema.php                        14-Apr-2024 10:04                2726
gmagick.getimagefilename.php                       14-Apr-2024 10:04                2604
gmagick.getimageformat.php                         14-Apr-2024 10:04                2587
gmagick.getimagegamma.php                          14-Apr-2024 10:04                2487
gmagick.getimagegreenprimary.php                   14-Apr-2024 10:04                2706
gmagick.getimageheight.php                         14-Apr-2024 10:04                2518
gmagick.getimagehistogram.php                      14-Apr-2024 10:04                2879
gmagick.getimageindex.php                          14-Apr-2024 10:04                2649
gmagick.getimageinterlacescheme.php                14-Apr-2024 10:04                2637
gmagick.getimageiterations.php                     14-Apr-2024 10:04                2564
gmagick.getimagematte.php                          14-Apr-2024 10:04                2904
gmagick.getimagemattecolor.php                     14-Apr-2024 10:04                2612
gmagick.getimageprofile.php                        14-Apr-2024 10:04                2719
gmagick.getimageredprimary.php                     14-Apr-2024 10:04                2727
gmagick.getimagerenderingintent.php                14-Apr-2024 10:04                2648
gmagick.getimageresolution.php                     14-Apr-2024 10:04                2580
gmagick.getimagescene.php                          14-Apr-2024 10:04                2483
gmagick.getimagesignature.php                      14-Apr-2024 10:04                2598
gmagick.getimagetype.php                           14-Apr-2024 10:04                2490
gmagick.getimageunits.php                          14-Apr-2024 10:04                2258
gmagick.getimagewhitepoint.php                     14-Apr-2024 10:04                2703
gmagick.getimagewidth.php                          14-Apr-2024 10:04                2497
gmagick.getpackagename.php                         14-Apr-2024 10:04                2551
gmagick.getquantumdepth.php                        14-Apr-2024 10:04                2728
gmagick.getreleasedate.php                         14-Apr-2024 10:04                2585
gmagick.getsamplingfactors.php                     14-Apr-2024 10:04                2638
gmagick.getsize.php                                14-Apr-2024 10:04                2787
gmagick.getversion.php                             14-Apr-2024 10:04                2528
gmagick.hasnextimage.php                           14-Apr-2024 10:04                2885
gmagick.haspreviousimage.php                       14-Apr-2024 10:04                2929
gmagick.implodeimage.php                           14-Apr-2024 10:04                2945
gmagick.installation.php                           14-Apr-2024 10:04                1959
gmagick.labelimage.php                             14-Apr-2024 10:04                2714
gmagick.levelimage.php                             14-Apr-2024 10:04                4665
gmagick.magnifyimage.php                           14-Apr-2024 10:04                2579
gmagick.mapimage.php                               14-Apr-2024 10:04                3250
gmagick.medianfilterimage.php                      14-Apr-2024 10:04                3034
gmagick.minifyimage.php                            14-Apr-2024 10:04                2613
gmagick.modulateimage.php                          14-Apr-2024 10:04                3863
gmagick.motionblurimage.php                        14-Apr-2024 10:04                3888
gmagick.newimage.php                               14-Apr-2024 10:04                3910
gmagick.nextimage.php                              14-Apr-2024 10:04                2745
gmagick.normalizeimage.php                         14-Apr-2024 10:04                2990
gmagick.oilpaintimage.php                          14-Apr-2024 10:04                3006
gmagick.previousimage.php                          14-Apr-2024 10:04                2740
gmagick.profileimage.php                           14-Apr-2024 10:04                3564
gmagick.quantizeimage.php                          14-Apr-2024 10:04                5333
gmagick.quantizeimages.php                         14-Apr-2024 10:04                5336
gmagick.queryfontmetrics.php                       14-Apr-2024 10:04                2906
gmagick.queryfonts.php                             14-Apr-2024 10:04                2682
gmagick.queryformats.php                           14-Apr-2024 10:04                3084
gmagick.radialblurimage.php                        14-Apr-2024 10:04                3210
gmagick.raiseimage.php                             14-Apr-2024 10:04                4401
gmagick.read.php                                   14-Apr-2024 10:04                2729
gmagick.readimage.php                              14-Apr-2024 10:04                2779
gmagick.readimageblob.php                          14-Apr-2024 10:04                3202
gmagick.readimagefile.php                          14-Apr-2024 10:04                3079
gmagick.reducenoiseimage.php                       14-Apr-2024 10:04                3184
gmagick.removeimage.php                            14-Apr-2024 10:04                2561
gmagick.removeimageprofile.php                     14-Apr-2024 10:04                2891
gmagick.requirements.php                           14-Apr-2024 10:04                1641
gmagick.resampleimage.php                          14-Apr-2024 10:04                3913
gmagick.resizeimage.php                            14-Apr-2024 10:04                4250
gmagick.rollimage.php                              14-Apr-2024 10:04                2989
gmagick.rotateimage.php                            14-Apr-2024 10:04                3164
gmagick.scaleimage.php                             14-Apr-2024 10:04                3532
gmagick.separateimagechannel.php                   14-Apr-2024 10:04                3176
gmagick.setcompressionquality.php                  14-Apr-2024 10:04                4181
gmagick.setfilename.php                            14-Apr-2024 10:04                2909
gmagick.setimagebackgroundcolor.php                14-Apr-2024 10:04                2978
gmagick.setimageblueprimary.php                    14-Apr-2024 10:04                3272
gmagick.setimagebordercolor.php                    14-Apr-2024 10:04                2940
gmagick.setimagechanneldepth.php                   14-Apr-2024 10:04                3419
gmagick.setimagecolorspace.php                     14-Apr-2024 10:04                3061
gmagick.setimagecompose.php                        14-Apr-2024 10:04                2827
gmagick.setimagedelay.php                          14-Apr-2024 10:04                2841
gmagick.setimagedepth.php                          14-Apr-2024 10:04                2839
gmagick.setimagedispose.php                        14-Apr-2024 10:04                2883
gmagick.setimagefilename.php                       14-Apr-2024 10:04                2933
gmagick.setimageformat.php                         14-Apr-2024 10:04                2896
gmagick.setimagegamma.php                          14-Apr-2024 10:04                2833
gmagick.setimagegreenprimary.php                   14-Apr-2024 10:04                3280
gmagick.setimageindex.php                          14-Apr-2024 10:04                2980
gmagick.setimageinterlacescheme.php                14-Apr-2024 10:04                3127
gmagick.setimageiterations.php                     14-Apr-2024 10:04                2936
gmagick.setimageprofile.php                        14-Apr-2024 10:04                3369
gmagick.setimageredprimary.php                     14-Apr-2024 10:04                3183
gmagick.setimagerenderingintent.php                14-Apr-2024 10:04                3158
gmagick.setimageresolution.php                     14-Apr-2024 10:04                3177
gmagick.setimagescene.php                          14-Apr-2024 10:04                2829
gmagick.setimagetype.php                           14-Apr-2024 10:04                2954
gmagick.setimageunits.php                          14-Apr-2024 10:04                3013
gmagick.setimagewhitepoint.php                     14-Apr-2024 10:04                3209
gmagick.setsamplingfactors.php                     14-Apr-2024 10:04                3055
gmagick.setsize.php                                14-Apr-2024 10:04                3525
gmagick.setup.php                                  14-Apr-2024 10:04                1504
gmagick.shearimage.php                             14-Apr-2024 10:04                3907
gmagick.solarizeimage.php                          14-Apr-2024 10:04                3087
gmagick.spreadimage.php                            14-Apr-2024 10:04                2931
gmagick.stripimage.php                             14-Apr-2024 10:04                2541
gmagick.swirlimage.php                             14-Apr-2024 10:04                3012
gmagick.thumbnailimage.php                         14-Apr-2024 10:04                3843
gmagick.trimimage.php                              14-Apr-2024 10:04                3076
gmagick.write.php                                  14-Apr-2024 10:04                1692
gmagick.writeimage.php                             14-Apr-2024 10:04                3488
gmagickdraw.annotate.php                           14-Apr-2024 10:04                3171
gmagickdraw.arc.php                                14-Apr-2024 10:04                4331
gmagickdraw.bezier.php                             14-Apr-2024 10:04                2610
gmagickdraw.ellipse.php                            14-Apr-2024 10:04                4252
gmagickdraw.getfillcolor.php                       14-Apr-2024 10:04                2428
gmagickdraw.getfillopacity.php                     14-Apr-2024 10:04                2379
gmagickdraw.getfont.php                            14-Apr-2024 10:04                2370
gmagickdraw.getfontsize.php                        14-Apr-2024 10:04                2421
gmagickdraw.getfontstyle.php                       14-Apr-2024 10:04                2497
gmagickdraw.getfontweight.php                      14-Apr-2024 10:04                2342
gmagickdraw.getstrokecolor.php                     14-Apr-2024 10:04                2483
gmagickdraw.getstrokeopacity.php                   14-Apr-2024 10:04                2456
gmagickdraw.getstrokewidth.php                     14-Apr-2024 10:04                2475
gmagickdraw.gettextdecoration.php                  14-Apr-2024 10:04                2409
gmagickdraw.gettextencoding.php                    14-Apr-2024 10:04                2498
gmagickdraw.line.php                               14-Apr-2024 10:04                3615
gmagickdraw.point.php                              14-Apr-2024 10:04                2902
gmagickdraw.polygon.php                            14-Apr-2024 10:04                2677
gmagickdraw.polyline.php                           14-Apr-2024 10:04                2712
gmagickdraw.rectangle.php                          14-Apr-2024 10:04                3719
gmagickdraw.rotate.php                             14-Apr-2024 10:04                2668
gmagickdraw.roundrectangle.php                     14-Apr-2024 10:04                4496
gmagickdraw.scale.php                              14-Apr-2024 10:04                2966
gmagickdraw.setfillcolor.php                       14-Apr-2024 10:04                2928
gmagickdraw.setfillopacity.php                     14-Apr-2024 10:04                2766
gmagickdraw.setfont.php                            14-Apr-2024 10:04                2666
gmagickdraw.setfontsize.php                        14-Apr-2024 10:04                2696
gmagickdraw.setfontstyle.php                       14-Apr-2024 10:04                2827
gmagickdraw.setfontweight.php                      14-Apr-2024 10:04                2698
gmagickdraw.setstrokecolor.php                     14-Apr-2024 10:04                2952
gmagickdraw.setstrokeopacity.php                   14-Apr-2024 10:04                2784
gmagickdraw.setstrokewidth.php                     14-Apr-2024 10:04                2744
gmagickdraw.settextdecoration.php                  14-Apr-2024 10:04                2830
gmagickdraw.settextencoding.php                    14-Apr-2024 10:04                3038
gmagickpixel.construct.php                         14-Apr-2024 10:04                2538
gmagickpixel.getcolor.php                          14-Apr-2024 10:04                4330
gmagickpixel.getcolorcount.php                     14-Apr-2024 10:04                2470
gmagickpixel.getcolorvalue.php                     14-Apr-2024 10:04                2874
gmagickpixel.setcolor.php                          14-Apr-2024 10:04                3005
gmagickpixel.setcolorvalue.php                     14-Apr-2024 10:04                3284
gmp.configuration.php                              14-Apr-2024 10:04                1219
gmp.constants.php                                  14-Apr-2024 10:04                4121
gmp.examples.php                                   14-Apr-2024 10:04                3023
gmp.installation.php                               14-Apr-2024 10:04                1312
gmp.requirements.php                               14-Apr-2024 10:04                1662
gmp.resources.php                                  14-Apr-2024 10:04                1371
gmp.setup.php                                      14-Apr-2024 10:04                1529
gnupg.configuration.php                            14-Apr-2024 10:04                1231
gnupg.constants.php                                14-Apr-2024 10:04                9351
gnupg.examples-clearsign.php                       14-Apr-2024 10:04                6291
gnupg.examples.php                                 14-Apr-2024 10:04                1336
gnupg.installation.php                             14-Apr-2024 10:04                1585
gnupg.requirements.php                             14-Apr-2024 10:04                1245
gnupg.resources.php                                14-Apr-2024 10:04                1172
gnupg.setup.php                                    14-Apr-2024 10:04                1556
hash.configuration.php                             14-Apr-2024 10:04                1226
hash.constants.php                                 14-Apr-2024 10:04                1775
hash.installation.php                              14-Apr-2024 10:04                1602
hash.requirements.php                              14-Apr-2024 10:04                1196
hash.resources.php                                 14-Apr-2024 10:04                1279
hash.setup.php                                     14-Apr-2024 10:04                1537
hashcontext.construct.php                          14-Apr-2024 10:04                1895
hashcontext.serialize.php                          14-Apr-2024 10:04                2391
hashcontext.unserialize.php                        14-Apr-2024 10:04                2695
history.php                                        14-Apr-2024 10:04                2126
history.php.books.php                              14-Apr-2024 10:04                2546
history.php.php                                    14-Apr-2024 10:04               10760
history.php.publications.php                       14-Apr-2024 10:04                1783
history.php.related.php                            14-Apr-2024 10:04                5945
hrtime-performancecounter.getfrequency.php         14-Apr-2024 10:04                2726
hrtime-performancecounter.getticks.php             14-Apr-2024 10:04                2599
hrtime-performancecounter.gettickssince.php        14-Apr-2024 10:04                2903
hrtime-stopwatch.getelapsedticks.php               14-Apr-2024 10:04                2501
hrtime-stopwatch.getelapsedtime.php                14-Apr-2024 10:04                2898
hrtime-stopwatch.getlastelapsedticks.php           14-Apr-2024 10:04                2569
hrtime-stopwatch.getlastelapsedtime.php            14-Apr-2024 10:04                2922
hrtime-stopwatch.isrunning.php                     14-Apr-2024 10:04                2462
hrtime-stopwatch.start.php                         14-Apr-2024 10:04                2363
hrtime-stopwatch.stop.php                          14-Apr-2024 10:04                2242
hrtime.example.basic.php                           14-Apr-2024 10:04                5415
hrtime.examples.php                                14-Apr-2024 10:04                1326
hrtime.installation.php                            14-Apr-2024 10:04                1997
hrtime.setup.php                                   14-Apr-2024 10:04                1360
ibase.configuration.php                            14-Apr-2024 10:04                7941
ibase.constants.php                                14-Apr-2024 10:04               21298
ibase.installation.php                             14-Apr-2024 10:04                3360
ibase.requirements.php                             14-Apr-2024 10:04                1169
ibase.resources.php                                14-Apr-2024 10:04                1172
ibase.setup.php                                    14-Apr-2024 10:04                1574
ibm-db2.configuration.php                          14-Apr-2024 10:04               20806
ibm-db2.constants.php                              14-Apr-2024 10:04                9041
ibm-db2.installation.php                           14-Apr-2024 10:04                3473
ibm-db2.requirements.php                           14-Apr-2024 10:04                3184
ibm-db2.resources.php                              14-Apr-2024 10:04                1240
ibm-db2.setup.php                                  14-Apr-2024 10:04                1586
iconv.configuration.php                            14-Apr-2024 10:04                4785
iconv.constants.php                                14-Apr-2024 10:04                3835
iconv.installation.php                             14-Apr-2024 10:04                1541
iconv.requirements.php                             14-Apr-2024 10:04                1461
iconv.resources.php                                14-Apr-2024 10:04                1172
iconv.setup.php                                    14-Apr-2024 10:04                1563
igbinary.configuration.php                         14-Apr-2024 10:04                3434
igbinary.installation.php                          14-Apr-2024 10:04                1988
igbinary.requirements.php                          14-Apr-2024 10:04                1190
igbinary.setup.php                                 14-Apr-2024 10:04                1511
image.configuration.php                            14-Apr-2024 10:04                3330
image.constants.php                                14-Apr-2024 10:04               52395
image.examples-png.php                             14-Apr-2024 10:04                4685
image.examples-watermark.php                       14-Apr-2024 10:04                5760
image.examples.merged-watermark.php                14-Apr-2024 10:04                8519
image.examples.php                                 14-Apr-2024 10:04                1552
image.installation.php                             14-Apr-2024 10:04                5934
image.requirements.php                             14-Apr-2024 10:04                4377
image.resources.php                                14-Apr-2024 10:04                2010
image.setup.php                                    14-Apr-2024 10:04                1559
imagick.adaptiveblurimage.php                      14-Apr-2024 10:04                6954
imagick.adaptiveresizeimage.php                    14-Apr-2024 10:04                9067
imagick.adaptivesharpenimage.php                   14-Apr-2024 10:04                6461
imagick.adaptivethresholdimage.php                 14-Apr-2024 10:04                6221
imagick.addimage.php                               14-Apr-2024 10:04                2911
imagick.addnoiseimage.php                          14-Apr-2024 10:04                5580
imagick.affinetransformimage.php                   14-Apr-2024 10:04                6617
imagick.animateimages.php                          14-Apr-2024 10:04                3167
imagick.annotateimage.php                          14-Apr-2024 10:04                8659
imagick.appendimages.php                           14-Apr-2024 10:04                6679
imagick.autolevelimage.php                         14-Apr-2024 10:04                4448
imagick.averageimages.php                          14-Apr-2024 10:04                2704
imagick.blackthresholdimage.php                    14-Apr-2024 10:04                5289
imagick.blueshiftimage.php                         14-Apr-2024 10:04                4493
imagick.blurimage.php                              14-Apr-2024 10:04                5750
imagick.borderimage.php                            14-Apr-2024 10:04                6039
imagick.brightnesscontrastimage.php                14-Apr-2024 10:04                5653
imagick.charcoalimage.php                          14-Apr-2024 10:04                4986
imagick.chopimage.php                              14-Apr-2024 10:04                7005
imagick.clampimage.php                             14-Apr-2024 10:04                2715
imagick.clear.php                                  14-Apr-2024 10:04                2264
imagick.clipimage.php                              14-Apr-2024 10:04                2511
imagick.clipimagepath.php                          14-Apr-2024 10:04                3138
imagick.clippathimage.php                          14-Apr-2024 10:04                3513
imagick.clone.php                                  14-Apr-2024 10:04                4121
imagick.clutimage.php                              14-Apr-2024 10:04                6025
imagick.coalesceimages.php                         14-Apr-2024 10:04                2798
imagick.colorfloodfillimage.php                    14-Apr-2024 10:04                5437
imagick.colorizeimage.php                          14-Apr-2024 10:04                6869
imagick.colormatriximage.php                       14-Apr-2024 10:04                7616
imagick.combineimages.php                          14-Apr-2024 10:04                3355
imagick.commentimage.php                           14-Apr-2024 10:04                4965
imagick.compareimagechannels.php                   14-Apr-2024 10:04                3937
imagick.compareimagelayers.php                     14-Apr-2024 10:04                5471
imagick.compareimages.php                          14-Apr-2024 10:04                5630
imagick.compositeimage.php                         14-Apr-2024 10:04                7997
imagick.configuration.php                          14-Apr-2024 10:04                4407
imagick.constants.php                              14-Apr-2024 10:04              160940
imagick.construct.php                              14-Apr-2024 10:04                2571
imagick.contrastimage.php                          14-Apr-2024 10:04                5026
imagick.contraststretchimage.php                   14-Apr-2024 10:04                3954
imagick.convolveimage.php                          14-Apr-2024 10:04                5942
imagick.count.php                                  14-Apr-2024 10:04                2695
imagick.cropimage.php                              14-Apr-2024 10:04                6143
imagick.cropthumbnailimage.php                     14-Apr-2024 10:04                3525
imagick.current.php                                14-Apr-2024 10:04                2459
imagick.cyclecolormapimage.php                     14-Apr-2024 10:04                2994
imagick.decipherimage.php                          14-Apr-2024 10:04                3259
imagick.deconstructimages.php                      14-Apr-2024 10:04                2614
imagick.deleteimageartifact.php                    14-Apr-2024 10:04                3667
imagick.deleteimageproperty.php                    14-Apr-2024 10:04                2642
imagick.deskewimage.php                            14-Apr-2024 10:04               11007
imagick.despeckleimage.php                         14-Apr-2024 10:04                4252
imagick.destroy.php                                14-Apr-2024 10:04                2402
imagick.displayimage.php                           14-Apr-2024 10:04                2795
imagick.displayimages.php                          14-Apr-2024 10:04                2839
imagick.distortimage.php                           14-Apr-2024 10:04               11853
imagick.drawimage.php                              14-Apr-2024 10:04                2630
imagick.edgeimage.php                              14-Apr-2024 10:04                4664
imagick.embossimage.php                            14-Apr-2024 10:04                5361
imagick.encipherimage.php                          14-Apr-2024 10:04                3255
imagick.enhanceimage.php                           14-Apr-2024 10:04                4219
imagick.equalizeimage.php                          14-Apr-2024 10:04                4186
imagick.evaluateimage.php                          14-Apr-2024 10:04                5918
imagick.examples-1.php                             14-Apr-2024 10:04               29866
imagick.examples.php                               14-Apr-2024 10:04                1338
imagick.exportimagepixels.php                      14-Apr-2024 10:04                7928
imagick.extentimage.php                            14-Apr-2024 10:04                5258
imagick.filter.php                                 14-Apr-2024 10:04                7594
imagick.flattenimages.php                          14-Apr-2024 10:04                2822
imagick.flipimage.php                              14-Apr-2024 10:04                4520
imagick.floodfillpaintimage.php                    14-Apr-2024 10:04               11591
imagick.flopimage.php                              14-Apr-2024 10:04                4552
imagick.forwardfouriertransformimage.php           14-Apr-2024 10:04               12080
imagick.frameimage.php                             14-Apr-2024 10:04                8321
imagick.functionimage.php                          14-Apr-2024 10:04               13735
imagick.fximage.php                                14-Apr-2024 10:04                6042
imagick.gammaimage.php                             14-Apr-2024 10:04                5703
imagick.gaussianblurimage.php                      14-Apr-2024 10:04                6239
imagick.getcolorspace.php                          14-Apr-2024 10:04                2441
imagick.getcompression.php                         14-Apr-2024 10:04                2264
imagick.getcompressionquality.php                  14-Apr-2024 10:04                2338
imagick.getcopyright.php                           14-Apr-2024 10:04                2367
imagick.getfilename.php                            14-Apr-2024 10:04                2436
imagick.getfont.php                                14-Apr-2024 10:04                3074
imagick.getformat.php                              14-Apr-2024 10:04                2398
imagick.getgravity.php                             14-Apr-2024 10:04                2420
imagick.gethomeurl.php                             14-Apr-2024 10:04                2244
imagick.getimage.php                               14-Apr-2024 10:04                2440
imagick.getimagealphachannel.php                   14-Apr-2024 10:04                3537
imagick.getimageartifact.php                       14-Apr-2024 10:04                3553
imagick.getimageattribute.php                      14-Apr-2024 10:04                2791
imagick.getimagebackgroundcolor.php                14-Apr-2024 10:04                2606
imagick.getimageblob.php                           14-Apr-2024 10:04                2692
imagick.getimageblueprimary.php                    14-Apr-2024 10:04                2883
imagick.getimagebordercolor.php                    14-Apr-2024 10:04                2627
imagick.getimagechanneldepth.php                   14-Apr-2024 10:04                3219
imagick.getimagechanneldistortion.php              14-Apr-2024 10:04                4085
imagick.getimagechanneldistortions.php             14-Apr-2024 10:04                4487
imagick.getimagechannelextrema.php                 14-Apr-2024 10:04                3631
imagick.getimagechannelkurtosis.php                14-Apr-2024 10:04                3622
imagick.getimagechannelmean.php                    14-Apr-2024 10:04                3249
imagick.getimagechannelrange.php                   14-Apr-2024 10:04                3475
imagick.getimagechannelstatistics.php              14-Apr-2024 10:04                2607
imagick.getimageclipmask.php                       14-Apr-2024 10:04                2959
imagick.getimagecolormapcolor.php                  14-Apr-2024 10:04                2962
imagick.getimagecolors.php                         14-Apr-2024 10:04                2408
imagick.getimagecolorspace.php                     14-Apr-2024 10:04                2391
imagick.getimagecompose.php                        14-Apr-2024 10:04                2413
imagick.getimagecompression.php                    14-Apr-2024 10:04                2352
imagick.getimagecompressionquality.php             14-Apr-2024 10:04                2446
imagick.getimagedelay.php                          14-Apr-2024 10:04                2429
imagick.getimagedepth.php                          14-Apr-2024 10:04                2197
imagick.getimagedispose.php                        14-Apr-2024 10:04                2469
imagick.getimagedistortion.php                     14-Apr-2024 10:04                3254
imagick.getimageextrema.php                        14-Apr-2024 10:04                2867
imagick.getimagefilename.php                       14-Apr-2024 10:04                2543
imagick.getimageformat.php                         14-Apr-2024 10:04                2525
imagick.getimagegamma.php                          14-Apr-2024 10:04                2424
imagick.getimagegeometry.php                       14-Apr-2024 10:04                4144
imagick.getimagegravity.php                        14-Apr-2024 10:04                2713
imagick.getimagegreenprimary.php                   14-Apr-2024 10:04                2694
imagick.getimageheight.php                         14-Apr-2024 10:04                2455
imagick.getimagehistogram.php                      14-Apr-2024 10:04               17184
imagick.getimageindex.php                          14-Apr-2024 10:04                2974
imagick.getimageinterlacescheme.php                14-Apr-2024 10:04                2489
imagick.getimageinterpolatemethod.php              14-Apr-2024 10:04                2728
imagick.getimageiterations.php                     14-Apr-2024 10:04                2517
imagick.getimagelength.php                         14-Apr-2024 10:04                3366
imagick.getimagematte.php                          14-Apr-2024 10:04                2824
imagick.getimagemattecolor.php                     14-Apr-2024 10:04                2782
imagick.getimagemimetype.php                       14-Apr-2024 10:04                2262
imagick.getimageorientation.php                    14-Apr-2024 10:04                2621
imagick.getimagepage.php                           14-Apr-2024 10:04                2686
imagick.getimagepixelcolor.php                     14-Apr-2024 10:04                3149
imagick.getimageprofile.php                        14-Apr-2024 10:04                2793
imagick.getimageprofiles.php                       14-Apr-2024 10:04                3541
imagick.getimageproperties.php                     14-Apr-2024 10:04                5783
imagick.getimageproperty.php                       14-Apr-2024 10:04                4932
imagick.getimageredprimary.php                     14-Apr-2024 10:04                2762
imagick.getimageregion.php                         14-Apr-2024 10:04                3949
imagick.getimagerenderingintent.php                14-Apr-2024 10:04                2645
imagick.getimageresolution.php                     14-Apr-2024 10:04                2521
imagick.getimagesblob.php                          14-Apr-2024 10:04                2522
imagick.getimagescene.php                          14-Apr-2024 10:04                2411
imagick.getimagesignature.php                      14-Apr-2024 10:04                2540
imagick.getimagesize.php                           14-Apr-2024 10:04                2640
imagick.getimagetickspersecond.php                 14-Apr-2024 10:04                2557
imagick.getimagetotalinkdensity.php                14-Apr-2024 10:04                2475
imagick.getimagetype.php                           14-Apr-2024 10:04                4864
imagick.getimageunits.php                          14-Apr-2024 10:04                2473
imagick.getimagevirtualpixelmethod.php             14-Apr-2024 10:04                2624
imagick.getimagewhitepoint.php                     14-Apr-2024 10:04                2674
imagick.getimagewidth.php                          14-Apr-2024 10:04                2429
imagick.getinterlacescheme.php                     14-Apr-2024 10:04                2575
imagick.getiteratorindex.php                       14-Apr-2024 10:04                6081
imagick.getnumberimages.php                        14-Apr-2024 10:04                2524
imagick.getoption.php                              14-Apr-2024 10:04                2767
imagick.getpackagename.php                         14-Apr-2024 10:04                2497
imagick.getpage.php                                14-Apr-2024 10:04                2498
imagick.getpixeliterator.php                       14-Apr-2024 10:04                5970
imagick.getpixelregioniterator.php                 14-Apr-2024 10:04                6717
imagick.getpointsize.php                           14-Apr-2024 10:04                2790
imagick.getquantum.php                             14-Apr-2024 10:04                2290
imagick.getquantumdepth.php                        14-Apr-2024 10:04                2608
imagick.getquantumrange.php                        14-Apr-2024 10:04                2870
imagick.getregistry.php                            14-Apr-2024 10:04                2504
imagick.getreleasedate.php                         14-Apr-2024 10:04                2521
imagick.getresource.php                            14-Apr-2024 10:04                2924
imagick.getresourcelimit.php                       14-Apr-2024 10:04                3342
imagick.getsamplingfactors.php                     14-Apr-2024 10:04                2585
imagick.getsize.php                                14-Apr-2024 10:04                5826
imagick.getsizeoffset.php                          14-Apr-2024 10:04                2573
imagick.getversion.php                             14-Apr-2024 10:04                2507
imagick.haldclutimage.php                          14-Apr-2024 10:04                6107
imagick.hasnextimage.php                           14-Apr-2024 10:04                2640
imagick.haspreviousimage.php                       14-Apr-2024 10:04                2678
imagick.identifyformat.php                         14-Apr-2024 10:04                4453
imagick.identifyimage.php                          14-Apr-2024 10:04                4055
imagick.implodeimage.php                           14-Apr-2024 10:04                4654
imagick.importimagepixels.php                      14-Apr-2024 10:04               11399
imagick.installation.php                           14-Apr-2024 10:04                2993
imagick.inversefouriertransformimage.php           14-Apr-2024 10:04                3501
imagick.labelimage.php                             14-Apr-2024 10:04                2586
imagick.levelimage.php                             14-Apr-2024 10:04                7769
imagick.linearstretchimage.php                     14-Apr-2024 10:04                5669
imagick.liquidrescaleimage.php                     14-Apr-2024 10:04                4518
imagick.listregistry.php                           14-Apr-2024 10:04                2349
imagick.magnifyimage.php                           14-Apr-2024 10:04                4218
imagick.mapimage.php                               14-Apr-2024 10:04                3238
imagick.mattefloodfillimage.php                    14-Apr-2024 10:04                5774
imagick.medianfilterimage.php                      14-Apr-2024 10:04                5126
imagick.mergeimagelayers.php                       14-Apr-2024 10:04                6441
imagick.minifyimage.php                            14-Apr-2024 10:04                2382
imagick.modulateimage.php                          14-Apr-2024 10:04                5617
imagick.montageimage.php                           14-Apr-2024 10:04                4550
imagick.morphimages.php                            14-Apr-2024 10:04                2782
imagick.morphology.php                             14-Apr-2024 10:04               66548
imagick.mosaicimages.php                           14-Apr-2024 10:04                2715
imagick.motionblurimage.php                        14-Apr-2024 10:04                6788
imagick.negateimage.php                            14-Apr-2024 10:04                5553
imagick.newimage.php                               14-Apr-2024 10:04                6289
imagick.newpseudoimage.php                         14-Apr-2024 10:04                5811
imagick.nextimage.php                              14-Apr-2024 10:04                2314
imagick.normalizeimage.php                         14-Apr-2024 10:04                6390
imagick.oilpaintimage.php                          14-Apr-2024 10:04                4595
imagick.opaquepaintimage.php                       14-Apr-2024 10:04                5026
imagick.optimizeimagelayers.php                    14-Apr-2024 10:04                5318
imagick.orderedposterizeimage.php                  14-Apr-2024 10:04                6802
imagick.paintfloodfillimage.php                    14-Apr-2024 10:04                5764
imagick.paintopaqueimage.php                       14-Apr-2024 10:04                5385
imagick.painttransparentimage.php                  14-Apr-2024 10:04                4650
imagick.pingimage.php                              14-Apr-2024 10:04                2708
imagick.pingimageblob.php                          14-Apr-2024 10:04                5957
imagick.pingimagefile.php                          14-Apr-2024 10:04                5789
imagick.polaroidimage.php                          14-Apr-2024 10:04                4745
imagick.posterizeimage.php                         14-Apr-2024 10:04                5628
imagick.previewimages.php                          14-Apr-2024 10:04                3117
imagick.previousimage.php                          14-Apr-2024 10:04                2369
imagick.profileimage.php                           14-Apr-2024 10:04                3205
imagick.quantizeimage.php                          14-Apr-2024 10:04                6693
imagick.quantizeimages.php                         14-Apr-2024 10:04                4034
imagick.queryfontmetrics.php                       14-Apr-2024 10:04                5568
imagick.queryfonts.php                             14-Apr-2024 10:04                4714
imagick.queryformats.php                           14-Apr-2024 10:04                7089
imagick.radialblurimage.php                        14-Apr-2024 10:04                5521
imagick.raiseimage.php                             14-Apr-2024 10:04                6512
imagick.randomthresholdimage.php                   14-Apr-2024 10:04                6427
imagick.readimage.php                              14-Apr-2024 10:04                2550
imagick.readimageblob.php                          14-Apr-2024 10:04                5432
imagick.readimagefile.php                          14-Apr-2024 10:04                3203
imagick.readimages.php                             14-Apr-2024 10:04                2597
imagick.recolorimage.php                           14-Apr-2024 10:04                6327
imagick.reducenoiseimage.php                       14-Apr-2024 10:04                5176
imagick.remapimage.php                             14-Apr-2024 10:04                3452
imagick.removeimage.php                            14-Apr-2024 10:04                2517
imagick.removeimageprofile.php                     14-Apr-2024 10:04                2788
imagick.render.php                                 14-Apr-2024 10:04                2277
imagick.requirements.php                           14-Apr-2024 10:04                1524
imagick.resampleimage.php                          14-Apr-2024 10:04                5621
imagick.resetimagepage.php                         14-Apr-2024 10:04                2808
imagick.resizeimage.php                            14-Apr-2024 10:04               11275
imagick.resources.php                              14-Apr-2024 10:04                1186
imagick.rollimage.php                              14-Apr-2024 10:04                4793
imagick.rotateimage.php                            14-Apr-2024 10:04                5679
imagick.rotationalblurimage.php                    14-Apr-2024 10:04                5750
imagick.roundcorners.php                           14-Apr-2024 10:04                6701
imagick.sampleimage.php                            14-Apr-2024 10:04                2973
imagick.scaleimage.php                             14-Apr-2024 10:04                6955
imagick.segmentimage.php                           14-Apr-2024 10:04                6753
imagick.selectiveblurimage.php                     14-Apr-2024 10:04                6613
imagick.separateimagechannel.php                   14-Apr-2024 10:04                5389
imagick.sepiatoneimage.php                         14-Apr-2024 10:04                4885
imagick.setbackgroundcolor.php                     14-Apr-2024 10:04                3263
imagick.setcolorspace.php                          14-Apr-2024 10:04                3009
imagick.setcompression.php                         14-Apr-2024 10:04                2767
imagick.setcompressionquality.php                  14-Apr-2024 10:04                6917
imagick.setfilename.php                            14-Apr-2024 10:04                2637
imagick.setfirstiterator.php                       14-Apr-2024 10:04                2363
imagick.setfont.php                                14-Apr-2024 10:04                5518
imagick.setformat.php                              14-Apr-2024 10:04                2539
imagick.setgravity.php                             14-Apr-2024 10:04                2728
imagick.setimage.php                               14-Apr-2024 10:04                4696
imagick.setimagealphachannel.php                   14-Apr-2024 10:04                3674
imagick.setimageartifact.php                       14-Apr-2024 10:04                7323
imagick.setimageattribute.php                      14-Apr-2024 10:04                3150
imagick.setimagebackgroundcolor.php                14-Apr-2024 10:04                3504
imagick.setimagebias.php                           14-Apr-2024 10:04                6739
imagick.setimagebiasquantum.php                    14-Apr-2024 10:04                2866
imagick.setimageblueprimary.php                    14-Apr-2024 10:04                3164
imagick.setimagebordercolor.php                    14-Apr-2024 10:04                3482
imagick.setimagechanneldepth.php                   14-Apr-2024 10:04                3181
imagick.setimageclipmask.php                       14-Apr-2024 10:04                8701
imagick.setimagecolormapcolor.php                  14-Apr-2024 10:04                3204
imagick.setimagecolorspace.php                     14-Apr-2024 10:04                3225
imagick.setimagecompose.php                        14-Apr-2024 10:04                2944
imagick.setimagecompression.php                    14-Apr-2024 10:04                2916
imagick.setimagecompressionquality.php             14-Apr-2024 10:04                4877
imagick.setimagedelay.php                          14-Apr-2024 10:04                6158
imagick.setimagedepth.php                          14-Apr-2024 10:04                2762
imagick.setimagedispose.php                        14-Apr-2024 10:04                2806
imagick.setimageextent.php                         14-Apr-2024 10:04                3081
imagick.setimagefilename.php                       14-Apr-2024 10:04                2858
imagick.setimageformat.php                         14-Apr-2024 10:04                2738
imagick.setimagegamma.php                          14-Apr-2024 10:04                2766
imagick.setimagegravity.php                        14-Apr-2024 10:04                2893
imagick.setimagegreenprimary.php                   14-Apr-2024 10:04                3157
imagick.setimageindex.php                          14-Apr-2024 10:04                3358
imagick.setimageinterlacescheme.php                14-Apr-2024 10:04                2926
imagick.setimageinterpolatemethod.php              14-Apr-2024 10:04                2841
imagick.setimageiterations.php                     14-Apr-2024 10:04                5004
imagick.setimagematte.php                          14-Apr-2024 10:04                2766
imagick.setimagemattecolor.php                     14-Apr-2024 10:04                3689
imagick.setimageopacity.php                        14-Apr-2024 10:04                5017
imagick.setimageorientation.php                    14-Apr-2024 10:04                4704
imagick.setimagepage.php                           14-Apr-2024 10:04                3720
imagick.setimageprofile.php                        14-Apr-2024 10:04                3300
imagick.setimageproperty.php                       14-Apr-2024 10:04                5163
imagick.setimageredprimary.php                     14-Apr-2024 10:04                3153
imagick.setimagerenderingintent.php                14-Apr-2024 10:04                2932
imagick.setimageresolution.php                     14-Apr-2024 10:04                4998
imagick.setimagescene.php                          14-Apr-2024 10:04                2786
imagick.setimagetickspersecond.php                 14-Apr-2024 10:04                7727
imagick.setimagetype.php                           14-Apr-2024 10:04                2572
imagick.setimageunits.php                          14-Apr-2024 10:04                2608
imagick.setimagevirtualpixelmethod.php             14-Apr-2024 10:04                2728
imagick.setimagewhitepoint.php                     14-Apr-2024 10:04                3151
imagick.setinterlacescheme.php                     14-Apr-2024 10:04                2656
imagick.setiteratorindex.php                       14-Apr-2024 10:04                6240
imagick.setlastiterator.php                        14-Apr-2024 10:04                2377
imagick.setoption.php                              14-Apr-2024 10:04               11518
imagick.setpage.php                                14-Apr-2024 10:04                3461
imagick.setpointsize.php                           14-Apr-2024 10:04                5221
imagick.setprogressmonitor.php                     14-Apr-2024 10:04               10229
imagick.setregistry.php                            14-Apr-2024 10:04                3054
imagick.setresolution.php                          14-Apr-2024 10:04                3753
imagick.setresourcelimit.php                       14-Apr-2024 10:04                3674
imagick.setsamplingfactors.php                     14-Apr-2024 10:04                6758
imagick.setsize.php                                14-Apr-2024 10:04                2887
imagick.setsizeoffset.php                          14-Apr-2024 10:04                3402
imagick.settype.php                                14-Apr-2024 10:04                2518
imagick.setup.php                                  14-Apr-2024 10:04                1581
imagick.shadeimage.php                             14-Apr-2024 10:04                5639
imagick.shadowimage.php                            14-Apr-2024 10:04                5432
imagick.sharpenimage.php                           14-Apr-2024 10:04                5602
imagick.shaveimage.php                             14-Apr-2024 10:04                4735
imagick.shearimage.php                             14-Apr-2024 10:04                6459
imagick.sigmoidalcontrastimage.php                 14-Apr-2024 10:04                7975
imagick.sketchimage.php                            14-Apr-2024 10:04                5842
imagick.smushimages.php                            14-Apr-2024 10:04                5772
imagick.solarizeimage.php                          14-Apr-2024 10:04                4838
imagick.sparsecolorimage.php                       14-Apr-2024 10:04               26676
imagick.spliceimage.php                            14-Apr-2024 10:04                5800
imagick.spreadimage.php                            14-Apr-2024 10:04                4660
imagick.statisticimage.php                         14-Apr-2024 10:04                6722
imagick.steganoimage.php                           14-Apr-2024 10:04                3039
imagick.stereoimage.php                            14-Apr-2024 10:04                2837
imagick.stripimage.php                             14-Apr-2024 10:04                2514
imagick.subimagematch.php                          14-Apr-2024 10:04                7486
imagick.swirlimage.php                             14-Apr-2024 10:04                4712
imagick.textureimage.php                           14-Apr-2024 10:04                6113
imagick.thresholdimage.php                         14-Apr-2024 10:04                5254
imagick.thumbnailimage.php                         14-Apr-2024 10:04                7512
imagick.tintimage.php                              14-Apr-2024 10:04                7808
imagick.tostring.php                               14-Apr-2024 10:04                2923
imagick.transformimage.php                         14-Apr-2024 10:04                5999
imagick.transformimagecolorspace.php               14-Apr-2024 10:04                5713
imagick.transparentpaintimage.php                  14-Apr-2024 10:04                7228
imagick.transposeimage.php                         14-Apr-2024 10:04                4589
imagick.transverseimage.php                        14-Apr-2024 10:04                4577
imagick.trimimage.php                              14-Apr-2024 10:04                5719
imagick.uniqueimagecolors.php                      14-Apr-2024 10:04                5520
imagick.unsharpmaskimage.php                       14-Apr-2024 10:04                6702
imagick.valid.php                                  14-Apr-2024 10:04                2257
imagick.vignetteimage.php                          14-Apr-2024 10:04                6594
imagick.waveimage.php                              14-Apr-2024 10:04                6327
imagick.whitethresholdimage.php                    14-Apr-2024 10:04                5201
imagick.writeimage.php                             14-Apr-2024 10:04                3017
imagick.writeimagefile.php                         14-Apr-2024 10:04                3768
imagick.writeimages.php                            14-Apr-2024 10:04                2871
imagick.writeimagesfile.php                        14-Apr-2024 10:04                3818
imagickdraw.affine.php                             14-Apr-2024 10:04               16924
imagickdraw.annotation.php                         14-Apr-2024 10:04                3324
imagickdraw.arc.php                                14-Apr-2024 10:04                9641
imagickdraw.bezier.php                             14-Apr-2024 10:04               16814
imagickdraw.circle.php                             14-Apr-2024 10:04                9036
imagickdraw.clear.php                              14-Apr-2024 10:04                2334
imagickdraw.clone.php                              14-Apr-2024 10:04                2427
imagickdraw.color.php                              14-Apr-2024 10:04                3484
imagickdraw.comment.php                            14-Apr-2024 10:04                2710
imagickdraw.composite.php                          14-Apr-2024 10:04               11917
imagickdraw.construct.php                          14-Apr-2024 10:04                2215
imagickdraw.destroy.php                            14-Apr-2024 10:04                2316
imagickdraw.ellipse.php                            14-Apr-2024 10:04               12222
imagickdraw.getclippath.php                        14-Apr-2024 10:04                2302
imagickdraw.getcliprule.php                        14-Apr-2024 10:04                2423
imagickdraw.getclipunits.php                       14-Apr-2024 10:04                2367
imagickdraw.getfillcolor.php                       14-Apr-2024 10:04                2376
imagickdraw.getfillopacity.php                     14-Apr-2024 10:04                2336
imagickdraw.getfillrule.php                        14-Apr-2024 10:04                2385
imagickdraw.getfont.php                            14-Apr-2024 10:04                2269
imagickdraw.getfontfamily.php                      14-Apr-2024 10:04                2329
imagickdraw.getfontsize.php                        14-Apr-2024 10:04                2405
imagickdraw.getfontstretch.php                     14-Apr-2024 10:04                2357
imagickdraw.getfontstyle.php                       14-Apr-2024 10:04                2548
imagickdraw.getfontweight.php                      14-Apr-2024 10:04                2387
imagickdraw.getgravity.php                         14-Apr-2024 10:04                2453
imagickdraw.getstrokeantialias.php                 14-Apr-2024 10:04                2725
imagickdraw.getstrokecolor.php                     14-Apr-2024 10:04                2779
imagickdraw.getstrokedasharray.php                 14-Apr-2024 10:04                2463
imagickdraw.getstrokedashoffset.php                14-Apr-2024 10:04                2437
imagickdraw.getstrokelinecap.php                   14-Apr-2024 10:04                2578
imagickdraw.getstrokelinejoin.php                  14-Apr-2024 10:04                2607
imagickdraw.getstrokemiterlimit.php                14-Apr-2024 10:04                2699
imagickdraw.getstrokeopacity.php                   14-Apr-2024 10:04                2440
imagickdraw.getstrokewidth.php                     14-Apr-2024 10:04                2449
imagickdraw.gettextalignment.php                   14-Apr-2024 10:04                2469
imagickdraw.gettextantialias.php                   14-Apr-2024 10:04                2606
imagickdraw.gettextdecoration.php                  14-Apr-2024 10:04                2506
imagickdraw.gettextencoding.php                    14-Apr-2024 10:04                2431
imagickdraw.gettextinterlinespacing.php            14-Apr-2024 10:04                2394
imagickdraw.gettextinterwordspacing.php            14-Apr-2024 10:04                2418
imagickdraw.gettextkerning.php                     14-Apr-2024 10:04                2313
imagickdraw.gettextundercolor.php                  14-Apr-2024 10:04                2479
imagickdraw.getvectorgraphics.php                  14-Apr-2024 10:04                2529
imagickdraw.line.php                               14-Apr-2024 10:04                8335
imagickdraw.matte.php                              14-Apr-2024 10:04                8359
imagickdraw.pathclose.php                          14-Apr-2024 10:04                2439
imagickdraw.pathcurvetoabsolute.php                14-Apr-2024 10:04                4908
imagickdraw.pathcurvetoquadraticbezierabsolute.php 14-Apr-2024 10:04               11155
imagickdraw.pathcurvetoquadraticbezierrelative.php 14-Apr-2024 10:04                4289
imagickdraw.pathcurvetoquadraticbeziersmoothabs..> 14-Apr-2024 10:04               10297
imagickdraw.pathcurvetoquadraticbeziersmoothrel..> 14-Apr-2024 10:04               10446
imagickdraw.pathcurvetorelative.php                14-Apr-2024 10:04                4924
imagickdraw.pathcurvetosmoothabsolute.php          14-Apr-2024 10:04                4661
imagickdraw.pathcurvetosmoothrelative.php          14-Apr-2024 10:04                4668
imagickdraw.pathellipticarcabsolute.php            14-Apr-2024 10:04                5681
imagickdraw.pathellipticarcrelative.php            14-Apr-2024 10:04                5651
imagickdraw.pathfinish.php                         14-Apr-2024 10:04                2272
imagickdraw.pathlinetoabsolute.php                 14-Apr-2024 10:04                3214
imagickdraw.pathlinetohorizontalabsolute.php       14-Apr-2024 10:04                3064
imagickdraw.pathlinetohorizontalrelative.php       14-Apr-2024 10:04                3059
imagickdraw.pathlinetorelative.php                 14-Apr-2024 10:04                3264
imagickdraw.pathlinetoverticalabsolute.php         14-Apr-2024 10:04                3028
imagickdraw.pathlinetoverticalrelative.php         14-Apr-2024 10:04                3033
imagickdraw.pathmovetoabsolute.php                 14-Apr-2024 10:04                3261
imagickdraw.pathmovetorelative.php                 14-Apr-2024 10:04                3197
imagickdraw.pathstart.php                          14-Apr-2024 10:04               11770
imagickdraw.point.php                              14-Apr-2024 10:04                6869
imagickdraw.polygon.php                            14-Apr-2024 10:04                8953
imagickdraw.polyline.php                           14-Apr-2024 10:04                8957
imagickdraw.pop.php                                14-Apr-2024 10:04                2685
imagickdraw.popclippath.php                        14-Apr-2024 10:04                2231
imagickdraw.popdefs.php                            14-Apr-2024 10:04                7710
imagickdraw.poppattern.php                         14-Apr-2024 10:04                2418
imagickdraw.push.php                               14-Apr-2024 10:04                8432
imagickdraw.pushclippath.php                       14-Apr-2024 10:04                2937
imagickdraw.pushdefs.php                           14-Apr-2024 10:04                2530
imagickdraw.pushpattern.php                        14-Apr-2024 10:04               14612
imagickdraw.rectangle.php                          14-Apr-2024 10:04                8541
imagickdraw.render.php                             14-Apr-2024 10:04                2460
imagickdraw.resetvectorgraphics.php                14-Apr-2024 10:04                2415
imagickdraw.rotate.php                             14-Apr-2024 10:04                7736
imagickdraw.roundrectangle.php                     14-Apr-2024 10:04                9391
imagickdraw.scale.php                              14-Apr-2024 10:04                8082
imagickdraw.setclippath.php                        14-Apr-2024 10:04                8413
imagickdraw.setcliprule.php                        14-Apr-2024 10:04                9424
imagickdraw.setclipunits.php                       14-Apr-2024 10:04                8801
imagickdraw.setfillalpha.php                       14-Apr-2024 10:04                7757
imagickdraw.setfillcolor.php                       14-Apr-2024 10:04                7759
imagickdraw.setfillopacity.php                     14-Apr-2024 10:04                7815
imagickdraw.setfillpatternurl.php                  14-Apr-2024 10:04                3261
imagickdraw.setfillrule.php                        14-Apr-2024 10:04               12961
imagickdraw.setfont.php                            14-Apr-2024 10:04                9268
imagickdraw.setfontfamily.php                      14-Apr-2024 10:04                9880
imagickdraw.setfontsize.php                        14-Apr-2024 10:04                8263
imagickdraw.setfontstretch.php                     14-Apr-2024 10:04                9690
imagickdraw.setfontstyle.php                       14-Apr-2024 10:04                8980
imagickdraw.setfontweight.php                      14-Apr-2024 10:04                9118
imagickdraw.setgravity.php                         14-Apr-2024 10:04               10547
imagickdraw.setresolution.php                      14-Apr-2024 10:04                2896
imagickdraw.setstrokealpha.php                     14-Apr-2024 10:04                8417
imagickdraw.setstrokeantialias.php                 14-Apr-2024 10:04                8956
imagickdraw.setstrokecolor.php                     14-Apr-2024 10:04                8476
imagickdraw.setstrokedasharray.php                 14-Apr-2024 10:04               13398
imagickdraw.setstrokedashoffset.php                14-Apr-2024 10:04                9848
imagickdraw.setstrokelinecap.php                   14-Apr-2024 10:04                8564
imagickdraw.setstrokelinejoin.php                  14-Apr-2024 10:04               11450
imagickdraw.setstrokemiterlimit.php                14-Apr-2024 10:04               11267
imagickdraw.setstrokeopacity.php                   14-Apr-2024 10:04               10213
imagickdraw.setstrokepatternurl.php                14-Apr-2024 10:04                2962
imagickdraw.setstrokewidth.php                     14-Apr-2024 10:04                8448
imagickdraw.settextalignment.php                   14-Apr-2024 10:04                9429
imagickdraw.settextantialias.php                   14-Apr-2024 10:04                8843
imagickdraw.settextdecoration.php                  14-Apr-2024 10:04                7465
imagickdraw.settextencoding.php                    14-Apr-2024 10:04                3144
imagickdraw.settextinterlinespacing.php            14-Apr-2024 10:04                2937
imagickdraw.settextinterwordspacing.php            14-Apr-2024 10:04                2760
imagickdraw.settextkerning.php                     14-Apr-2024 10:04                2846
imagickdraw.settextundercolor.php                  14-Apr-2024 10:04                7781
imagickdraw.setvectorgraphics.php                  14-Apr-2024 10:04                8946
imagickdraw.setviewbox.php                         14-Apr-2024 10:04               10326
imagickdraw.skewx.php                              14-Apr-2024 10:04                8147
imagickdraw.skewy.php                              14-Apr-2024 10:04                8136
imagickdraw.translate.php                          14-Apr-2024 10:04                8474
imagickkernel.addkernel.php                        14-Apr-2024 10:04                7002
imagickkernel.addunitykernel.php                   14-Apr-2024 10:04               13654
imagickkernel.frombuiltin.php                      14-Apr-2024 10:04               26207
imagickkernel.frommatrix.php                       14-Apr-2024 10:04               23139
imagickkernel.getmatrix.php                        14-Apr-2024 10:04                7062
imagickkernel.scale.php                            14-Apr-2024 10:04               13169
imagickkernel.separate.php                         14-Apr-2024 10:04                9690
imagickpixel.clear.php                             14-Apr-2024 10:04                2378
imagickpixel.construct.php                         14-Apr-2024 10:04               11802
imagickpixel.destroy.php                           14-Apr-2024 10:04                2467
imagickpixel.getcolor.php                          14-Apr-2024 10:04                7851
imagickpixel.getcolorasstring.php                  14-Apr-2024 10:04                4831
imagickpixel.getcolorcount.php                     14-Apr-2024 10:04                4891
imagickpixel.getcolorquantum.php                   14-Apr-2024 10:04                2884
imagickpixel.getcolorvalue.php                     14-Apr-2024 10:04                8622
imagickpixel.getcolorvaluequantum.php              14-Apr-2024 10:04                6078
imagickpixel.gethsl.php                            14-Apr-2024 10:04                4334
imagickpixel.getindex.php                          14-Apr-2024 10:04                2260
imagickpixel.ispixelsimilar.php                    14-Apr-2024 10:04                3617
imagickpixel.ispixelsimilarquantum.php             14-Apr-2024 10:04                3209
imagickpixel.issimilar.php                         14-Apr-2024 10:04               16525
imagickpixel.setcolor.php                          14-Apr-2024 10:04                7480
imagickpixel.setcolorcount.php                     14-Apr-2024 10:04                2669
imagickpixel.setcolorvalue.php                     14-Apr-2024 10:04                5154
imagickpixel.setcolorvaluequantum.php              14-Apr-2024 10:04                8453
imagickpixel.sethsl.php                            14-Apr-2024 10:04                7506
imagickpixel.setindex.php                          14-Apr-2024 10:04                2598
imagickpixeliterator.clear.php                     14-Apr-2024 10:04                6290
imagickpixeliterator.construct.php                 14-Apr-2024 10:04                5963
imagickpixeliterator.destroy.php                   14-Apr-2024 10:04                2508
imagickpixeliterator.getcurrentiteratorrow.php     14-Apr-2024 10:04                2602
imagickpixeliterator.getiteratorrow.php            14-Apr-2024 10:04                2527
imagickpixeliterator.getnextiteratorrow.php        14-Apr-2024 10:04                6708
imagickpixeliterator.getpreviousiteratorrow.php    14-Apr-2024 10:04                2671
imagickpixeliterator.newpixeliterator.php          14-Apr-2024 10:04                2761
imagickpixeliterator.newpixelregioniterator.php    14-Apr-2024 10:04                4274
imagickpixeliterator.resetiterator.php             14-Apr-2024 10:04                8698
imagickpixeliterator.setiteratorfirstrow.php       14-Apr-2024 10:04                2602
imagickpixeliterator.setiteratorlastrow.php        14-Apr-2024 10:04                2595
imagickpixeliterator.setiteratorrow.php            14-Apr-2024 10:04                7115
imagickpixeliterator.synciterator.php              14-Apr-2024 10:04                2450
imap.configuration.php                             14-Apr-2024 10:04                3208
imap.constants.php                                 14-Apr-2024 10:04               24780
imap.installation.php                              14-Apr-2024 10:04                2604
imap.requirements.php                              14-Apr-2024 10:04                2997
imap.resources.php                                 14-Apr-2024 10:04                1363
imap.setup.php                                     14-Apr-2024 10:04                1550
index.php                                          14-Apr-2024 10:04               14777
indexes.examples.php                               14-Apr-2024 10:04              682865
indexes.functions.php                              14-Apr-2024 10:04             1156591
indexes.php                                        14-Apr-2024 10:04                1389
infiniteiterator.construct.php                     14-Apr-2024 10:04                5021
infiniteiterator.next.php                          14-Apr-2024 10:04                3282
info.configuration.php                             14-Apr-2024 10:04               19375
info.constants.php                                 14-Apr-2024 10:04               20321
info.installation.php                              14-Apr-2024 10:04                1205
info.requirements.php                              14-Apr-2024 10:04                1162
info.resources.php                                 14-Apr-2024 10:04                1165
info.setup.php                                     14-Apr-2024 10:04                1539
ini.core.php                                       14-Apr-2024 10:04               73057
ini.list.php                                       14-Apr-2024 10:04              100214
ini.php                                            14-Apr-2024 10:04                1546
ini.sections.php                                   14-Apr-2024 10:04                4157
inotify.configuration.php                          14-Apr-2024 10:04                1257
inotify.constants.php                              14-Apr-2024 10:04               10346
inotify.install.php                                14-Apr-2024 10:04                1776
inotify.requirements.php                           14-Apr-2024 10:04                1199
inotify.resources.php                              14-Apr-2024 10:04                1297
inotify.setup.php                                  14-Apr-2024 10:04                1586
install.cloud.azure.php                            14-Apr-2024 10:04                4275
install.cloud.ec2.php                              14-Apr-2024 10:04                1413
install.cloud.php                                  14-Apr-2024 10:04                1606
install.fpm.configuration.php                      14-Apr-2024 10:04               36074
install.fpm.install.php                            14-Apr-2024 10:04                3286
install.fpm.php                                    14-Apr-2024 10:04                3564
install.general.php                                14-Apr-2024 10:04                4322
install.macosx.bundled.php                         14-Apr-2024 10:04               10021
install.macosx.compile.php                         14-Apr-2024 10:04                1307
install.macosx.packages.php                        14-Apr-2024 10:04                2766
install.macosx.php                                 14-Apr-2024 10:04                1878
install.pecl.downloads.php                         14-Apr-2024 10:04                3513
install.pecl.intro.php                             14-Apr-2024 10:04                3029
install.pecl.pear.php                              14-Apr-2024 10:04                2893
install.pecl.php                                   14-Apr-2024 10:04                1942
install.pecl.php-config.php                        14-Apr-2024 10:04                4092
install.pecl.phpize.php                            14-Apr-2024 10:04                2977
install.pecl.static.php                            14-Apr-2024 10:04                3371
install.pecl.windows.php                           14-Apr-2024 10:04                9002
install.php                                        14-Apr-2024 10:04                5408
install.problems.bugs.php                          14-Apr-2024 10:04                1905
install.problems.faq.php                           14-Apr-2024 10:04                1253
install.problems.php                               14-Apr-2024 10:04                1524
install.problems.support.php                       14-Apr-2024 10:04                2314
install.unix.apache2.php                           14-Apr-2024 10:04               12611
install.unix.commandline.php                       14-Apr-2024 10:04                3700
install.unix.debian.php                            14-Apr-2024 10:04                6591
install.unix.lighttpd-14.php                       14-Apr-2024 10:04                6303
install.unix.litespeed.php                         14-Apr-2024 10:04                8938
install.unix.nginx.php                             14-Apr-2024 10:04                8307
install.unix.openbsd.php                           14-Apr-2024 10:04                5623
install.unix.php                                   14-Apr-2024 10:04                6957
install.unix.solaris.php                           14-Apr-2024 10:04                3731
install.windows.apache2.php                        14-Apr-2024 10:04                6812
install.windows.building.php                       14-Apr-2024 10:04                1635
install.windows.commandline.php                    14-Apr-2024 10:04                8143
install.windows.manual.php                         14-Apr-2024 10:04                5190
install.windows.pecl.php                           14-Apr-2024 10:04                1532
install.windows.php                                14-Apr-2024 10:04                3063
install.windows.recommended.php                    14-Apr-2024 10:04                4564
install.windows.requirements.php                   14-Apr-2024 10:04                2178
install.windows.tools.php                          14-Apr-2024 10:04                1743
install.windows.troubleshooting.php                14-Apr-2024 10:04                1656
internaliterator.construct.php                     14-Apr-2024 10:04                1954
internaliterator.current.php                       14-Apr-2024 10:04                2263
internaliterator.key.php                           14-Apr-2024 10:04                2252
internaliterator.next.php                          14-Apr-2024 10:04                2246
internaliterator.rewind.php                        14-Apr-2024 10:04                2281
internaliterator.valid.php                         14-Apr-2024 10:04                2252
intl.configuration.php                             14-Apr-2024 10:04                5301
intl.constants.php                                 14-Apr-2024 10:04               11600
intl.examples.basic.php                            14-Apr-2024 10:04                4286
intl.examples.php                                  14-Apr-2024 10:04                1350
intl.installation.php                              14-Apr-2024 10:04                1718
intl.requirements.php                              14-Apr-2024 10:04                1328
intl.resources.php                                 14-Apr-2024 10:04                1165
intl.setup.php                                     14-Apr-2024 10:04                1549
intlbreakiterator.construct.php                    14-Apr-2024 10:04                4039
intlbreakiterator.createcharacterinstance.php      14-Apr-2024 10:04                3327
intlbreakiterator.createcodepointinstance.php      14-Apr-2024 10:04                2772
intlbreakiterator.createlineinstance.php           14-Apr-2024 10:04                3288
intlbreakiterator.createsentenceinstance.php       14-Apr-2024 10:04                3290
intlbreakiterator.createtitleinstance.php          14-Apr-2024 10:04                3270
intlbreakiterator.createwordinstance.php           14-Apr-2024 10:04                3224
intlbreakiterator.current.php                      14-Apr-2024 10:04                2461
intlbreakiterator.first.php                        14-Apr-2024 10:04                2445
intlbreakiterator.following.php                    14-Apr-2024 10:04                2745
intlbreakiterator.geterrorcode.php                 14-Apr-2024 10:04                2996
intlbreakiterator.geterrormessage.php              14-Apr-2024 10:04                3045
intlbreakiterator.getlocale.php                    14-Apr-2024 10:04                2855
intlbreakiterator.getpartsiterator.php             14-Apr-2024 10:04                3682
intlbreakiterator.gettext.php                      14-Apr-2024 10:04                2578
intlbreakiterator.isboundary.php                   14-Apr-2024 10:04                2715
intlbreakiterator.last.php                         14-Apr-2024 10:04                2444
intlbreakiterator.next.php                         14-Apr-2024 10:04                2879
intlbreakiterator.preceding.php                    14-Apr-2024 10:04                2723
intlbreakiterator.previous.php                     14-Apr-2024 10:04                2500
intlbreakiterator.settext.php                      14-Apr-2024 10:04                3597
intlcalendar.add.php                               14-Apr-2024 10:04                8810
intlcalendar.after.php                             14-Apr-2024 10:04                6805
intlcalendar.before.php                            14-Apr-2024 10:04                4192
intlcalendar.clear.php                             14-Apr-2024 10:04               19079
intlcalendar.construct.php                         14-Apr-2024 10:04                2312
intlcalendar.createinstance.php                    14-Apr-2024 10:04               13557
intlcalendar.equals.php                            14-Apr-2024 10:04               10900
intlcalendar.fielddifference.php                   14-Apr-2024 10:04               11336
intlcalendar.fromdatetime.php                      14-Apr-2024 10:04                8026
intlcalendar.get.php                               14-Apr-2024 10:04                8835
intlcalendar.getactualmaximum.php                  14-Apr-2024 10:04                8742
intlcalendar.getactualminimum.php                  14-Apr-2024 10:04                5925
intlcalendar.getavailablelocales.php               14-Apr-2024 10:04                4434
intlcalendar.getdayofweektype.php                  14-Apr-2024 10:04               10659
intlcalendar.geterrorcode.php                      14-Apr-2024 10:04                9075
intlcalendar.geterrormessage.php                   14-Apr-2024 10:04                6172
intlcalendar.getfirstdayofweek.php                 14-Apr-2024 10:04                8755
intlcalendar.getgreatestminimum.php                14-Apr-2024 10:04                4807
intlcalendar.getkeywordvaluesforlocale.php         14-Apr-2024 10:04                7507
intlcalendar.getleastmaximum.php                   14-Apr-2024 10:04                8389
intlcalendar.getlocale.php                         14-Apr-2024 10:04                6339
intlcalendar.getmaximum.php                        14-Apr-2024 10:04                5458
intlcalendar.getminimaldaysinfirstweek.php         14-Apr-2024 10:04                9047
intlcalendar.getminimum.php                        14-Apr-2024 10:04                4751
intlcalendar.getnow.php                            14-Apr-2024 10:04                5351
intlcalendar.getrepeatedwalltimeoption.php         14-Apr-2024 10:04               10329
intlcalendar.getskippedwalltimeoption.php          14-Apr-2024 10:04               12668
intlcalendar.gettime.php                           14-Apr-2024 10:04                6608
intlcalendar.gettimezone.php                       14-Apr-2024 10:04                7566
intlcalendar.gettype.php                           14-Apr-2024 10:04                5744
intlcalendar.getweekendtransition.php              14-Apr-2024 10:04                5413
intlcalendar.indaylighttime.php                    14-Apr-2024 10:04                8729
intlcalendar.isequivalentto.php                    14-Apr-2024 10:04                8490
intlcalendar.islenient.php                         14-Apr-2024 10:04                8390
intlcalendar.isset.php                             14-Apr-2024 10:04                4851
intlcalendar.isweekend.php                         14-Apr-2024 10:04                8978
intlcalendar.roll.php                              14-Apr-2024 10:04                9526
intlcalendar.set.php                               14-Apr-2024 10:04               16055
intlcalendar.setdate.php                           14-Apr-2024 10:04                4845
intlcalendar.setdatetime.php                       14-Apr-2024 10:04                6659
intlcalendar.setfirstdayofweek.php                 14-Apr-2024 10:04                8905
intlcalendar.setlenient.php                        14-Apr-2024 10:04                5092
intlcalendar.setminimaldaysinfirstweek.php         14-Apr-2024 10:04                5430
intlcalendar.setrepeatedwalltimeoption.php         14-Apr-2024 10:04                6561
intlcalendar.setskippedwalltimeoption.php          14-Apr-2024 10:04                7428
intlcalendar.settime.php                           14-Apr-2024 10:04                8722
intlcalendar.settimezone.php                       14-Apr-2024 10:04               11293
intlcalendar.todatetime.php                        14-Apr-2024 10:04                7174
intlchar.charage.php                               14-Apr-2024 10:04                5873
intlchar.chardigitvalue.php                        14-Apr-2024 10:04                5534
intlchar.chardirection.php                         14-Apr-2024 10:04               10686
intlchar.charfromname.php                          14-Apr-2024 10:04                7259
intlchar.charmirror.php                            14-Apr-2024 10:04                6575
intlchar.charname.php                              14-Apr-2024 10:04                7645
intlchar.chartype.php                              14-Apr-2024 10:04               11579
intlchar.chr.php                                   14-Apr-2024 10:04                5615
intlchar.digit.php                                 14-Apr-2024 10:04                8429
intlchar.enumcharnames.php                         14-Apr-2024 10:04                9089
intlchar.enumchartypes.php                         14-Apr-2024 10:04                5825
intlchar.foldcase.php                              14-Apr-2024 10:04                4068
intlchar.fordigit.php                              14-Apr-2024 10:04                7086
intlchar.getbidipairedbracket.php                  14-Apr-2024 10:04                6335
intlchar.getblockcode.php                          14-Apr-2024 10:04                5592
intlchar.getcombiningclass.php                     14-Apr-2024 10:04                4936
intlchar.getfc-nfkc-closure.php                    14-Apr-2024 10:04                4957
intlchar.getintpropertymaxvalue.php                14-Apr-2024 10:04                6363
intlchar.getintpropertyminvalue.php                14-Apr-2024 10:04                6356
intlchar.getintpropertyvalue.php                   14-Apr-2024 10:04                8067
intlchar.getnumericvalue.php                       14-Apr-2024 10:04                5642
intlchar.getpropertyenum.php                       14-Apr-2024 10:04                6710
intlchar.getpropertyname.php                       14-Apr-2024 10:04                9061
intlchar.getpropertyvalueenum.php                  14-Apr-2024 10:04                7958
intlchar.getpropertyvaluename.php                  14-Apr-2024 10:04               10873
intlchar.getunicodeversion.php                     14-Apr-2024 10:04                3953
intlchar.hasbinaryproperty.php                     14-Apr-2024 10:04                9028
intlchar.isalnum.php                               14-Apr-2024 10:04                5965
intlchar.isalpha.php                               14-Apr-2024 10:04                5851
intlchar.isbase.php                                14-Apr-2024 10:04                6161
intlchar.isblank.php                               14-Apr-2024 10:04                6829
intlchar.iscntrl.php                               14-Apr-2024 10:04                6925
intlchar.isdefined.php                             14-Apr-2024 10:04                6838
intlchar.isdigit.php                               14-Apr-2024 10:04                6172
intlchar.isgraph.php                               14-Apr-2024 10:04                6110
intlchar.isidignorable.php                         14-Apr-2024 10:04                6370
intlchar.isidpart.php                              14-Apr-2024 10:04                7011
intlchar.isidstart.php                             14-Apr-2024 10:04                6442
intlchar.isisocontrol.php                          14-Apr-2024 10:04                5649
intlchar.isjavaidpart.php                          14-Apr-2024 10:04                6934
intlchar.isjavaidstart.php                         14-Apr-2024 10:04                6664
intlchar.isjavaspacechar.php                       14-Apr-2024 10:04                6897
intlchar.islower.php                               14-Apr-2024 10:04                7324
intlchar.ismirrored.php                            14-Apr-2024 10:04                5773
intlchar.isprint.php                               14-Apr-2024 10:04                6245
intlchar.ispunct.php                               14-Apr-2024 10:04                5899
intlchar.isspace.php                               14-Apr-2024 10:04                6643
intlchar.istitle.php                               14-Apr-2024 10:04                7539
intlchar.isualphabetic.php                         14-Apr-2024 10:04                5986
intlchar.isulowercase.php                          14-Apr-2024 10:04                7016
intlchar.isupper.php                               14-Apr-2024 10:04                7322
intlchar.isuuppercase.php                          14-Apr-2024 10:04                7054
intlchar.isuwhitespace.php                         14-Apr-2024 10:04                7476
intlchar.iswhitespace.php                          14-Apr-2024 10:04                7371
intlchar.isxdigit.php                              14-Apr-2024 10:04                7242
intlchar.ord.php                                   14-Apr-2024 10:04                5448
intlchar.tolower.php                               14-Apr-2024 10:04                7746
intlchar.totitle.php                               14-Apr-2024 10:04                7891
intlchar.toupper.php                               14-Apr-2024 10:04                7657
intlcodepointbreakiterator.getlastcodepoint.php    14-Apr-2024 10:04                2703
intldateformatter.create.php                       14-Apr-2024 10:04               29280
intldateformatter.format.php                       14-Apr-2024 10:04               26595
intldateformatter.formatobject.php                 14-Apr-2024 10:04               14656
intldateformatter.getcalendar.php                  14-Apr-2024 10:04               11134
intldateformatter.getcalendarobject.php            14-Apr-2024 10:04                7652
intldateformatter.getdatetype.php                  14-Apr-2024 10:04               11590
intldateformatter.geterrorcode.php                 14-Apr-2024 10:04                8555
intldateformatter.geterrormessage.php              14-Apr-2024 10:04                8533
intldateformatter.getlocale.php                    14-Apr-2024 10:04               12140
intldateformatter.getpattern.php                   14-Apr-2024 10:04               10315
intldateformatter.gettimetype.php                  14-Apr-2024 10:04               11584
intldateformatter.gettimezone.php                  14-Apr-2024 10:04                8654
intldateformatter.gettimezoneid.php                14-Apr-2024 10:04                8872
intldateformatter.islenient.php                    14-Apr-2024 10:04               14678
intldateformatter.localtime.php                    14-Apr-2024 10:04               11536
intldateformatter.parse.php                        14-Apr-2024 10:04               12402
intldateformatter.setcalendar.php                  14-Apr-2024 10:04               14450
intldateformatter.setlenient.php                   14-Apr-2024 10:04               15528
intldateformatter.setpattern.php                   14-Apr-2024 10:04               11551
intldateformatter.settimezone.php                  14-Apr-2024 10:04               12533
intldatepatterngenerator.create.php                14-Apr-2024 10:04                4374
intldatepatterngenerator.getbestpattern.php        14-Apr-2024 10:04                6883
intlgregoriancalendar.construct.php                14-Apr-2024 10:04                5640
intlgregoriancalendar.createfromdate.php           14-Apr-2024 10:04                7350
intlgregoriancalendar.createfromdatetime.php       14-Apr-2024 10:04                8950
intlgregoriancalendar.getgregorianchange.php       14-Apr-2024 10:04                2683
intlgregoriancalendar.isleapyear.php               14-Apr-2024 10:04                3047
intlgregoriancalendar.setgregorianchange.php       14-Apr-2024 10:04                3078
intliterator.current.php                           14-Apr-2024 10:04                2335
intliterator.key.php                               14-Apr-2024 10:04                2304
intliterator.next.php                              14-Apr-2024 10:04                2320
intliterator.rewind.php                            14-Apr-2024 10:04                2348
intliterator.valid.php                             14-Apr-2024 10:04                2323
intlpartsiterator.getbreakiterator.php             14-Apr-2024 10:04                2546
intlrulebasedbreakiterator.construct.php           14-Apr-2024 10:04                3181
intlrulebasedbreakiterator.getbinaryrules.php      14-Apr-2024 10:04                2803
intlrulebasedbreakiterator.getrules.php            14-Apr-2024 10:04                2767
intlrulebasedbreakiterator.getrulestatus.php       14-Apr-2024 10:04                2739
intlrulebasedbreakiterator.getrulestatusvec.php    14-Apr-2024 10:04                2861
intltimezone.construct.php                         14-Apr-2024 10:04                1953
intltimezone.countequivalentids.php                14-Apr-2024 10:04                3675
intltimezone.createdefault.php                     14-Apr-2024 10:04                3003
intltimezone.createenumeration.php                 14-Apr-2024 10:04                4761
intltimezone.createtimezone.php                    14-Apr-2024 10:04                3651
intltimezone.createtimezoneidenumeration.php       14-Apr-2024 10:04                5835
intltimezone.fromdatetimezone.php                  14-Apr-2024 10:04                3772
intltimezone.getcanonicalid.php                    14-Apr-2024 10:04                4398
intltimezone.getdisplayname.php                    14-Apr-2024 10:04                5579
intltimezone.getdstsavings.php                     14-Apr-2024 10:04                3135
intltimezone.getequivalentid.php                   14-Apr-2024 10:04                4081
intltimezone.geterrorcode.php                      14-Apr-2024 10:04                3307
intltimezone.geterrormessage.php                   14-Apr-2024 10:04                3335
intltimezone.getgmt.php                            14-Apr-2024 10:04                2852
intltimezone.getid.php                             14-Apr-2024 10:04                3187
intltimezone.getidforwindowsid.php                 14-Apr-2024 10:04                5847
intltimezone.getoffset.php                         14-Apr-2024 10:04                5099
intltimezone.getrawoffset.php                      14-Apr-2024 10:04                3086
intltimezone.getregion.php                         14-Apr-2024 10:04                3676
intltimezone.gettzdataversion.php                  14-Apr-2024 10:04                3226
intltimezone.getunknown.php                        14-Apr-2024 10:04                3118
intltimezone.getwindowsid.php                      14-Apr-2024 10:04                4418
intltimezone.hassamerules.php                      14-Apr-2024 10:04                3513
intltimezone.todatetimezone.php                    14-Apr-2024 10:04                3436
intltimezone.usedaylighttime.php                   14-Apr-2024 10:04                3112
intro-whatcando.php                                14-Apr-2024 10:04                8202
intro-whatis.php                                   14-Apr-2024 10:04                4212
intro.apache.php                                   14-Apr-2024 10:04                1150
intro.apcu.php                                     14-Apr-2024 10:04                1790
intro.array.php                                    14-Apr-2024 10:04                1903
intro.bc.php                                       14-Apr-2024 10:04                1211
intro.bzip2.php                                    14-Apr-2024 10:04                1154
intro.calendar.php                                 14-Apr-2024 10:04                2005
intro.classobj.php                                 14-Apr-2024 10:04                1756
intro.cmark.php                                    14-Apr-2024 10:04                7303
intro.com.php                                      14-Apr-2024 10:04                3048
intro.componere.php                                14-Apr-2024 10:04                6629
intro.ctype.php                                    14-Apr-2024 10:04                3539
intro.cubrid.php                                   14-Apr-2024 10:04                1436
intro.curl.php                                     14-Apr-2024 10:04                1567
intro.datetime.php                                 14-Apr-2024 10:04                2640
intro.dba.php                                      14-Apr-2024 10:04                1456
intro.dbase.php                                    14-Apr-2024 10:04                6744
intro.dio.php                                      14-Apr-2024 10:04                1655
intro.dom.php                                      14-Apr-2024 10:04                1632
intro.ds.php                                       14-Apr-2024 10:04                1416
intro.eio.php                                      14-Apr-2024 10:04               14342
intro.enchant.php                                  14-Apr-2024 10:04                2569
intro.errorfunc.php                                14-Apr-2024 10:04                1851
intro.ev.php                                       14-Apr-2024 10:04                2239
intro.event.php                                    14-Apr-2024 10:04                1919
intro.exec.php                                     14-Apr-2024 10:04                1688
intro.exif.php                                     14-Apr-2024 10:04                1431
intro.expect.php                                   14-Apr-2024 10:04                1390
intro.fann.php                                     14-Apr-2024 10:04                1369
intro.fdf.php                                      14-Apr-2024 10:04                3785
intro.ffi.php                                      14-Apr-2024 10:04                2817
intro.fileinfo.php                                 14-Apr-2024 10:04                1355
intro.filesystem.php                               14-Apr-2024 10:04                1400
intro.filter.php                                   14-Apr-2024 10:04                2779
intro.fpm.php                                      14-Apr-2024 10:04                1270
intro.ftp.php                                      14-Apr-2024 10:04                1734
intro.funchand.php                                 14-Apr-2024 10:04                1189
intro.gearman.php                                  14-Apr-2024 10:04                1620
intro.gender.php                                   14-Apr-2024 10:04                1288
intro.geoip.php                                    14-Apr-2024 10:04                1527
intro.gettext.php                                  14-Apr-2024 10:04                1503
intro.gmagick.php                                  14-Apr-2024 10:04                1650
intro.gmp.php                                      14-Apr-2024 10:04                3637
intro.gnupg.php                                    14-Apr-2024 10:04                1177
intro.hash.php                                     14-Apr-2024 10:04                1192
intro.hrtime.php                                   14-Apr-2024 10:04                1620
intro.ibase.php                                    14-Apr-2024 10:04                3174
intro.ibm-db2.php                                  14-Apr-2024 10:04                1237
intro.iconv.php                                    14-Apr-2024 10:04                1913
intro.igbinary.php                                 14-Apr-2024 10:04                1632
intro.image.php                                    14-Apr-2024 10:04                6931
intro.imagick.php                                  14-Apr-2024 10:04                1669
intro.imap.php                                     14-Apr-2024 10:04                1645
intro.info.php                                     14-Apr-2024 10:04                1452
intro.inotify.php                                  14-Apr-2024 10:04                2299
intro.intl.php                                     14-Apr-2024 10:04                4971
intro.json.php                                     14-Apr-2024 10:04                1592
intro.ldap.php                                     14-Apr-2024 10:04                4037
intro.libxml.php                                   14-Apr-2024 10:04                1725
intro.lua.php                                      14-Apr-2024 10:04                1225
intro.luasandbox.php                               14-Apr-2024 10:04                2322
intro.lzf.php                                      14-Apr-2024 10:04                1378
intro.mail.php                                     14-Apr-2024 10:04                1174
intro.mailparse.php                                14-Apr-2024 10:04                1894
intro.math.php                                     14-Apr-2024 10:04                1966
intro.mbstring.php                                 14-Apr-2024 10:04                2817
intro.mcrypt.php                                   14-Apr-2024 10:04                2199
intro.memcache.php                                 14-Apr-2024 10:04                1641
intro.memcached.php                                14-Apr-2024 10:04                1834
intro.mhash.php                                    14-Apr-2024 10:04                2795
intro.misc.php                                     14-Apr-2024 10:04                1140
intro.mqseries.php                                 14-Apr-2024 10:04                1701
intro.mysql-xdevapi.php                            14-Apr-2024 10:04                1837
intro.mysql.php                                    14-Apr-2024 10:04                1868
intro.mysqli.php                                   14-Apr-2024 10:04                2119
intro.mysqlnd.php                                  14-Apr-2024 10:04                1897
intro.network.php                                  14-Apr-2024 10:04                1116
intro.oauth.php                                    14-Apr-2024 10:04                1291
intro.oci8.php                                     14-Apr-2024 10:04                1433
intro.opcache.php                                  14-Apr-2024 10:04                1487
intro.openal.php                                   14-Apr-2024 10:04                1210
intro.openssl.php                                  14-Apr-2024 10:04                1537
intro.outcontrol.php                               14-Apr-2024 10:04                1767
intro.parallel.php                                 14-Apr-2024 10:04                6847
intro.parle.php                                    14-Apr-2024 10:04                3396
intro.password.php                                 14-Apr-2024 10:04                1374
intro.pcntl.php                                    14-Apr-2024 10:04                2581
intro.pcre.php                                     14-Apr-2024 10:04                2795
intro.pdo.php                                      14-Apr-2024 10:04                2011
intro.pgsql.php                                    14-Apr-2024 10:04                1535
intro.phar.php                                     14-Apr-2024 10:04                9978
intro.phpdbg.php                                   14-Apr-2024 10:04                5998
intro.posix.php                                    14-Apr-2024 10:04                1687
intro.ps.php                                       14-Apr-2024 10:04                1719
intro.pspell.php                                   14-Apr-2024 10:04                1152
intro.pthreads.php                                 14-Apr-2024 10:04                9106
intro.quickhash.php                                14-Apr-2024 10:04                1224
intro.radius.php                                   14-Apr-2024 10:04                2122
intro.random.php                                   14-Apr-2024 10:04                1066
intro.rar.php                                      14-Apr-2024 10:04                1498
intro.readline.php                                 14-Apr-2024 10:04                1923
intro.recode.php                                   14-Apr-2024 10:04                2229
intro.reflection.php                               14-Apr-2024 10:04                1732
intro.rnp.php                                      14-Apr-2024 10:04                1237
intro.rpminfo.php                                  14-Apr-2024 10:04                1354
intro.rrd.php                                      14-Apr-2024 10:04                1393
intro.runkit7.php                                  14-Apr-2024 10:04                1436
intro.scoutapm.php                                 14-Apr-2024 10:04                1432
intro.seaslog.php                                  14-Apr-2024 10:04                3890
intro.sem.php                                      14-Apr-2024 10:04                3180
intro.session.php                                  14-Apr-2024 10:04                4702
intro.shmop.php                                    14-Apr-2024 10:04                1198
intro.simdjson.php                                 14-Apr-2024 10:04                1186
intro.simplexml.php                                14-Apr-2024 10:04                1276
intro.snmp.php                                     14-Apr-2024 10:04                1616
intro.soap.php                                     14-Apr-2024 10:04                1421
intro.sockets.php                                  14-Apr-2024 10:04                2545
intro.sodium.php                                   14-Apr-2024 10:04                1287
intro.solr.php                                     14-Apr-2024 10:04                1742
intro.spl.php                                      14-Apr-2024 10:04                1532
intro.sqlite3.php                                  14-Apr-2024 10:04                1117
intro.sqlsrv.php                                   14-Apr-2024 10:04                2123
intro.ssdeep.php                                   14-Apr-2024 10:04                1716
intro.ssh2.php                                     14-Apr-2024 10:04                1298
intro.stats.php                                    14-Apr-2024 10:04                1468
intro.stomp.php                                    14-Apr-2024 10:04                1301
intro.stream.php                                   14-Apr-2024 10:04                3893
intro.strings.php                                  14-Apr-2024 10:04                1600
intro.svm.php                                      14-Apr-2024 10:04                1199
intro.svn.php                                      14-Apr-2024 10:04                1760
intro.swoole.php                                   14-Apr-2024 10:04                1605
intro.sync.php                                     14-Apr-2024 10:04                2309
intro.taint.php                                    14-Apr-2024 10:04                4255
intro.tcpwrap.php                                  14-Apr-2024 10:04                1230
intro.tidy.php                                     14-Apr-2024 10:04                1366
intro.tokenizer.php                                14-Apr-2024 10:04                1470
intro.trader.php                                   14-Apr-2024 10:04                2345
intro.ui.php                                       14-Apr-2024 10:04                1158
intro.uodbc.php                                    14-Apr-2024 10:04                2713
intro.uopz.php                                     14-Apr-2024 10:04                2242
intro.url.php                                      14-Apr-2024 10:04                1114
intro.v8js.php                                     14-Apr-2024 10:04                1185
intro.var.php                                      14-Apr-2024 10:04                1279
intro.var_representation.php                       14-Apr-2024 10:04                1386
intro.varnish.php                                  14-Apr-2024 10:04                1275
intro.wddx.php                                     14-Apr-2024 10:04                2102
intro.win32service.php                             14-Apr-2024 10:04                1358
intro.wincache.php                                 14-Apr-2024 10:04                4847
intro.wkhtmltox.php                                14-Apr-2024 10:04                1234
intro.xattr.php                                    14-Apr-2024 10:04                1147
intro.xdiff.php                                    14-Apr-2024 10:04                2569
intro.xhprof.php                                   14-Apr-2024 10:04                2751
intro.xlswriter.php                                14-Apr-2024 10:04                1147
intro.xml.php                                      14-Apr-2024 10:04                2211
intro.xmldiff.php                                  14-Apr-2024 10:04                1368
intro.xmlreader.php                                14-Apr-2024 10:04                1544
intro.xmlrpc.php                                   14-Apr-2024 10:04                1842
intro.xmlwriter.php                                14-Apr-2024 10:04                1506
intro.xsl.php                                      14-Apr-2024 10:04                1295
intro.yac.php                                      14-Apr-2024 10:04                1159
intro.yaconf.php                                   14-Apr-2024 10:04                2506
intro.yaf.php                                      14-Apr-2024 10:04                1507
intro.yaml.php                                     14-Apr-2024 10:04                1384
intro.yar.php                                      14-Apr-2024 10:04                1228
intro.yaz.php                                      14-Apr-2024 10:04                2491
intro.zip.php                                      14-Apr-2024 10:04                1161
intro.zlib.php                                     14-Apr-2024 10:04                2693
intro.zmq.php                                      14-Apr-2024 10:04                1344
intro.zookeeper.php                                14-Apr-2024 10:04                1405
introduction.php                                   14-Apr-2024 10:04                1443
iterator.current.php                               14-Apr-2024 10:04                2121
iterator.key.php                                   14-Apr-2024 10:04                2505
iterator.next.php                                  14-Apr-2024 10:04                2365
iterator.rewind.php                                14-Apr-2024 10:04                2540
iterator.valid.php                                 14-Apr-2024 10:04                2747
iteratoraggregate.getiterator.php                  14-Apr-2024 10:04                2811
iteratoriterator.construct.php                     14-Apr-2024 10:04                3419
iteratoriterator.current.php                       14-Apr-2024 10:04                2696
iteratoriterator.getinneriterator.php              14-Apr-2024 10:04                3143
iteratoriterator.key.php                           14-Apr-2024 10:04                2644
iteratoriterator.next.php                          14-Apr-2024 10:04                2811
iteratoriterator.rewind.php                        14-Apr-2024 10:04                2830
iteratoriterator.valid.php                         14-Apr-2024 10:04                3015
json.configuration.php                             14-Apr-2024 10:04                1226
json.constants.php                                 14-Apr-2024 10:04               16373
json.installation.php                              14-Apr-2024 10:04                1790
json.requirements.php                              14-Apr-2024 10:04                1196
json.resources.php                                 14-Apr-2024 10:04                1165
json.setup.php                                     14-Apr-2024 10:04                1521
jsonserializable.jsonserialize.php                 14-Apr-2024 10:04               12528
langref.php                                        14-Apr-2024 10:04               20163
language.attributes.classes.php                    14-Apr-2024 10:04                6521
language.attributes.overview.php                   14-Apr-2024 10:04               10152
language.attributes.php                            14-Apr-2024 10:04                1690
language.attributes.reflection.php                 14-Apr-2024 10:04                8149
language.attributes.syntax.php                     14-Apr-2024 10:04                6031
language.basic-syntax.comments.php                 14-Apr-2024 10:04                3793
language.basic-syntax.instruction-separation.php   14-Apr-2024 10:04                4258
language.basic-syntax.php                          14-Apr-2024 10:04                1646
language.basic-syntax.phpmode.php                  14-Apr-2024 10:04                4695
language.basic-syntax.phptags.php                  14-Apr-2024 10:04                4908
language.constants.magic.php                       14-Apr-2024 10:04                5580
language.constants.php                             14-Apr-2024 10:04                6260
language.constants.predefined.php                  14-Apr-2024 10:04                1537
language.constants.syntax.php                      14-Apr-2024 10:04               10037
language.control-structures.php                    14-Apr-2024 10:04                2727
language.enumerations.backed.php                   14-Apr-2024 10:04                9822
language.enumerations.basics.php                   14-Apr-2024 10:04                7997
language.enumerations.constants.php                14-Apr-2024 10:04                2326
language.enumerations.examples.php                 14-Apr-2024 10:04                7276
language.enumerations.expressions.php              14-Apr-2024 10:04                6530
language.enumerations.listing.php                  14-Apr-2024 10:04                2162
language.enumerations.methods.php                  14-Apr-2024 10:04               13441
language.enumerations.object-differences.inheri..> 14-Apr-2024 10:04                5965
language.enumerations.object-differences.php       14-Apr-2024 10:04                4704
language.enumerations.overview.php                 14-Apr-2024 10:04                2279
language.enumerations.php                          14-Apr-2024 10:04                2398
language.enumerations.serialization.php            14-Apr-2024 10:04                4831
language.enumerations.static-methods.php           14-Apr-2024 10:04                3179
language.enumerations.traits.php                   14-Apr-2024 10:04                4279
language.errors.basics.php                         14-Apr-2024 10:04                4762
language.errors.php                                14-Apr-2024 10:04                1798
language.errors.php7.php                           14-Apr-2024 10:04                5694
language.exceptions.extending.php                  14-Apr-2024 10:04               19302
language.exceptions.php                            14-Apr-2024 10:04               27378
language.expressions.php                           14-Apr-2024 10:04               15482
language.fibers.php                                14-Apr-2024 10:04                6093
language.functions.php                             14-Apr-2024 10:04                1933
language.generators.comparison.php                 14-Apr-2024 10:04                8819
language.generators.overview.php                   14-Apr-2024 10:04                9043
language.generators.php                            14-Apr-2024 10:04                1548
language.generators.syntax.php                     14-Apr-2024 10:04               23604
language.namespaces.basics.php                     14-Apr-2024 10:04               10687
language.namespaces.definition.php                 14-Apr-2024 10:04                4140
language.namespaces.definitionmultiple.php         14-Apr-2024 10:04                8923
language.namespaces.dynamic.php                    14-Apr-2024 10:04                8045
language.namespaces.fallback.php                   14-Apr-2024 10:04                5860
language.namespaces.faq.php                        14-Apr-2024 10:04               31076
language.namespaces.global.php                     14-Apr-2024 10:04                2648
language.namespaces.importing.php                  14-Apr-2024 10:04               14721
language.namespaces.nested.php                     14-Apr-2024 10:04                2719
language.namespaces.nsconstants.php                14-Apr-2024 10:04                8574
language.namespaces.php                            14-Apr-2024 10:04                2241
language.namespaces.rationale.php                  14-Apr-2024 10:04                6108
language.namespaces.rules.php                      14-Apr-2024 10:04               11697
language.oop5.abstract.php                         14-Apr-2024 10:04               11613
language.oop5.anonymous.php                        14-Apr-2024 10:04               10355
language.oop5.autoload.php                         14-Apr-2024 10:04               11647
language.oop5.basic.php                            14-Apr-2024 10:04               49185
language.oop5.changelog.php                        14-Apr-2024 10:04               13185
language.oop5.cloning.php                          14-Apr-2024 10:04                7975
language.oop5.constants.php                        14-Apr-2024 10:04                7888
language.oop5.decon.php                            14-Apr-2024 10:04               27810
language.oop5.final.php                            14-Apr-2024 10:04                5899
language.oop5.inheritance.php                      14-Apr-2024 10:04               12915
language.oop5.interfaces.php                       14-Apr-2024 10:04               22583
language.oop5.iterations.php                       14-Apr-2024 10:04                5773
language.oop5.late-static-bindings.php             14-Apr-2024 10:04               14198
language.oop5.magic.php                            14-Apr-2024 10:04               43280
language.oop5.object-comparison.php                14-Apr-2024 10:04                8680
language.oop5.overloading.php                      14-Apr-2024 10:04               23692
language.oop5.paamayim-nekudotayim.php             14-Apr-2024 10:04                8315
language.oop5.php                                  14-Apr-2024 10:04                3252
language.oop5.properties.php                       14-Apr-2024 10:04               26995
language.oop5.references.php                       14-Apr-2024 10:04                5658
language.oop5.serialization.php                    14-Apr-2024 10:04                6988
language.oop5.static.php                           14-Apr-2024 10:04                9074
language.oop5.traits.php                           14-Apr-2024 10:04               34632
language.oop5.variance.php                         14-Apr-2024 10:04               15658
language.oop5.visibility.php                       14-Apr-2024 10:04               24225
language.operators.arithmetic.php                  14-Apr-2024 10:04                5986
language.operators.array.php                       14-Apr-2024 10:04                9060
language.operators.assignment.php                  14-Apr-2024 10:04               11616
language.operators.bitwise.php                     14-Apr-2024 10:04               41397
language.operators.comparison.php                  14-Apr-2024 10:04               43044
language.operators.errorcontrol.php                14-Apr-2024 10:04                6071
language.operators.execution.php                   14-Apr-2024 10:04                3397
language.operators.increment.php                   14-Apr-2024 10:04               10895
language.operators.logical.php                     14-Apr-2024 10:04                7735
language.operators.php                             14-Apr-2024 10:04                4052
language.operators.precedence.php                  14-Apr-2024 10:04               20584
language.operators.string.php                      14-Apr-2024 10:04                3109
language.operators.type.php                        14-Apr-2024 10:04               18543
language.references.arent.php                      14-Apr-2024 10:04                3233
language.references.pass.php                       14-Apr-2024 10:04                6839
language.references.php                            14-Apr-2024 10:04                1940
language.references.return.php                     14-Apr-2024 10:04                7452
language.references.spot.php                       14-Apr-2024 10:04                2750
language.references.unset.php                      14-Apr-2024 10:04                2290
language.references.whatare.php                    14-Apr-2024 10:04                2086
language.references.whatdo.php                     14-Apr-2024 10:04               19286
language.types.array.php                           14-Apr-2024 10:04              100045
language.types.boolean.php                         14-Apr-2024 10:04                9520
language.types.callable.php                        14-Apr-2024 10:04               12000
language.types.declarations.php                    14-Apr-2024 10:04               53213
language.types.enumerations.php                    14-Apr-2024 10:04                3602
language.types.float.php                           14-Apr-2024 10:04                9704
language.types.integer.php                         14-Apr-2024 10:04               18294
language.types.intro.php                           14-Apr-2024 10:04                8547
language.types.iterable.php                        14-Apr-2024 10:04                2909
language.types.mixed.php                           14-Apr-2024 10:04                1664
language.types.never.php                           14-Apr-2024 10:04                1883
language.types.null.php                            14-Apr-2024 10:04                3708
language.types.numeric-strings.php                 14-Apr-2024 10:04               10885
language.types.object.php                          14-Apr-2024 10:04                5561
language.types.php                                 14-Apr-2024 10:04                2716
language.types.relative-class-types.php            14-Apr-2024 10:04                2324
language.types.resource.php                        14-Apr-2024 10:04                3097
language.types.string.php                          14-Apr-2024 10:04               79729
language.types.type-juggling.php                   14-Apr-2024 10:04               26546
language.types.type-system.php                     14-Apr-2024 10:04                8359
language.types.value.php                           14-Apr-2024 10:04                2111
language.types.void.php                            14-Apr-2024 10:04                1910
language.variables.basics.php                      14-Apr-2024 10:04               13382
language.variables.external.php                    14-Apr-2024 10:04               17083
language.variables.php                             14-Apr-2024 10:04                1679
language.variables.predefined.php                  14-Apr-2024 10:04                2778
language.variables.scope.php                       14-Apr-2024 10:04               27670
language.variables.superglobals.php                14-Apr-2024 10:04                4187
language.variables.variable.php                    14-Apr-2024 10:04               10012
ldap.configuration.php                             14-Apr-2024 10:04                2374
ldap.constants.php                                 14-Apr-2024 10:04               32744
ldap.controls.php                                  14-Apr-2024 10:04                9848
ldap.examples-basic.php                            14-Apr-2024 10:04                8057
ldap.examples-controls.php                         14-Apr-2024 10:04               15932
ldap.examples.php                                  14-Apr-2024 10:04                1369
ldap.installation.php                              14-Apr-2024 10:04                2797
ldap.requirements.php                              14-Apr-2024 10:04                1483
ldap.resources.php                                 14-Apr-2024 10:04                1376
ldap.setup.php                                     14-Apr-2024 10:04                1548
ldap.using.php                                     14-Apr-2024 10:04                2175
libxml.configuration.php                           14-Apr-2024 10:04                1240
libxml.constants.php                               14-Apr-2024 10:04               13156
libxml.installation.php                            14-Apr-2024 10:04                2550
libxml.requirements.php                            14-Apr-2024 10:04                1239
libxml.resources.php                               14-Apr-2024 10:04                1179
libxml.setup.php                                   14-Apr-2024 10:04                1563
limititerator.construct.php                        14-Apr-2024 10:04                7284
limititerator.current.php                          14-Apr-2024 10:04                3529
limititerator.getposition.php                      14-Apr-2024 10:04                5711
limititerator.key.php                              14-Apr-2024 10:04                3579
limititerator.next.php                             14-Apr-2024 10:04                3269
limititerator.rewind.php                           14-Apr-2024 10:04                3437
limititerator.seek.php                             14-Apr-2024 10:04                4089
limititerator.valid.php                            14-Apr-2024 10:04                3495
locale.acceptfromhttp.php                          14-Apr-2024 10:04                6194
locale.canonicalize.php                            14-Apr-2024 10:04                3156
locale.composelocale.php                           14-Apr-2024 10:04               13415
locale.filtermatches.php                           14-Apr-2024 10:04                9252
locale.getallvariants.php                          14-Apr-2024 10:04                6650
locale.getdefault.php                              14-Apr-2024 10:04                5827
locale.getdisplaylanguage.php                      14-Apr-2024 10:04                9863
locale.getdisplayname.php                          14-Apr-2024 10:04                9845
locale.getdisplayregion.php                        14-Apr-2024 10:04                9811
locale.getdisplayscript.php                        14-Apr-2024 10:04                9818
locale.getdisplayvariant.php                       14-Apr-2024 10:04                9857
locale.getkeywords.php                             14-Apr-2024 10:04                7262
locale.getprimarylanguage.php                      14-Apr-2024 10:04                6051
locale.getregion.php                               14-Apr-2024 10:04                5992
locale.getscript.php                               14-Apr-2024 10:04                5670
locale.lookup.php                                  14-Apr-2024 10:04               10149
locale.parselocale.php                             14-Apr-2024 10:04                7373
locale.setdefault.php                              14-Apr-2024 10:04                5337
lua.assign.php                                     14-Apr-2024 10:04                4598
lua.call.php                                       14-Apr-2024 10:04                7488
lua.configuration.php                              14-Apr-2024 10:04                1219
lua.construct.php                                  14-Apr-2024 10:04                2388
lua.eval.php                                       14-Apr-2024 10:04                3749
lua.getversion.php                                 14-Apr-2024 10:04                2266
lua.include.php                                    14-Apr-2024 10:04                2692
lua.installation.php                               14-Apr-2024 10:04                2030
lua.registercallback.php                           14-Apr-2024 10:04                4546
lua.requirements.php                               14-Apr-2024 10:04                1246
lua.resources.php                                  14-Apr-2024 10:04                1163
lua.setup.php                                      14-Apr-2024 10:04                1508
luaclosure.invoke.php                              14-Apr-2024 10:04                4106
luasandbox.callfunction.php                        14-Apr-2024 10:04                5031
luasandbox.configuration.php                       14-Apr-2024 10:04                1268
luasandbox.disableprofiler.php                     14-Apr-2024 10:04                2855
luasandbox.enableprofiler.php                      14-Apr-2024 10:04                3483
luasandbox.examples-basic.php                      14-Apr-2024 10:04                6586
luasandbox.examples.php                            14-Apr-2024 10:04                1429
luasandbox.getcpuusage.php                         14-Apr-2024 10:04                3598
luasandbox.getmemoryusage.php                      14-Apr-2024 10:04                3178
luasandbox.getpeakmemoryusage.php                  14-Apr-2024 10:04                3228
luasandbox.getprofilerfunctionreport.php           14-Apr-2024 10:04                5975
luasandbox.getversioninfo.php                      14-Apr-2024 10:04                3088
luasandbox.installation.php                        14-Apr-2024 10:04                2128
luasandbox.loadbinary.php                          14-Apr-2024 10:04                3612
luasandbox.loadstring.php                          14-Apr-2024 10:04                5603
luasandbox.pauseusagetimer.php                     14-Apr-2024 10:04                9401
luasandbox.registerlibrary.php                     14-Apr-2024 10:04                6616
luasandbox.requirements.php                        14-Apr-2024 10:04                1732
luasandbox.resources.php                           14-Apr-2024 10:04                1228
luasandbox.setcpulimit.php                         14-Apr-2024 10:04                6127
luasandbox.setmemorylimit.php                      14-Apr-2024 10:04                5532
luasandbox.setup.php                               14-Apr-2024 10:04                1599
luasandbox.unpauseusagetimer.php                   14-Apr-2024 10:04                3151
luasandbox.wrapphpfunction.php                     14-Apr-2024 10:04                4350
luasandboxfunction.call.php                        14-Apr-2024 10:04                8010
luasandboxfunction.construct.php                   14-Apr-2024 10:04                2665
luasandboxfunction.dump.php                        14-Apr-2024 10:04                2429
lzf.configuration.php                              14-Apr-2024 10:04                1219
lzf.constants.php                                  14-Apr-2024 10:04                1097
lzf.installation.php                               14-Apr-2024 10:04                2478
lzf.requirements.php                               14-Apr-2024 10:04                1155
lzf.resources.php                                  14-Apr-2024 10:04                1158
lzf.setup.php                                      14-Apr-2024 10:04                1529
mail.configuration.php                             14-Apr-2024 10:04                8157
mail.constants.php                                 14-Apr-2024 10:04                1106
mail.installation.php                              14-Apr-2024 10:04                1205
mail.requirements.php                              14-Apr-2024 10:04                1843
mail.resources.php                                 14-Apr-2024 10:04                1165
mail.setup.php                                     14-Apr-2024 10:04                1543
mailparse.configuration.php                        14-Apr-2024 10:04                2501
mailparse.constants.php                            14-Apr-2024 10:04                2324
mailparse.installation.php                         14-Apr-2024 10:04                2488
mailparse.requirements.php                         14-Apr-2024 10:04                1197
mailparse.resources.php                            14-Apr-2024 10:04                1519
mailparse.setup.php                                14-Apr-2024 10:04                1607
manual.php                                         14-Apr-2024 10:04                1231
math.configuration.php                             14-Apr-2024 10:04                1226
math.constants.php                                 14-Apr-2024 10:04                7149
math.installation.php                              14-Apr-2024 10:04                1205
math.requirements.php                              14-Apr-2024 10:04                1162
math.resources.php                                 14-Apr-2024 10:04                1165
math.setup.php                                     14-Apr-2024 10:04                1537
mbstring.configuration.php                         14-Apr-2024 10:04               16211
mbstring.constants.php                             14-Apr-2024 10:04                6772
mbstring.encodings.php                             14-Apr-2024 10:04               15375
mbstring.http.php                                  14-Apr-2024 10:04                5032
mbstring.installation.php                          14-Apr-2024 10:04                3295
mbstring.ja-basic.php                              14-Apr-2024 10:04                3656
mbstring.overload.php                              14-Apr-2024 10:04                7150
mbstring.php4.req.php                              14-Apr-2024 10:04                3957
mbstring.requirements.php                          14-Apr-2024 10:04                1190
mbstring.resources.php                             14-Apr-2024 10:04                1193
mbstring.setup.php                                 14-Apr-2024 10:04                1607
mbstring.supported-encodings.php                   14-Apr-2024 10:04                8147
mcrypt.ciphers.php                                 14-Apr-2024 10:04                6189
mcrypt.configuration.php                           14-Apr-2024 10:04                3639
mcrypt.constants.php                               14-Apr-2024 10:04                6399
mcrypt.installation.php                            14-Apr-2024 10:04                1800
mcrypt.requirements.php                            14-Apr-2024 10:04                2093
mcrypt.resources.php                               14-Apr-2024 10:04                1279
mcrypt.setup.php                                   14-Apr-2024 10:04                1574
memcache.add.php                                   14-Apr-2024 10:04                7220
memcache.addserver.php                             14-Apr-2024 10:04               13760
memcache.close.php                                 14-Apr-2024 10:04                5160
memcache.connect.php                               14-Apr-2024 10:04                7420
memcache.constants.php                             14-Apr-2024 10:04                5119
memcache.decrement.php                             14-Apr-2024 10:04                7234
memcache.delete.php                                14-Apr-2024 10:04                6528
memcache.examples-overview.php                     14-Apr-2024 10:04                6392
memcache.examples.php                              14-Apr-2024 10:04                1358
memcache.flush.php                                 14-Apr-2024 10:04                4575
memcache.get.php                                   14-Apr-2024 10:04                8820
memcache.getextendedstats.php                      14-Apr-2024 10:04                8186
memcache.getserverstatus.php                       14-Apr-2024 10:04                6158
memcache.getstats.php                              14-Apr-2024 10:04                4810
memcache.getversion.php                            14-Apr-2024 10:04                5025
memcache.increment.php                             14-Apr-2024 10:04                7032
memcache.ini.php                                   14-Apr-2024 10:04               10656
memcache.installation.php                          14-Apr-2024 10:04                2134
memcache.pconnect.php                              14-Apr-2024 10:04                6262
memcache.replace.php                               14-Apr-2024 10:04                7323
memcache.requirements.php                          14-Apr-2024 10:04                1322
memcache.resources.php                             14-Apr-2024 10:04                1257
memcache.set.php                                   14-Apr-2024 10:04                9681
memcache.setcompressthreshold.php                  14-Apr-2024 10:04                6009
memcache.setserverparams.php                       14-Apr-2024 10:04               11181
memcache.setup.php                                 14-Apr-2024 10:04                1589
memcached.add.php                                  14-Apr-2024 10:04                4652
memcached.addbykey.php                             14-Apr-2024 10:04                5648
memcached.addserver.php                            14-Apr-2024 10:04                7662
memcached.addservers.php                           14-Apr-2024 10:04                5422
memcached.append.php                               14-Apr-2024 10:04                7471
memcached.appendbykey.php                          14-Apr-2024 10:04                5205
memcached.callbacks.php                            14-Apr-2024 10:04                1476
memcached.callbacks.read-through.php               14-Apr-2024 10:04                4320
memcached.callbacks.result.php                     14-Apr-2024 10:04                4820
memcached.cas.php                                  14-Apr-2024 10:04                9425
memcached.casbykey.php                             14-Apr-2024 10:04                5974
memcached.configuration.php                        14-Apr-2024 10:04               28300
memcached.constants.php                            14-Apr-2024 10:04               29373
memcached.construct.php                            14-Apr-2024 10:04                5683
memcached.decrement.php                            14-Apr-2024 10:04                9120
memcached.decrementbykey.php                       14-Apr-2024 10:04                6010
memcached.delete.php                               14-Apr-2024 10:04                5641
memcached.deletebykey.php                          14-Apr-2024 10:04                5625
memcached.deletemulti.php                          14-Apr-2024 10:04                4798
memcached.deletemultibykey.php                     14-Apr-2024 10:04                5805
memcached.expiration.php                           14-Apr-2024 10:04                1875
memcached.fetch.php                                14-Apr-2024 10:04                6730
memcached.fetchall.php                             14-Apr-2024 10:04                6490
memcached.flush.php                                14-Apr-2024 10:04                4660
memcached.get.php                                  14-Apr-2024 10:04               10440
memcached.getallkeys.php                           14-Apr-2024 10:04                3037
memcached.getbykey.php                             14-Apr-2024 10:04                6658
memcached.getdelayed.php                           14-Apr-2024 10:04                8800
memcached.getdelayedbykey.php                      14-Apr-2024 10:04                5803
memcached.getmulti.php                             14-Apr-2024 10:04               20790
memcached.getmultibykey.php                        14-Apr-2024 10:04                5659
memcached.getoption.php                            14-Apr-2024 10:04                5146
memcached.getresultcode.php                        14-Apr-2024 10:04                4236
memcached.getresultmessage.php                     14-Apr-2024 10:04                4676
memcached.getserverbykey.php                       14-Apr-2024 10:04                7391
memcached.getserverlist.php                        14-Apr-2024 10:04                4590
memcached.getstats.php                             14-Apr-2024 10:04                5727
memcached.getversion.php                           14-Apr-2024 10:04                3977
memcached.increment.php                            14-Apr-2024 10:04                8450
memcached.incrementbykey.php                       14-Apr-2024 10:04                5943
memcached.installation.php                         14-Apr-2024 10:04                2626
memcached.ispersistent.php                         14-Apr-2024 10:04                2993
memcached.ispristine.php                           14-Apr-2024 10:04                2920
memcached.prepend.php                              14-Apr-2024 10:04                7502
memcached.prependbykey.php                         14-Apr-2024 10:04                5234
memcached.quit.php                                 14-Apr-2024 10:04                2446
memcached.replace.php                              14-Apr-2024 10:04                4724
memcached.replacebykey.php                         14-Apr-2024 10:04                5735
memcached.requirements.php                         14-Apr-2024 10:04                1496
memcached.resetserverlist.php                      14-Apr-2024 10:04                3160
memcached.resources.php                            14-Apr-2024 10:04                1200
memcached.sessions.php                             14-Apr-2024 10:04                2378
memcached.set.php                                  14-Apr-2024 10:04                9133
memcached.setbykey.php                             14-Apr-2024 10:04                7018
memcached.setmulti.php                             14-Apr-2024 10:04                6197
memcached.setmultibykey.php                        14-Apr-2024 10:04                4957
memcached.setoption.php                            14-Apr-2024 10:04                7317
memcached.setoptions.php                           14-Apr-2024 10:04                6936
memcached.setsaslauthdata.php                      14-Apr-2024 10:04                3507
memcached.setup.php                                14-Apr-2024 10:04                1607
memcached.touch.php                                14-Apr-2024 10:04                3720
memcached.touchbykey.php                           14-Apr-2024 10:04                4671
messageformatter.create.php                        14-Apr-2024 10:04               11010
messageformatter.format.php                        14-Apr-2024 10:04                9681
messageformatter.formatmessage.php                 14-Apr-2024 10:04               14428
messageformatter.geterrorcode.php                  14-Apr-2024 10:04                3964
messageformatter.geterrormessage.php               14-Apr-2024 10:04                7600
messageformatter.getlocale.php                     14-Apr-2024 10:04                5457
messageformatter.getpattern.php                    14-Apr-2024 10:04               10054
messageformatter.parse.php                         14-Apr-2024 10:04                9794
messageformatter.parsemessage.php                  14-Apr-2024 10:04                9991
messageformatter.setpattern.php                    14-Apr-2024 10:04               10598
mhash.configuration.php                            14-Apr-2024 10:04                1233
mhash.constants.php                                14-Apr-2024 10:04                7146
mhash.examples.php                                 14-Apr-2024 10:04                3254
mhash.installation.php                             14-Apr-2024 10:04                1576
mhash.requirements.php                             14-Apr-2024 10:04                1303
mhash.resources.php                                14-Apr-2024 10:04                1172
mhash.setup.php                                    14-Apr-2024 10:04                1555
migration56.changed-functions.php                  14-Apr-2024 10:04                6867
migration56.constants.php                          14-Apr-2024 10:04                6105
migration56.deprecated.php                         14-Apr-2024 10:04                6224
migration56.extensions.php                         14-Apr-2024 10:04                4313
migration56.incompatible.php                       14-Apr-2024 10:04                8455
migration56.new-features.php                       14-Apr-2024 10:04               28905
migration56.new-functions.php                      14-Apr-2024 10:04                7495
migration56.openssl.php                            14-Apr-2024 10:04               25830
migration56.php                                    14-Apr-2024 10:04                2429
migration70.changed-functions.php                  14-Apr-2024 10:04                5189
migration70.classes.php                            14-Apr-2024 10:04                3875
migration70.constants.php                          14-Apr-2024 10:04                9463
migration70.deprecated.php                         14-Apr-2024 10:04                5666
migration70.incompatible.php                       14-Apr-2024 10:04               62183
migration70.new-features.php                       14-Apr-2024 10:04               42455
migration70.new-functions.php                      14-Apr-2024 10:04                7333
migration70.other-changes.php                      14-Apr-2024 10:04                3398
migration70.php                                    14-Apr-2024 10:04                2822
migration70.removed-exts-sapis.php                 14-Apr-2024 10:04                3129
migration70.sapi-changes.php                       14-Apr-2024 10:04                1974
migration71.changed-functions.php                  14-Apr-2024 10:04                7568
migration71.constants.php                          14-Apr-2024 10:04                8746
migration71.deprecated.php                         14-Apr-2024 10:04                2246
migration71.incompatible.php                       14-Apr-2024 10:04               32239
migration71.new-features.php                       14-Apr-2024 10:04               27269
migration71.new-functions.php                      14-Apr-2024 10:04                5030
migration71.other-changes.php                      14-Apr-2024 10:04                8567
migration71.php                                    14-Apr-2024 10:04                2485
migration71.windows-support.php                    14-Apr-2024 10:04                7125
migration72.constants.php                          14-Apr-2024 10:04               31938
migration72.deprecated.php                         14-Apr-2024 10:04               10463
migration72.incompatible.php                       14-Apr-2024 10:04               19672
migration72.new-features.php                       14-Apr-2024 10:04               18946
migration72.new-functions.php                      14-Apr-2024 10:04               24374
migration72.other-changes.php                      14-Apr-2024 10:04                5840
migration72.php                                    14-Apr-2024 10:04                2385
migration73.constants.php                          14-Apr-2024 10:04               25832
migration73.deprecated.php                         14-Apr-2024 10:04                8709
migration73.incompatible.php                       14-Apr-2024 10:04               18076
migration73.new-features.php                       14-Apr-2024 10:04               16744
migration73.new-functions.php                      14-Apr-2024 10:04                7404
migration73.other-changes.php                      14-Apr-2024 10:04               16516
migration73.php                                    14-Apr-2024 10:04                2503
migration73.windows-support.php                    14-Apr-2024 10:04                1801
migration74.constants.php                          14-Apr-2024 10:04                7742
migration74.deprecated.php                         14-Apr-2024 10:04               15241
migration74.incompatible.php                       14-Apr-2024 10:04               18450
migration74.new-classes.php                        14-Apr-2024 10:04                1481
migration74.new-features.php                       14-Apr-2024 10:04               21934
migration74.new-functions.php                      14-Apr-2024 10:04                3697
migration74.other-changes.php                      14-Apr-2024 10:04               21224
migration74.php                                    14-Apr-2024 10:04                2719
migration74.removed-extensions.php                 14-Apr-2024 10:04                1889
migration74.windows-support.php                    14-Apr-2024 10:04                3754
migration80.deprecated.php                         14-Apr-2024 10:04               18750
migration80.incompatible.php                       14-Apr-2024 10:04               98588
migration80.new-features.php                       14-Apr-2024 10:04               32498
migration80.other-changes.php                      14-Apr-2024 10:04               15082
migration80.php                                    14-Apr-2024 10:04                2372
migration81.constants.php                          14-Apr-2024 10:04                8249
migration81.deprecated.php                         14-Apr-2024 10:04               19429
migration81.incompatible.php                       14-Apr-2024 10:04               23245
migration81.new-classes.php                        14-Apr-2024 10:04                2117
migration81.new-features.php                       14-Apr-2024 10:04               23905
migration81.new-functions.php                      14-Apr-2024 10:04                8457
migration81.other-changes.php                      14-Apr-2024 10:04                9856
migration81.php                                    14-Apr-2024 10:04                2592
migration82.constants.php                          14-Apr-2024 10:04               22142
migration82.deprecated.php                         14-Apr-2024 10:04                5851
migration82.incompatible.php                       14-Apr-2024 10:04                9621
migration82.new-features.php                       14-Apr-2024 10:04                7177
migration82.new-functions.php                      14-Apr-2024 10:04                4268
migration82.other-changes.php                      14-Apr-2024 10:04               25771
migration82.php                                    14-Apr-2024 10:04                2639
migration82.windows-support.php                    14-Apr-2024 10:04                2291
migration83.constants.php                          14-Apr-2024 10:04               15487
migration83.deprecated.php                         14-Apr-2024 10:04                7692
migration83.incompatible.php                       14-Apr-2024 10:04               14682
migration83.new-classes.php                        14-Apr-2024 10:04                3369
migration83.new-features.php                       14-Apr-2024 10:04                7224
migration83.new-functions.php                      14-Apr-2024 10:04                7287
migration83.other-changes.php                      14-Apr-2024 10:04               31889
migration83.php                                    14-Apr-2024 10:04                2781
migration83.windows-support.php                    14-Apr-2024 10:04                1367
misc.configuration.php                             14-Apr-2024 10:04                6012
misc.constants.php                                 14-Apr-2024 10:04                2540
misc.installation.php                              14-Apr-2024 10:04                1205
misc.requirements.php                              14-Apr-2024 10:04                1162
misc.resources.php                                 14-Apr-2024 10:04                1165
misc.setup.php                                     14-Apr-2024 10:04                1527
mongodb-bson-binary.construct.php                  14-Apr-2024 10:04                7936
mongodb-bson-binary.getdata.php                    14-Apr-2024 10:04                4407
mongodb-bson-binary.gettype.php                    14-Apr-2024 10:04                4389
mongodb-bson-binary.jsonserialize.php              14-Apr-2024 10:04                5378
mongodb-bson-binary.serialize.php                  14-Apr-2024 10:04                3470
mongodb-bson-binary.tostring.php                   14-Apr-2024 10:04                4193
mongodb-bson-binary.unserialize.php                14-Apr-2024 10:04                4319
mongodb-bson-binaryinterface.getdata.php           14-Apr-2024 10:04                2831
mongodb-bson-binaryinterface.gettype.php           14-Apr-2024 10:04                2841
mongodb-bson-binaryinterface.tostring.php          14-Apr-2024 10:04                3296
mongodb-bson-dbpointer.construct.php               14-Apr-2024 10:04                2654
mongodb-bson-dbpointer.jsonserialize.php           14-Apr-2024 10:04                5447
mongodb-bson-dbpointer.serialize.php               14-Apr-2024 10:04                3545
mongodb-bson-dbpointer.tostring.php                14-Apr-2024 10:04                2673
mongodb-bson-dbpointer.unserialize.php             14-Apr-2024 10:04                3818
mongodb-bson-decimal128.construct.php              14-Apr-2024 10:04                5769
mongodb-bson-decimal128.jsonserialize.php          14-Apr-2024 10:04                5468
mongodb-bson-decimal128.serialize.php              14-Apr-2024 10:04                3570
mongodb-bson-decimal128.tostring.php               14-Apr-2024 10:04                4543
mongodb-bson-decimal128.unserialize.php            14-Apr-2024 10:04                4411
mongodb-bson-decimal128interface.tostring.php      14-Apr-2024 10:04                2994
mongodb-bson-document.construct.php                14-Apr-2024 10:04                3268
mongodb-bson-document.frombson.php                 14-Apr-2024 10:04                4035
mongodb-bson-document.fromjson.php                 14-Apr-2024 10:04                4548
mongodb-bson-document.fromphp.php                  14-Apr-2024 10:04                4270
mongodb-bson-document.get.php                      14-Apr-2024 10:04                4242
mongodb-bson-document.getiterator.php              14-Apr-2024 10:04                3511
mongodb-bson-document.has.php                      14-Apr-2024 10:04                3768
mongodb-bson-document.serialize.php                14-Apr-2024 10:04                3534
mongodb-bson-document.tocanonicalextendedjson.php  14-Apr-2024 10:04               12715
mongodb-bson-document.tophp.php                    14-Apr-2024 10:04                5420
mongodb-bson-document.torelaxedextendedjson.php    14-Apr-2024 10:04               12432
mongodb-bson-document.tostring.php                 14-Apr-2024 10:04                2747
mongodb-bson-document.unserialize.php              14-Apr-2024 10:04                4367
mongodb-bson-int64.construct.php                   14-Apr-2024 10:04                4756
mongodb-bson-int64.jsonserialize.php               14-Apr-2024 10:04                5122
mongodb-bson-int64.serialize.php                   14-Apr-2024 10:04                3447
mongodb-bson-int64.tostring.php                    14-Apr-2024 10:04                3861
mongodb-bson-int64.unserialize.php                 14-Apr-2024 10:04                4290
mongodb-bson-iterator.construct.php                14-Apr-2024 10:04                3356
mongodb-bson-iterator.current.php                  14-Apr-2024 10:04                3604
mongodb-bson-iterator.key.php                      14-Apr-2024 10:04                3601
mongodb-bson-iterator.next.php                     14-Apr-2024 10:04                2387
mongodb-bson-iterator.rewind.php                   14-Apr-2024 10:04                2427
mongodb-bson-iterator.valid.php                    14-Apr-2024 10:04                2810
mongodb-bson-javascript.construct.php              14-Apr-2024 10:04                7247
mongodb-bson-javascript.getcode.php                14-Apr-2024 10:04                4379
mongodb-bson-javascript.getscope.php               14-Apr-2024 10:04                5355
mongodb-bson-javascript.jsonserialize.php          14-Apr-2024 10:04                5464
mongodb-bson-javascript.serialize.php              14-Apr-2024 10:04                3570
mongodb-bson-javascript.tostring.php               14-Apr-2024 10:04                4187
mongodb-bson-javascript.unserialize.php            14-Apr-2024 10:04                4403
mongodb-bson-javascriptinterface.getcode.php       14-Apr-2024 10:04                2925
mongodb-bson-javascriptinterface.getscope.php      14-Apr-2024 10:04                3090
mongodb-bson-javascriptinterface.tostring.php      14-Apr-2024 10:04                3394
mongodb-bson-maxkey.construct.php                  14-Apr-2024 10:04                3632
mongodb-bson-maxkey.jsonserialize.php              14-Apr-2024 10:04                5384
mongodb-bson-maxkey.serialize.php                  14-Apr-2024 10:04                3474
mongodb-bson-maxkey.unserialize.php                14-Apr-2024 10:04                3751
mongodb-bson-minkey.construct.php                  14-Apr-2024 10:04                3632
mongodb-bson-minkey.jsonserialize.php              14-Apr-2024 10:04                5384
mongodb-bson-minkey.serialize.php                  14-Apr-2024 10:04                3474
mongodb-bson-minkey.unserialize.php                14-Apr-2024 10:04                3755
mongodb-bson-objectid.construct.php                14-Apr-2024 10:04                5259
mongodb-bson-objectid.gettimestamp.php             14-Apr-2024 10:04                5483
mongodb-bson-objectid.jsonserialize.php            14-Apr-2024 10:04                5430
mongodb-bson-objectid.serialize.php                14-Apr-2024 10:04                3522
mongodb-bson-objectid.tostring.php                 14-Apr-2024 10:04                4189
mongodb-bson-objectid.unserialize.php              14-Apr-2024 10:04                4357
mongodb-bson-objectidinterface.gettimestamp.php    14-Apr-2024 10:04                2994
mongodb-bson-objectidinterface.tostring.php        14-Apr-2024 10:04                2978
mongodb-bson-packedarray.construct.php             14-Apr-2024 10:04                2888
mongodb-bson-packedarray.fromphp.php               14-Apr-2024 10:04                3951
mongodb-bson-packedarray.get.php                   14-Apr-2024 10:04                4293
mongodb-bson-packedarray.getiterator.php           14-Apr-2024 10:04                3565
mongodb-bson-packedarray.has.php                   14-Apr-2024 10:04                3822
mongodb-bson-packedarray.serialize.php             14-Apr-2024 10:04                3566
mongodb-bson-packedarray.tophp.php                 14-Apr-2024 10:04                4639
mongodb-bson-packedarray.tostring.php              14-Apr-2024 10:04                2763
mongodb-bson-packedarray.unserialize.php           14-Apr-2024 10:04                4423
mongodb-bson-persistable.bsonserialize.php         14-Apr-2024 10:04                6141
mongodb-bson-regex.construct.php                   14-Apr-2024 10:04                7008
mongodb-bson-regex.getflags.php                    14-Apr-2024 10:04                4498
mongodb-bson-regex.getpattern.php                  14-Apr-2024 10:04                4360
mongodb-bson-regex.jsonserialize.php               14-Apr-2024 10:04                5363
mongodb-bson-regex.serialize.php                   14-Apr-2024 10:04                3445
mongodb-bson-regex.tostring.php                    14-Apr-2024 10:04                3888
mongodb-bson-regex.unserialize.php                 14-Apr-2024 10:04                4294
mongodb-bson-regexinterface.getflags.php           14-Apr-2024 10:04                2830
mongodb-bson-regexinterface.getpattern.php         14-Apr-2024 10:04                2873
mongodb-bson-regexinterface.tostring.php           14-Apr-2024 10:04                2904
mongodb-bson-serializable.bsonserialize.php        14-Apr-2024 10:04               16600
mongodb-bson-symbol.construct.php                  14-Apr-2024 10:04                2594
mongodb-bson-symbol.jsonserialize.php              14-Apr-2024 10:04                5384
mongodb-bson-symbol.serialize.php                  14-Apr-2024 10:04                3470
mongodb-bson-symbol.tostring.php                   14-Apr-2024 10:04                2651
mongodb-bson-symbol.unserialize.php                14-Apr-2024 10:04                3757
mongodb-bson-timestamp.construct.php               14-Apr-2024 10:04                4809
mongodb-bson-timestamp.getincrement.php            14-Apr-2024 10:04                4293
mongodb-bson-timestamp.gettimestamp.php            14-Apr-2024 10:04                4278
mongodb-bson-timestamp.jsonserialize.php           14-Apr-2024 10:04                5451
mongodb-bson-timestamp.serialize.php               14-Apr-2024 10:04                3545
mongodb-bson-timestamp.tostring.php                14-Apr-2024 10:04                4031
mongodb-bson-timestamp.unserialize.php             14-Apr-2024 10:04                4390
mongodb-bson-timestampinterface.getincrement.php   14-Apr-2024 10:04                3357
mongodb-bson-timestampinterface.gettimestamp.php   14-Apr-2024 10:04                3372
mongodb-bson-timestampinterface.tostring.php       14-Apr-2024 10:04                2996
mongodb-bson-undefined.construct.php               14-Apr-2024 10:04                2654
mongodb-bson-undefined.jsonserialize.php           14-Apr-2024 10:04                5447
mongodb-bson-undefined.serialize.php               14-Apr-2024 10:04                3545
mongodb-bson-undefined.tostring.php                14-Apr-2024 10:04                2673
mongodb-bson-undefined.unserialize.php             14-Apr-2024 10:04                3819
mongodb-bson-unserializable.bsonunserialize.php    14-Apr-2024 10:04                7060
mongodb-bson-utcdatetime.construct.php             14-Apr-2024 10:04                8159
mongodb-bson-utcdatetime.jsonserialize.php         14-Apr-2024 10:04                5489
mongodb-bson-utcdatetime.serialize.php             14-Apr-2024 10:04                3597
mongodb-bson-utcdatetime.todatetime.php            14-Apr-2024 10:04                5829
mongodb-bson-utcdatetime.tostring.php              14-Apr-2024 10:04                3986
mongodb-bson-utcdatetime.unserialize.php           14-Apr-2024 10:04                4422
mongodb-bson-utcdatetimeinterface.todatetime.php   14-Apr-2024 10:04                3273
mongodb-bson-utcdatetimeinterface.tostring.php     14-Apr-2024 10:04                3012
mongodb-driver-bulkwrite.construct.php             14-Apr-2024 10:04               18650
mongodb-driver-bulkwrite.count.php                 14-Apr-2024 10:04                6933
mongodb-driver-bulkwrite.delete.php                14-Apr-2024 10:04               12036
mongodb-driver-bulkwrite.insert.php                14-Apr-2024 10:04                9608
mongodb-driver-bulkwrite.update.php                14-Apr-2024 10:04               15646
mongodb-driver-clientencryption.addkeyaltname.php  14-Apr-2024 10:04                5546
mongodb-driver-clientencryption.construct.php      14-Apr-2024 10:04               11295
mongodb-driver-clientencryption.createdatakey.php  14-Apr-2024 10:04               10984
mongodb-driver-clientencryption.decrypt.php        14-Apr-2024 10:04                4187
mongodb-driver-clientencryption.deletekey.php      14-Apr-2024 10:04                4287
mongodb-driver-clientencryption.encrypt.php        14-Apr-2024 10:04               12812
mongodb-driver-clientencryption.encryptexpressi..> 14-Apr-2024 10:04               14512
mongodb-driver-clientencryption.getkey.php         14-Apr-2024 10:04                4420
mongodb-driver-clientencryption.getkeybyaltname..> 14-Apr-2024 10:04                5016
mongodb-driver-clientencryption.getkeys.php        14-Apr-2024 10:04                3843
mongodb-driver-clientencryption.removekeyaltnam..> 14-Apr-2024 10:04                5611
mongodb-driver-clientencryption.rewrapmanydatak..> 14-Apr-2024 10:04               12153
mongodb-driver-command.construct.php               14-Apr-2024 10:04               14235
mongodb-driver-commandexception.getresultdocume..> 14-Apr-2024 10:04                3246
mongodb-driver-cursor.construct.php                14-Apr-2024 10:04                3328
mongodb-driver-cursor.current.php                  14-Apr-2024 10:04                3092
mongodb-driver-cursor.getid.php                    14-Apr-2024 10:04                7600
mongodb-driver-cursor.getserver.php                14-Apr-2024 10:04                7493
mongodb-driver-cursor.isdead.php                   14-Apr-2024 10:04               10616
mongodb-driver-cursor.key.php                      14-Apr-2024 10:04                2647
mongodb-driver-cursor.next.php                     14-Apr-2024 10:04                3495
mongodb-driver-cursor.rewind.php                   14-Apr-2024 10:04                3951
mongodb-driver-cursor.settypemap.php               14-Apr-2024 10:04                7967
mongodb-driver-cursor.toarray.php                  14-Apr-2024 10:04                7686
mongodb-driver-cursor.valid.php                    14-Apr-2024 10:04                2835
mongodb-driver-cursorid.construct.php              14-Apr-2024 10:04                2816
mongodb-driver-cursorid.serialize.php              14-Apr-2024 10:04                3568
mongodb-driver-cursorid.tostring.php               14-Apr-2024 10:04                6985
mongodb-driver-cursorid.unserialize.php            14-Apr-2024 10:04                4429
mongodb-driver-cursorinterface.getid.php           14-Apr-2024 10:04                4005
mongodb-driver-cursorinterface.getserver.php       14-Apr-2024 10:04                4106
mongodb-driver-cursorinterface.isdead.php          14-Apr-2024 10:04                4069
mongodb-driver-cursorinterface.settypemap.php      14-Apr-2024 10:04                4106
mongodb-driver-cursorinterface.toarray.php         14-Apr-2024 10:04                3968
mongodb-driver-manager.addsubscriber.php           14-Apr-2024 10:04                5533
mongodb-driver-manager.construct.php               14-Apr-2024 10:04               80087
mongodb-driver-manager.createclientencryption.php  14-Apr-2024 10:04               12629
mongodb-driver-manager.executebulkwrite.php        14-Apr-2024 10:04               22831
mongodb-driver-manager.executecommand.php          14-Apr-2024 10:04               24862
mongodb-driver-manager.executequery.php            14-Apr-2024 10:04               16252
mongodb-driver-manager.executereadcommand.php      14-Apr-2024 10:04               10231
mongodb-driver-manager.executereadwritecommand.php 14-Apr-2024 10:04               11211
mongodb-driver-manager.executewritecommand.php     14-Apr-2024 10:04               11286
mongodb-driver-manager.getencryptedfieldsmap.php   14-Apr-2024 10:04                3903
mongodb-driver-manager.getreadconcern.php          14-Apr-2024 10:04                5897
mongodb-driver-manager.getreadpreference.php       14-Apr-2024 10:04                6492
mongodb-driver-manager.getservers.php              14-Apr-2024 10:04                7933
mongodb-driver-manager.getwriteconcern.php         14-Apr-2024 10:04                5950
mongodb-driver-manager.removesubscriber.php        14-Apr-2024 10:04                4925
mongodb-driver-manager.selectserver.php            14-Apr-2024 10:04                7198
mongodb-driver-manager.startsession.php            14-Apr-2024 10:04               12595
mongodb-driver-monitoring-commandfailedevent.ge..> 14-Apr-2024 10:04                3707
mongodb-driver-monitoring-commandfailedevent.ge..> 14-Apr-2024 10:04                3800
mongodb-driver-monitoring-commandfailedevent.ge..> 14-Apr-2024 10:04                3631
mongodb-driver-monitoring-commandfailedevent.ge..> 14-Apr-2024 10:04                4829
mongodb-driver-monitoring-commandfailedevent.ge..> 14-Apr-2024 10:04                4022
mongodb-driver-monitoring-commandfailedevent.ge..> 14-Apr-2024 10:04                4258
mongodb-driver-monitoring-commandfailedevent.ge..> 14-Apr-2024 10:04                4184
mongodb-driver-monitoring-commandfailedevent.ge..> 14-Apr-2024 10:04                4024
mongodb-driver-monitoring-commandfailedevent.ge..> 14-Apr-2024 10:04                3808
mongodb-driver-monitoring-commandstartedevent.g..> 14-Apr-2024 10:04                4029
mongodb-driver-monitoring-commandstartedevent.g..> 14-Apr-2024 10:04                3739
mongodb-driver-monitoring-commandstartedevent.g..> 14-Apr-2024 10:04                3641
mongodb-driver-monitoring-commandstartedevent.g..> 14-Apr-2024 10:04                5138
mongodb-driver-monitoring-commandstartedevent.g..> 14-Apr-2024 10:04                4719
mongodb-driver-monitoring-commandstartedevent.g..> 14-Apr-2024 10:04                4475
mongodb-driver-monitoring-commandstartedevent.g..> 14-Apr-2024 10:04                4044
mongodb-driver-monitoring-commandstartedevent.g..> 14-Apr-2024 10:04                3828
mongodb-driver-monitoring-commandsubscriber.com..> 14-Apr-2024 10:04                4907
mongodb-driver-monitoring-commandsubscriber.com..> 14-Apr-2024 10:04                4957
mongodb-driver-monitoring-commandsubscriber.com..> 14-Apr-2024 10:04                4970
mongodb-driver-monitoring-commandsucceededevent..> 14-Apr-2024 10:04                3764
mongodb-driver-monitoring-commandsucceededevent..> 14-Apr-2024 10:04                3869
mongodb-driver-monitoring-commandsucceededevent..> 14-Apr-2024 10:04                4916
mongodb-driver-monitoring-commandsucceededevent..> 14-Apr-2024 10:04                4079
mongodb-driver-monitoring-commandsucceededevent..> 14-Apr-2024 10:04                4321
mongodb-driver-monitoring-commandsucceededevent..> 14-Apr-2024 10:04                4689
mongodb-driver-monitoring-commandsucceededevent..> 14-Apr-2024 10:04                4084
mongodb-driver-monitoring-commandsucceededevent..> 14-Apr-2024 10:04                3854
mongodb-driver-monitoring-logsubscriber.log.php    14-Apr-2024 10:04                4637
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Apr-2024 10:04                4790
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Apr-2024 10:04                4760
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Apr-2024 10:04                5327
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Apr-2024 10:04                5372
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Apr-2024 10:04                5403
mongodb-driver-monitoring-sdamsubscriber.server..> 14-Apr-2024 10:04                4790
mongodb-driver-monitoring-sdamsubscriber.topolo..> 14-Apr-2024 10:04                4865
mongodb-driver-monitoring-sdamsubscriber.topolo..> 14-Apr-2024 10:04                4802
mongodb-driver-monitoring-sdamsubscriber.topolo..> 14-Apr-2024 10:04                4785
mongodb-driver-monitoring-serverchangedevent.ge..> 14-Apr-2024 10:04                3173
mongodb-driver-monitoring-serverchangedevent.ge..> 14-Apr-2024 10:04                3489
mongodb-driver-monitoring-serverchangedevent.ge..> 14-Apr-2024 10:04                3241
mongodb-driver-monitoring-serverchangedevent.ge..> 14-Apr-2024 10:04                3566
mongodb-driver-monitoring-serverchangedevent.ge..> 14-Apr-2024 10:04                3289
mongodb-driver-monitoring-serverclosedevent.get..> 14-Apr-2024 10:04                3135
mongodb-driver-monitoring-serverclosedevent.get..> 14-Apr-2024 10:04                3185
mongodb-driver-monitoring-serverclosedevent.get..> 14-Apr-2024 10:04                3245
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Apr-2024 10:04                3621
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Apr-2024 10:04                3473
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Apr-2024 10:04                3310
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Apr-2024 10:04                3339
mongodb-driver-monitoring-serverheartbeatfailed..> 14-Apr-2024 10:04                3695
mongodb-driver-monitoring-serverheartbeatstarte..> 14-Apr-2024 10:04                3315
mongodb-driver-monitoring-serverheartbeatstarte..> 14-Apr-2024 10:04                3357
mongodb-driver-monitoring-serverheartbeatstarte..> 14-Apr-2024 10:04                3715
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Apr-2024 10:04                3673
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Apr-2024 10:04                3382
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Apr-2024 10:04                3391
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Apr-2024 10:04                4216
mongodb-driver-monitoring-serverheartbeatsuccee..> 14-Apr-2024 10:04                3731
mongodb-driver-monitoring-serveropeningevent.ge..> 14-Apr-2024 10:04                3153
mongodb-driver-monitoring-serveropeningevent.ge..> 14-Apr-2024 10:04                3203
mongodb-driver-monitoring-serveropeningevent.ge..> 14-Apr-2024 10:04                3277
mongodb-driver-monitoring-topologychangedevent...> 14-Apr-2024 10:04                3558
mongodb-driver-monitoring-topologychangedevent...> 14-Apr-2024 10:04                3636
mongodb-driver-monitoring-topologychangedevent...> 14-Apr-2024 10:04                3297
mongodb-driver-monitoring-topologyclosedevent.g..> 14-Apr-2024 10:04                3242
mongodb-driver-monitoring-topologyopeningevent...> 14-Apr-2024 10:04                3252
mongodb-driver-query.construct.php                 14-Apr-2024 10:04               32827
mongodb-driver-readconcern.bsonserialize.php       14-Apr-2024 10:04                6778
mongodb-driver-readconcern.construct.php           14-Apr-2024 10:04                5705
mongodb-driver-readconcern.getlevel.php            14-Apr-2024 10:04                5784
mongodb-driver-readconcern.isdefault.php           14-Apr-2024 10:04                8058
mongodb-driver-readconcern.serialize.php           14-Apr-2024 10:04                3645
mongodb-driver-readconcern.unserialize.php         14-Apr-2024 10:04                4480
mongodb-driver-readpreference.bsonserialize.php    14-Apr-2024 10:04               10420
mongodb-driver-readpreference.construct.php        14-Apr-2024 10:04               18433
mongodb-driver-readpreference.gethedge.php         14-Apr-2024 10:04                3415
mongodb-driver-readpreference.getmaxstalenessse..> 14-Apr-2024 10:04                8156
mongodb-driver-readpreference.getmode.php          14-Apr-2024 10:04                7480
mongodb-driver-readpreference.getmodestring.php    14-Apr-2024 10:04                7686
mongodb-driver-readpreference.gettagsets.php       14-Apr-2024 10:04                8041
mongodb-driver-readpreference.serialize.php        14-Apr-2024 10:04                3722
mongodb-driver-readpreference.unserialize.php      14-Apr-2024 10:04                4559
mongodb-driver-runtimeexception.haserrorlabel.php  14-Apr-2024 10:04                4265
mongodb-driver-server.construct.php                14-Apr-2024 10:04                3360
mongodb-driver-server.executebulkwrite.php         14-Apr-2024 10:04               11114
mongodb-driver-server.executecommand.php           14-Apr-2024 10:04               13151
mongodb-driver-server.executequery.php             14-Apr-2024 10:04                8472
mongodb-driver-server.executereadcommand.php       14-Apr-2024 10:04               10553
mongodb-driver-server.executereadwritecommand.php  14-Apr-2024 10:04               11721
mongodb-driver-server.executewritecommand.php      14-Apr-2024 10:04               11762
mongodb-driver-server.gethost.php                  14-Apr-2024 10:04                5447
mongodb-driver-server.getinfo.php                  14-Apr-2024 10:04               10608
mongodb-driver-server.getlatency.php               14-Apr-2024 10:04                7123
mongodb-driver-server.getport.php                  14-Apr-2024 10:04                5489
mongodb-driver-server.getserverdescription.php     14-Apr-2024 10:04                3413
mongodb-driver-server.gettags.php                  14-Apr-2024 10:04                3776
mongodb-driver-server.gettype.php                  14-Apr-2024 10:04                3812
mongodb-driver-server.isarbiter.php                14-Apr-2024 10:04                3629
mongodb-driver-server.ishidden.php                 14-Apr-2024 10:04                3623
mongodb-driver-server.ispassive.php                14-Apr-2024 10:04                3691
mongodb-driver-server.isprimary.php                14-Apr-2024 10:04                3636
mongodb-driver-server.issecondary.php              14-Apr-2024 10:04                3671
mongodb-driver-serverapi.bsonserialize.php         14-Apr-2024 10:04                3298
mongodb-driver-serverapi.construct.php             14-Apr-2024 10:04                5198
mongodb-driver-serverapi.serialize.php             14-Apr-2024 10:04                3598
mongodb-driver-serverapi.unserialize.php           14-Apr-2024 10:04                4447
mongodb-driver-serverdescription.gethellorespon..> 14-Apr-2024 10:04                5187
mongodb-driver-serverdescription.gethost.php       14-Apr-2024 10:04                3438
mongodb-driver-serverdescription.getlastupdatet..> 14-Apr-2024 10:04                3588
mongodb-driver-serverdescription.getport.php       14-Apr-2024 10:04                3493
mongodb-driver-serverdescription.getroundtripti..> 14-Apr-2024 10:04                3892
mongodb-driver-serverdescription.gettype.php       14-Apr-2024 10:04                3828
mongodb-driver-session.aborttransaction.php        14-Apr-2024 10:04                4200
mongodb-driver-session.advanceclustertime.php      14-Apr-2024 10:04                4874
mongodb-driver-session.advanceoperationtime.php    14-Apr-2024 10:04                4814
mongodb-driver-session.committransaction.php       14-Apr-2024 10:04                5556
mongodb-driver-session.construct.php               14-Apr-2024 10:04                2883
mongodb-driver-session.endsession.php              14-Apr-2024 10:04                4332
mongodb-driver-session.getclustertime.php          14-Apr-2024 10:04                3966
mongodb-driver-session.getlogicalsessionid.php     14-Apr-2024 10:04                3123
mongodb-driver-session.getoperationtime.php        14-Apr-2024 10:04                4046
mongodb-driver-session.getserver.php               14-Apr-2024 10:04                3938
mongodb-driver-session.gettransactionoptions.php   14-Apr-2024 10:04                3821
mongodb-driver-session.gettransactionstate.php     14-Apr-2024 10:04                3725
mongodb-driver-session.isdirty.php                 14-Apr-2024 10:04                3008
mongodb-driver-session.isintransaction.php         14-Apr-2024 10:04                3787
mongodb-driver-session.starttransaction.php        14-Apr-2024 10:04                9084
mongodb-driver-topologydescription.getservers.php  14-Apr-2024 10:04                3450
mongodb-driver-topologydescription.gettype.php     14-Apr-2024 10:04                3498
mongodb-driver-topologydescription.hasreadables..> 14-Apr-2024 10:04                3937
mongodb-driver-topologydescription.haswritables..> 14-Apr-2024 10:04                3218
mongodb-driver-writeconcern.bsonserialize.php      14-Apr-2024 10:04                7223
mongodb-driver-writeconcern.construct.php          14-Apr-2024 10:04               10512
mongodb-driver-writeconcern.getjournal.php         14-Apr-2024 10:04                5970
mongodb-driver-writeconcern.getw.php               14-Apr-2024 10:04                5260
mongodb-driver-writeconcern.getwtimeout.php        14-Apr-2024 10:04                5892
mongodb-driver-writeconcern.isdefault.php          14-Apr-2024 10:04                7845
mongodb-driver-writeconcern.serialize.php          14-Apr-2024 10:04                3670
mongodb-driver-writeconcern.unserialize.php        14-Apr-2024 10:04                4519
mongodb-driver-writeconcernerror.getcode.php       14-Apr-2024 10:04                6307
mongodb-driver-writeconcernerror.getinfo.php       14-Apr-2024 10:04                6633
mongodb-driver-writeconcernerror.getmessage.php    14-Apr-2024 10:04                6398
mongodb-driver-writeerror.getcode.php              14-Apr-2024 10:04                5649
mongodb-driver-writeerror.getindex.php             14-Apr-2024 10:04                6178
mongodb-driver-writeerror.getinfo.php              14-Apr-2024 10:04                3120
mongodb-driver-writeerror.getmessage.php           14-Apr-2024 10:04                5785
mongodb-driver-writeexception.getwriteresult.php   14-Apr-2024 10:04                7910
mongodb-driver-writeresult.getdeletedcount.php     14-Apr-2024 10:04                8139
mongodb-driver-writeresult.getinsertedcount.php    14-Apr-2024 10:04                8221
mongodb-driver-writeresult.getmatchedcount.php     14-Apr-2024 10:04                8784
mongodb-driver-writeresult.getmodifiedcount.php    14-Apr-2024 10:04                9082
mongodb-driver-writeresult.getserver.php           14-Apr-2024 10:04                6514
mongodb-driver-writeresult.getupsertedcount.php    14-Apr-2024 10:04                8310
mongodb-driver-writeresult.getupsertedids.php      14-Apr-2024 10:04                8795
mongodb-driver-writeresult.getwriteconcernerror..> 14-Apr-2024 10:04                7185
mongodb-driver-writeresult.getwriteerrors.php      14-Apr-2024 10:04               13006
mongodb-driver-writeresult.isacknowledged.php      14-Apr-2024 10:04                8164
mongodb.architecture.php                           14-Apr-2024 10:04                1922
mongodb.configuration.php                          14-Apr-2024 10:04                3955
mongodb.connection-handling.php                    14-Apr-2024 10:04                8662
mongodb.constants.php                              14-Apr-2024 10:04                2093
mongodb.exceptions.php                             14-Apr-2024 10:04                5149
mongodb.exceptions.tree.php                        14-Apr-2024 10:04                5559
mongodb.installation.homebrew.php                  14-Apr-2024 10:04                1976
mongodb.installation.manual.php                    14-Apr-2024 10:04                6107
mongodb.installation.pecl.php                      14-Apr-2024 10:04                4964
mongodb.installation.php                           14-Apr-2024 10:04                1776
mongodb.installation.windows.php                   14-Apr-2024 10:04                4332
mongodb.monitoring.php                             14-Apr-2024 10:04               18962
mongodb.overview.php                               14-Apr-2024 10:04                4599
mongodb.persistence.deserialization.php            14-Apr-2024 10:04               21778
mongodb.persistence.php                            14-Apr-2024 10:04                1811
mongodb.persistence.serialization.php              14-Apr-2024 10:04               20074
mongodb.requirements.php                           14-Apr-2024 10:04                3113
mongodb.security.php                               14-Apr-2024 10:04                1484
mongodb.security.request_injection.php             14-Apr-2024 10:04                2970
mongodb.security.script_injection.php              14-Apr-2024 10:04                9159
mongodb.setup.php                                  14-Apr-2024 10:04                2019
mongodb.tutorial.apm.php                           14-Apr-2024 10:04               18727
mongodb.tutorial.library.php                       14-Apr-2024 10:04               10666
mongodb.tutorial.php                               14-Apr-2024 10:04                1694
mqseries.configure.php                             14-Apr-2024 10:04                2816
mqseries.constants.php                             14-Apr-2024 10:04                2635
mqseries.ini.php                                   14-Apr-2024 10:04                1301
mqseries.requirements.php                          14-Apr-2024 10:04                1587
mqseries.resources.php                             14-Apr-2024 10:04                1639
mqseries.setup.php                                 14-Apr-2024 10:04                1592
multipleiterator.attachiterator.php                14-Apr-2024 10:04                4588
multipleiterator.construct.php                     14-Apr-2024 10:04                8592
multipleiterator.containsiterator.php